3FYTA

Crystal structure of bacillus pumilus acetyl xylan esterase s181a mutant in complex with beta-d-xylopyranose
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
315
structure length
315
Chain Sequence
FDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGAQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
total genus 113
structure length 315
sequence length 315
chains with identical sequence B, C, D, E, F, G, H, I, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fytA00
4CG3A 5YASA 2OGZA 4FOLA 4H7EA 1EDEA 4ROTA 2HU5A 2HFJA 1QFMA 5JZ9A 3I6ZA 3ZPXA 3STUA 5KWIA 1CVLA 4U2GA 5LP1A 4FNMA 3WJ2A 4KRYA 1E89A 2QMQA 2HADA 3C8DA 1AUOA 2RIPA 3Q8WA 1YA8A 4FLFA 3IURA 1HKHA 5AKGA 1CQWA 2UZ0A 1IUNA 5HFNA 3PDCA 5AOAA 3PUHA 5E2IA 4B7ZA 1WB5A 4GW3A 3I1IA 2VEOA 3H1BA 4EBBA 2BGNA 2XMCA 1UWCA 1VLQA 2WJ6A 1TCBA 5HK9A 1QIFA 1IZ7A 3STXA 3ZLUA 1R50A 2X8BA 4G1FA 1QO9A 1QONA 4PSDA 4L9AA 3WK7A 5IVIA 3QVMA 4LKOA 1XZJA 4C88A 1CV2A 5AKEA 1XRRA 4MJ3A 1XQYA 4X97A 1R4ZA 3G02A 4RE6A 4DMFA 1BEZA 2VAVA 3D2AA 4KE6A 2VTVA 4Q05A 5K3CA 4M0FA 5DLPA 4J7AA 4DYHA 4W63A 1E8NA 1SFRA 2ZSHA 2J3QA 1K5PA 3ICWA 4IH4A 2QUAA 4AB1A 1HLGA 4E15A 3G8YA 2HU7A 2E3JA 2QOEA 5FPPA 4N5IX 3S2ZA 3HSSA 3CN7A 4CIBA 3I2KA 5BV7A 5JAOA 1CUAA 1HL7A 1OCEA 5K5EA 4AO6A 5LKRA 4LHEA 4KACA 3WK6A 5T4EA 5AIAA 4N8EA 1EINA 4XJVA 4IHAA 3DYIA 1A8QA 1EDBA 4A5SA 3R40A 5ALKA 4UHEA 5AKLA 3ANSA 2BAGA 5IH7A 4UBIA 5K3EA 4BBZA 4CG2A 3O4GA 3F8SA 1AC5A 4X3CA 4HXFB 5DTIA 1EXWA 3ICVA 5ESRA 1THGA 1VKHA 2I78A 1BU8A 3GFFA 2RHWA 1XLWA 3A6ZA 3M81A 5EHQA 5IKXA 1AZWA 5AOBA 4WY8A 2I03A 1LPSA 3H2KA 2OXEA 1VXOA 1JFRA 3AFIA 3F67A 4E11A 2BGRA 2YASA 1DT5A 4KAFA 1XRMA 4MWTA 2OG1A 4U2BA 2G5PA 3IUMA 5AH0A 3FLBA 1UT6A 3FVTA 2DQZA 2JEYA 1MX1A 3AUKA 1Q84A 2AJLI 2K2QB 1C7JA 1BS9A 4TVKA 4H0CA 1G5FA 3AIMA 5AKIA 2PBLA 4Y2SA 4AN0A 5CT6A 4ZXFA 1QE3A 5HCUA 5JAHA 1FFBA 3W04A 1U8EA 2PVSA 4IQ4A 4UHFA 5K3BA 4W1SA 4GI1A 3QPAA 1F6WA 4EY6A 2OQVA 2HA0A 3NUZA 2JIDA 5AI4A 1XZIA 1K8QA 5ALVA 2OCGA 2XMQA 5DYWA 3OC0A 5ALWA 4I19A 1ZD3A 3O4HA 4GDMA 3W9BA 2XQFA 5LKAA 1XZMA 5D7BA 5K3AA 4AN1A 3ZLTA 2ECFA 1J1IA 1CUYA 1KEZA 4BAZA 4OSEA 1MU0A 1MO2A 3ESCA 4ZWNA 1JU4A 4QWMA 1QO7A 3W05A 3FYUA 1QIIA 1XFDA 3NWOA 2OPHA 3QPDA 5KBYA 4Y2VA 1LPOA 1F8UA 1LPMA 5AM0A 3WWDA 2YXPX 1OILA 3BDIA 3F97A 1ORWA 2WU4A 5ALIA 4C4ZA 5JZBA 5EFZA 1UK7A 5KWJA 2AJ8A 2WFZA 2BKLA 2OAEA 5FDFA 1DINA 1XLVA 1XRNA 4G4IA 1H2WA 3OTQA 5ALEA 5ALYA 5AK6A 1DQZA 3RARA 4BP9A 5HF9A 3O9VA 4C89A 4Y7DA 5FOQA 2WG1A 4G8BA 4HXGA 3I6MA 3KWJA 1ZD5A 1ZJ5A 3DOHA 3I2FA 4OU5A 1DU4A 3R3WA 5JYCA 1R3DA 1W75A 2ZYIA 1CUVA 2PX6A 5CH5A 3G0DA 5DNWA 3L1HA 1RYYA 1CUDA 4UUQA 2WIGA 4FLEA 3OPMA 3HC7A 3HXKA 5ALZA 3WIOA 2HA6A 1DX6A 4Z49A 1ZICA 3BWXA 3G9XA 3FLAA 5ALNA 5EHNA 4QDXA 2RONA 3NGMA 1YCDA 1DX4A 4AO7A 4BDTA 3LCRA 2CB9A 3W06A 3H2GA 2DHCA 4X85A 4FHZA 4UFOA 5AKXA 4Q3LA 4BCDA 2GBGA 2FUKA 5F4ZA 4DLNA 2C5GA 1WOMA 2JEZA 2QVBA 4HRXA 1XZKA 2BUCA 1EDDA 5JD4A 2QUBA 5ALLA 1U4NA 4G4GA 4LYEA 2WJ4A 1TQHA 3QH4A 1NU8A 1L7QA 3R3ZA 5LYYA 1BN7A 4XIIA 4Q34A 3OURA 3O4IA 4BAUA 4MEBA 4B9EA 4F21A 1R9MA 1XRQA 1O6FA 3G0BA 5CT8A 1CUXA 3FYUB 4N8DA 4AXBA 2HDWA 4UBLA 1GXSA 4JYMA 4KE8A 1W52X 1SOMA 2WHPA 1QIDA 1AGYA 2XUQA 4M0MA 4FLMA 5CH3A 3V48A 4BCCA 4BVJA 1UXOA 3TGLA 1USWA 1JMYA 4HXEB 2QRUA 4PQEA 5CT9A 4HRYA 4B0PA 4XX1A 1UOOA 2XMGA 3D2BA 1E66A 4TPKA 4H7FA 5AI8A 1BN6A 1XZGA 3BJRA 4DNOA 4FDMA 4EB0A 1A8SA 1QZ3A 1GGVA 4KEAA 4EY7A 3D59A 1P0PA 2V9ZA 4YK7A 5C81A 2PSJA 3H18A 4DMHA 5FPQA 1YAJA 4BC1A 3F9CA 1U2EA 1XLUA 2OGTA 1UKCA 2EDCA 3SK0A 2FX5A 2JGKA 2H9YA 3PF9A 3K2IA 1H2XA 3GUUA 4H7KA 4JYPA 5KREA 5JASA 1A7UA 1AKNA 1SC9A 1T4MA 2O2IA 3CN9A 3FOBA 3VJMA 1WHSA 4OYYA 2BCEA 5HF8A 1E8DA 3WWEA 1XZBA 1LPPA 4BRZA 5HFAA 2X76A 2HRQA 4GLBA 1QLWA 4OUKX 4RPCA 1AX9A 1VE6A 2WTNA 3T52A 3BDVA 3AZQA 3WK9A 3PUIA 3TEJA 5FP0A 1UFOA 2WG0A 2WIDA 1GT6A 1W6RA 4HZGA 2PU5A 5A2GA 1CUGA 5EHZA 2JGFA 1FFCA 3E4DA 1YA4A 2Q0XA 1A8UA 3RM3A 4Y2TA 3C8HA 3JW8A 4W9RA 5JADA 4QZVA 5T4BA 4GWLA 1X70A 2H1IA 2AJDA 2QT9A 1LLFA 2H7XA 4H35A 5AK5A 1HDEA 2OQIA 1XZFA 3WL7A 2Z3ZA 3VVLA 3ZI7A 4HAIA 2WTMA 3WKAA 2ROQA 1B41A 5I8PA 4X6UA 1YASA 2HA5A 2WHPB 1FSSA 2XMSA 1NU6A 3IB3A 3BF8A 4CCWA 3QITA 4Y2JA 1XKTA 2HA7A 1GPKA 5I7UA 1D07A 1VZ2A 3LP5A 3G7NA 3C70A 5FUMA 2BUBA 4UBNA 5AO9A 2XUAA 3C5VA 4INZA 2ZJ6A 1E3QA 1UK8A 1CUWA 3F96A 2WSLA 4FFWA 3QYJA 1UK6A 4H7JA 1A88A 1JJIA 3DD5A 3DDUA 5CH8A 1Y37A 1ZGBA 2XMBA 1CUJA 3OM8A 4WFKA 2XUOA 1ODTC 4XVCA 2XUHA 5ISMA 1EB9A 1PJAA 1THTA 2WFLB 3DJYA 1ISPA 5HQ3A 4Q3KA 3KSRA 3HZOA 4FBMA 1GKKA 4P08A 5T4FA 1EK1A 1XQVA 4BZZA 4C4XA 3VDXA 1J2EA 1SCKA 3BL8A 1E5TA 3A2LA 1ODCA 4JUIA 2WILA 5AIBA 2XQJA 2GBCA 1FFDA 3BXPA 1N5MA 4FKBA 3F98A 5ALHA 2VT7A 5CTAA 2Y2VA 5D3ZA 5ALSA 1ZI9A 1YR2A 2XLBA 4LIPD 1CUBA 4WFIA 1I6WA 2RI6A 3FAKA 2JGIA 2XMRA 2VJBA 5FXMA 3B5EA 3TRDA 4K6KA 1ZI6A 2GYUA 3PF8A 4WDQA 4J0IA 4BCBA 5E4YA 4ZV9A 2C0PA 3VJLA 1UKAA 1LZLA 4G8DA 4C01A 1Q83A 4AO8A 2HHAA 4DMCA 2NW6A 4MEAA 4OPMA 3R3XA 4IO0A 4UHCA 2DCMA 1LGYA 1S8OA 4Y2YA 1EI9A 2O2GA 1CUUA 4K5QA 5AI6A 5AM1A 4U2EA 3EQ9A 5SYMA 1G42A 4JNCA 3H17A 2AJCA 4PO3X 1CR6A 3DOIA 4NZZA 3FSGA 5LZ8A 4J0DA 3V1MA 4CFSA 2JGLA 2CMFA 4WFJA 5AJHA 3NOXA 1JI3A 3WWOA 5AKJA 1AQLA 2ORYA 1N1MA 3E0XA 3I28A 1IVYA 3UUFA 3V1LA 5E4JA 4QE3A 4DSAA 4KJXA 1VA5A 5EHXA 1XZDA 2V97A 3MVEA 3WKBA 2HA3A 4CIAA 3I2JA 2QZPA 1Y7HA 4BVKA 5AOCA 4O08A 4GBGA 1EVEA 2WQZA 5FV4A 2VJCA 2WFMA 1CUIA 2IITA 5CURA 2XT0A 4AZ0A 4E14A 2HU8A 5SYNA 5HKAA 4UFPA 4KRXA 1JMKC 4EY5A 3HLKA 5HQ3B 1QIGA 1DQYA 3QMVA 3M82A 4AMZA 3W2TA 4Y2PA 1P0QA 2FJ0A 4AZ3A 1BEEA 3YASA 3GELA 1GKLA 3IUJA 5DJ5A 1WB6A 3AZOA 2LIPA 3DNMA 4H77A 1YS1X 2JBWA 4B0OA 5I9IA 4C4YA 4ARAA 1T2NA 3OOSA 4YX9A 5JANA 3EQ8A 1YAHA 3C6ZA 1IUPA 2WG2A 3H2HA 3U0VA 4EY4A 4A16A 4X71A 3STWA 1QIHA 2QS9A 3A70A 4G8CA 4J0JA 5EI5A 3D2CA 1YB6A 5JALA 4G9EA 3FBWA 3GZJA 2J3DA 1CUCA 3HEAA 2ZJ7A 3WZMA 3SWWA 1UZAA 5JATA 1WCYA 1XQXA 2QR5A 3VVMA 1WM1A 4DIUA 4E46A 4N5HX 4UPDA 5JD5A 1N8SA 1K6EA 2ZYRA 1FFAA 3HYSA 4QLOA 1Q0ZA 5EIHA 2QM0A 3VKFA 5A7GA 2WUGA 3MUOA 1KU0A 1MT3A 1QTIA 4QDOA 3WQHA 4CCYA 2OAGA 3G0IA 3FLEA 4B81A 2WHQA 2D5LA 4IH1A 2HFKA 3I2GA 2I3DA 2I3ZA 5ALXA 2VJDA 1R9NA 3KWFA 4BDSA 1XZAA 4EUSA 4G4JA 1LPBB 3DCNA 2ZJFA 1ACJA 5C8ZA 3CCCA 4BE9A 2JGJA 1M33A 1LPAB 4NS4A 5LZ5A 3IBTA 2XI4A 2XQKA 3WLAA 2XUGA 1CUHA 4QA9A 3PE6A 5A6VA 2BFNA 3HI4A 4K6GA 1CLEA 2XDWA 5BWCA 1ZOIA 3DQZA 4UHHA 1C7IA 2XE4A 1F0PA 3WJ1A 4KR0A 4U2DA 4J03A 4B80A 3FSGD 4BZWA 3FNBA 1ODSA 2CZQA 1VOTA 4OB7A 3ZWQA 5AP9A 3G9ZA 5DNUA 3PFCA 3FYUC 3HABA 4Y2UA 5D6OA 5DWDA 3IVMA 3DS8A 2PSEA 3WK4A 4X95A 4GEGA 2ACEA 1WPRA 1QJ4A 4QDUA 1XRLA 2X5XA 1JKMA 5IVKA 2VA9A 1XZLA 1E8MA 1MN6A 4HVTA 5LZ2A 5IVHA 1DWPA 2BUAA 3ESAA 2CUTA 3BIWA 3KD2A 2PUJA 3EF3A 1ZJ4A 4P93A 4KAJA 2CJPA 3V1NA 4DTCA 4X6XA 1LPNA 2DQYA 4PV7A 5AM3A 1WPXA 4MYSA 4BP8A 4F60A 2AJBA 1K4YA 3D5EA 3RKSA 3JYHA 4L3WA 2WIFA 4NVRA 5HF5A 4DNQA 3G0CA 4EY8A 1ETHA 5DYTA 3MUNA 3DL4A 4GXNA 1X2BA 2C0QA 2QJWA 3LIPA 3N2ZB 4DGQA 3WI7A 3BF7A 1EHYA 3DYVA 4OD0A 5AKKA 4IH9A 1CUFA 1MNAA 2V98A 2HM7A 4KYVA 1B6GA 2HL6A 4KAAA 4DSZA 1GQRA 3G0GA 3WA6A 2C5FA 3HJUA 4J3JA 4FWBA 2XB6A 1P0IA 5ALMA 2HA4A 4ITVA 5AM5A 3AJAA 1QIMA 4I4CA 4M0EA 3B3QA 4H7HA 3C6XA 4RGYA 1O6GA 2WU3A 4D9JA 4OCZA 1H2ZA 3I2IA 3WK5A 3AILA 5JZSA 4F5ZA 1MNQA 2QXTA 2WUEA 5H3HA 2XUFA 2ONCA 3EQ7A 4QDTA 4NMWA 5FRDA 1X2EA 1AMNA 1JJFA 4PNZA 2P8SA 5CBKA 1LBSA 1EB8A 3AIOA 1QIKA 2VATA 1CUEA 3I6YA 3DKKA 1SCQA 2ZYSA 4UBMA 1FFEA 4ARBA 4U2FA 1CRLA 3DKRA 2ES4A 4JH0A 2OLEA 5AM4A 5JAPA 5FKJA 1IUOA 3BIXA 4Q1VA 3R3VA 5EGNA 5AI5A 2GYWA 4X92A 1W76A 3RK4A 3TJMA 4ZREA 5FLKA 5AK3A 2XQGA 2QXUA 1QIEA 5LZ7A 3S8YA 1SCIA 1J07A 3HRHA 1XZCA 1R1DA 2Z5GA 4BTLA 1FJ2A 2OCKA 1P0MA 3H2JA 3HACA 4B85A 1EX9A 2RGUA 1DTEA 5CT4A 4EA6A 1NX9A 1R88A 4P9NA 3WKDA 3GA7A 1TKRA 4X00A 3M3DA 3IULA 3RLIA 4C6HA 3K9BA 1CUSA 3DL7A 4ZRDA 4ETWA 4BAGA 4B84A 2OGSA 1ZD2P 1RP1A 3I2HA 1XRPA 3C6YA 5AI9A 2Z3WA 4OB8A 2O7VA 3R41A 1MAHA 1UOPA 3WL6A 1CPYA 2YH2A 3UMJA 3WKCA 4MXDA 3L1IA 2W22A 2VT6A 4F0JA 2PM8A 5ALTA 4OU4A 1EVQA 2CEKA 3V9AA 2PUHA 1QOZA 3GBSA 1ZGCA 2DSNA 2XMZA 3STVA 2WM2A 3MGAA 2ZVDA 5ALJA 1PFQA 2DR0A 3FCXA 3FCYA 2RHTA 3H0CA 4X91A 2IIVA 2XUJA 3ESDA 3H04A 1YSCA 4UBKA 5AKHA 1BRTA 5LZ9A 5BWBA 2BJHA 5DYYA 1IZ8A 4QLAA 1VJ5A 4YASA 2HIHA 4MWSA 5C7YA 3O4JA 2XUPA 1J06A 4Y2QA 3LS2A 1TCCA 5C8VA 4FTWA 3UUEA 2PSHA 3WZLA 2WIKA 3VISA 1XZHA 2B9VA 1VXRA 4X93A 2O2HA 4DNFA 1BCSA 1L7RA 4N8SA 4GHWA 3N0TA 2QJRA 3CXUA 3QM1A 3GROA 4AQDA 4PW0A 1VA4A 1ACLA 2Z8XA 3PICA 5CMLA 2G4LA 5AKYA 4J0HA 4BB0A 1ZIYA 2Y2UA 4RNCA 1MX5A 4H7IA 4BE4A 3C5WP 1HBJA 1QIJA 3ZV7A 4C87A 4AX4A 2JF0A 4FNGA 5K3DA 1GQSA 1AURA 2D0DA 3A2NA 1VE7A 4CG1A 1MX9A 4GECA 3SC2A 1TRHA 4W1QA 1VZ3A 1Z68A 3H19A 4UBJA 3ED1A 3T4UA 2XQIA 4HTAA 4QEKA 1N5RA 4PF1A 1ZIXA 3IA2A 2EDAA 1KU6A 2J4CA 5AKZA 2XUKA 4MQLA 3WYDA 4Y9SA 4J0KA 3IUQA 2G5TA 1C4XA 1G4HA 1H22A 1W4LA 5AI0A 3D0KA 5E4TA 1HQDA 3BJMA 1XZEA 2WUFA 2WIJA 2C4HA 1MPXA 1UOQA 2OCIA 3D3NA 1WB4A 4J0GA 4LXGA 4JEIA 5JIBA 4H18A 3VJKA 5CXXA 4QDZA 3IUNA 3QMWA 4CI9A 3D7RA 5AM2A 4QNNA 3W9UA 3JWEA 4ZV7A 4AMYA 2GBFA 3KXPA 1GPLA 4UFNA 2ACKA 4OYLA 3R0VA 5K3FA 3DLTA 3WK8A 4DM7A 2G63A 4WCVA 2EEPA 3G9TA 3IIIA 6YASA 4BC0A 1H2YA 2QTBA 4Y2RA 2PL5A 2JGEA 3I1YA 4J0CA 4A23A 3WL8A 3ILSA 4G5XA 1DWQA 1G66A 3ANTA 1PV1A 4K2AA 3SX4A 1JU3A 3K6KA 3QMMA 3O0DA 3WL5A 1CUZA 4BVLA 5JARA 2YYSA 3QPCA 2VF2A 1MAAA 1L7AA 4FMPA 3KOOA 3LLCA 5EIAA 4B83A 2C58A 4BTVA 1OXMA 4X6YA 4LXIA 5D3KA 4LXHA 1WHTA 1LZKA 5A62A 2GZRA 2PSFA 3E3AA 1U65A 1JT2A 4EHBA 1MTZA 5HZGA 2VAXA 3FYTA 1Y7IA 3IDAA 1EK2A 2PU7A 5ALRA 3R3YA 3BE8A 4QWWA 4TGLA 4P92A 4W1RA 3U1TA 5LLSA 2Y1KA 1W1IA 5BOVA 1YS2X 2AXEA 4XWGA 3ESBA 2GZSA 3Q0TA 4L0CA 3WIBA 1TAHA 3QZUA 5CXUA 2DHDA 2IX9A 1ZI8A 3PI6A 5ALOA 1CIJA 3OG9A 2V96A 4HS9A 3B12A 5ALUA 1ORVA 4Q82A 1H23A 5LIPA 5T4HA 2PSDA 1UK9A 2PPLA 5JAUA 7YASA 5CW2A 1CEXA 5AK4A 5ALDA 2B20A 1BCRA 4BRSA 5LZ4A 1BROA 3DEAA 3LIIA 3WYNA 3C87A 3WA7A 1YB7A 4U2CA 3WKEA 1CFJA 2C7BA 2HRRA 5ALQA 4B82A 5DNVA 4ZGBA 2WKWA 5ALGA 2XUIA 5A71A 3PFBA 4B9AA 4L72A 3WWCA 4BATA 1K63A 4ZI5A 3FWHA 4WJLA 3STTA 4KE9A 2RAUA 3X3HA 3WWPA 5EIEA 1RWQA 2VJAA 2B4KA 2VQ6A 2VSQA 2Z8ZA 4KE7A 4BYMA 4MQMA 5K3FB 4H7DA 5CT5A 1Q0RA 2O7RA 5AHXA 3FVRA 1XQWA 2CKMA 4YPVA 2H7YA 2DFPA 4W1PA 4PSUA 4Y2XA 3G9UA 3R3UA 4FBLA 2Y6UA 5ALPA 2ZYHA 1GZ7A 1LNSA 2FJPA 3AINA 2CBGA 3VXKA 1EA5A 3C43A 3H1AA 3P2MA 3AIKA 1TK3A 5A7FA 5HKBA 5HK8A 2J4FA 5A7HA 5JD6A 5DTJA 1TIBA 2W6CX 4UBOA 2WUDA 2XLCA 2R8BA 5ALFA 2PKYX 2WLSA 4OB6A 4K6HA 2R11A 2JGMA 2WJ3A 5C8XA 1QTRA 2XUDA 5IVDA 1GPNA 1XKLA 4WDRA 1EH5A 3A2MA 4DNPA 3EIOA 4S0XA 3C45A 2QKYA 2B61A 4FFVA 5CRIA 1UKBA 3O9MA 4X7BA 3EBLA 1IMJA 1QGED 2XMDA 1F0NA 2Y6VA 4Q3OA 2ZSIA 3D4LA 2OCLA 4X90A 4V2IA 4X94A 1ZD4A 3CCBA 4CCYB 5J3JA 2WHRA 3C6BA 4RE5A 1MJ5A 2GYVA 3V1KA 3O95A 4MYDA 4PSCA 4UHDA 3QBJA 3E1GA 1JJBA 1CQZA 1HPLA 2WFLA 3L1JA 4I3FA 3H2IA 3M83A 1DT3A 4LYDA 2GBIA 2HA2A 3KDAA 4UHBA 1DWOA 3WMRA 3ZLVA 1LBTA 3STYA 4EZIA 4B6GA 1QFSA 1XROA 1BE0A 4DMKA 5AICA 2H7CA 2DHEA 4WY5A 5HF6A 1TCAA 4G9GA 3AZPA
chains in the Genus database with same CATH superfamily
4TTIA 2Q6VA 3B48A 4OHBA 5YASA 1THMA 2AHRA 2C4TA 3U4DA 3WLOA 3PTLA 3Q1LA 3TW8A 3RTBA 1Q1ZA 4EELA 3DOOA 2HFJA 1QO0D 4R2IA 1YQQA 3AUJB 1FQJA 1K2VN 3FJYA 1W48A 3K30A 1XC7A 5EKSA 4GM0A 3WIUA 5JZ9A 2Z1DA 1N2BA 3D9QX 3I6ZA 2P5UA 4AY3A 1TPZA 4C7VA 1WBBA 5C8YB 1EM8B 3M3PA 2NXCA 2W6MA 4H6WA 4NAUA 5KI6A 4U2GA 3T3OA 2VC2B 3EK2A 5FEMA 3ZV5A 2I7XA 1O5TA 5K2OA 1RJ9A 2G76A 4PONA 3A28A 4G5SA 3ETLA 4FNMA 4RKWA 5EJAA 5J5CA 2OYRA 3CPSA 4KRYA 5HUHA 2ZBPA 3E9RA 3UGJA 2CJFA 3CW9A 1YS4A 2QMQA 2HADA 3SEAA 3R9IA 4PFSA 3V7FA 3S1AB 3Q8WA 5CJJA 4UDXX 3U0BA 3VHXA 2KYRA 2IW3A 5JVDF 3KKOA 1YA8A 2GHIA 1QZTA 3NOVA 4BN4A 3NANA 3OIDA 1RQGA 4IGFA 4EHKA 4DLVA 3FOAA 1M8FA 3LUJA 1EZ1A 3SU8A 5LYJF 1A9PA 2XY4A 3GMSA 2AEMA 3PK0A 1R0SA 5EP3A 3PUHA 1XAIA 1P2GA 1W8IA 3KYCA 4WNAA 2O4CA 1AQ6A 4MUHA 3SF0A 1WB5A 4LF5B 3ZKWA 2NV2B 1DAIA 2A9QA 3TQHA 1EBBA 1NZJA 2BM8A 5HUQA 3H1BA 4OMUA 4XYLA 4BO7A 1NC3A 5JAQA 4BB9A 4KU4A 2UUPA 4AP9A 1VLQA 3IIMA 1TF7A 3L41A 1A5BB 1KOLA 1P80A 4DT1A 3ESZA 1XDDA 3Q12A 3STXA 4F2DA 2VQSA 1XL1A 2ZZMA 1EFPA 1CX9B 5TQ2B 2BEKA 4HYQA 3QNWA 3AYZB 4LYYA 1JR2A 1QONA 4FP9A 1FUYB 3PP8A 3LI2A 3EIWA 3WK7A 1S2NA 1BVRA 4G81A 5KJ6A 3JWGA 1TF2A 2PRSA 2Z2ZA 4RJKA 3TM5A 2PPVA 1HDGO 3R6LA 4HD8A 4GKBA 2O2JA 3G02A 2GEFA 2C9ZA 3QVKA 3OOHA 4G5GA 4ZVOA 4YMHA 5JYDA 3DMDA 4RNDB 1RWOA 3RAPR 3ZBUA 1G41A 4RO0A 4DMFA 4NCXA 3EOZA 3UANA 4EKGA 1NPTO 2N0SA 2VTVA 5K3CA 1UJ2A 3O75A 1JG3A 1U0SY 2VR1A 4ATNA 3LWZA 2ZSEA 3F7TA 3JZDA 1J33A 1SWWA 1AUPA 3L8MA 1E8NA 1FYVA 4QJIA 3OZUA 1FJHA 4A92A 1P3DA 1L7MA 2J3QA 2OUKA 4RAOA 4GYYA 3EGDB 4ZODA 4ZYUA 2FQXA 2K7FA 1IY9A 5CFQA 1G8JA 4KBYA 2V7GA 2VTEA 2QUAA 4ZQBA 3MTEA 3EMVA 1PIWA 2VDPB 1RRCA 1ECPA 4BO9A 4JUFA 3PXGA 2Z83A 5HE9A 3ZQ6A 5DI9A 2P62A 2OB1A 1RE1A 3HXLA 4LRUA 3SIWA 4KMRA 3EZFA 1GSAA 5FPPA 4CHTA 4N5IX 3VAAA 3BE4A 1OWOA 1C9KA 1DXYA 3GPIA 3TAHA 1XDSA 4TKUB 2CV2A 1E59A 2WMDA 4KN6A 3RSHA 3TR6A 4CIBA 4U7PB 4WCFB 5BV7A 3QEMA 5JAOA 4B7CA 1YVRA 2AOUA 3ND7A 1YNOA 4B8WA 5E8RA 3ER9A 4EHLA 1OCEA 4DLLA 3FUCA 3MS7A 2ST1A 5LKRA 4HLQB 4LHEA 4JI5B 1VHDA 4AJPA 4TQ9A 4WZZA 1RI4A 3KR2A 5TGTA 5AIAA 2E1RA 1MJHA 4NEQA 1JIQA 5AJTA 3GLUA 2HHLA 2YXDA 5DHSA 4NZPA 4IKEA 3PQ3A 2W90A 4NQZA 5LQSA 1QGUB 2BDEA 3R8CA 1BFDA 1R7RA 2IP1A 3DBVO 2BH2A 2EG5A 3B20A 4E5NA 3Q3EA 3Q85A 4C2BA 1EDBA 5F7JA 1I32A 1ZHHA 1U1DA 2PBFA 3EGXB 2GD0A 3KXIA 4RANA 1W5SA 1XTRA 4BLRA 3VYUB 4OKIA 5EMMA 4BQEA 1P4GA 2EZ8A 4UBIA 5I6DA 3DE6X 2PZMA 3DE7X 4I9NA 4BX8A 4FUQA 3IPAA 3K0SA 5AJWA 4CV3A 2CSXA 1VRVA 1CY1A 2VFAA 3DXFA 3GJ0A 4JOBA 4OKSA 3F8SA 3WLFA 1Z2NX 1AC5A 2VHZA 4D9EA 2HKIA 1Z12A 2OR3A 4HWKA 5GJWC 1PJ8A 3FMFA 1WKCA 4X3CA 5H59A 3IBYA 2M6LA 4B6SA 1GILA 3PQ6A 2BD0A 4OMFG 1T9BA 4JHXA 1D5WA 1OGYA 2YJTD 2XT6A 5BYBA 3IUEA 1UJ5A 2P30A 3OZDA 3PQDA 4FFNA 2I78A 3SE0A 4EGAA 4P7JA 3DR5A 3QVXA 1E9EA 1PNRA 2OOSA 1NVUQ 1V4NA 2C92A 1XLWA 3BB3A 3CH5A 3E2IA 3IMKA 3G68A 4Z9XA 4OA8A 2LPMA 1HNZB 5J2TF 4IIUA 5CM2Z 1DRWA 1ZNWA 3A4LA 1ABEA 5AOBA 4G37A 4CM3A 1QHNA 4K0KB 1BG6A 2VZ9A 3AR3A 4WY8A 4EAAA 1W88A 4YIKA 3TSZA 3K4QA 1GZ6A 2GKOA 2V7QA 4LDRA 1RYHA 4YWHA 3HFSA 3HQ4O 3H2KA 4B75A 1PUXA 1KH3A 2XADA 1JFRA 3FCSB 4JVNA 3AFIA 1E98A 1OYYA 3DT8A 3HUFA 1U28C 1HYEA 2ZRPA 4Q3BA 3IT1A 1UANA 4W5QA 1G6Q1 2CMKA 5LVAA 1ZRNA 1X7GA 1V39A 4QO7A 4E6EA 4EPYA 1SHTX 4YQZA 4MNTA 3KOUA 3DEJA 4KAFA 4NXNB 1K7YA 2Z6VA 4HFMA 2Z8YA 3PGKA 3GQBA 1AUQA 2YMLA 1WMAA 2YVKA 1F8XA 5C2JB 1CS4C 1W7AA 4UUAA 1W59A 3BXFA 1FNDA 1SUCA 4MUAA 3P27A 4NP6A 3VOBA 5F2NA 1H5NA 3RHZA 4B3SB 2R2GA 4MO2A 1GD1O 3B8EA 2BBSA 2FDCA 2B82A 1Y4ZA 3ZOZA 2DQZA 3EDCA 5EP2A 1MX1A 1J00A 3QP9A 4DMGA 1DRJA 3SFZA 3K0AB 1E1DA 1V7CA 1DV2A 1YQUA 2AJLI 2RDMA 1NASA 1BOFA 1Y6QA 2RHOA 1C0PA 5TJ9A 821PA 5AW4A 1C7JA 1V11B 1XTBA 2DLNA 3FOWA 1F9AA 4KDCA 4OEHA 5DM2A 2BRUC 1R64A 3KHTA 3AEXA 3M0EA 4TVKA 3X1YA 1I14A 1SVKA 4RD4A 4H0CA 3ML1A 1Z25A 2QN7A 3NT2A 3UMSA 1G5FA 1YDHA 1KY5A 4L50A 4MSUA 1JEEA 4HH1A 2PBLA 1WDKA 2R8XA 3D8BA 1VYUA 1UPXA 4AN0A 1OLUA 5CT6A 3AFMA 3FFBA 3WGZA 4B09A 3UTDA 5KUTA 3FCEA 1EHIA 1A9OA 3VYVA 4NK5A 1P2BA 3BYZA 1Z6QA 2F43B 2KBEA 5E3IA 4NV0A 1PD0A 3VSDA 4IQ4A 1D8AA 4RA6A 3CVUA 1GRVA 2P9BA 3NHLA 5K3BA 1L8OA 221PA 4M1WA 1U0TA 4M98A 2AN1A 2XIJA 4RY2A 1M2WA 2IF0A 2FMHA 3R3JA 4WXYB 3S28A 1OA1A 4ZI2A 5B5SA 4L5BA 5ICCA 5JCJD 1WF3A 1ZD1A 1DDIA 4GI1A 3OWXA 3KLBA 1EJ2A 4NCAA 4LRTB 4LYGA 2OM6A 3SF8A 5AI4A 3X2EA 4DL9A 1K8QA 2H2AA 3H5AA 2PQ6A 2CUNA 2E6UX 4U00A 3IIKA 1IJKA 1JAHA 3LZDA 3O7MA 4K05A 3UFXA 4PZ0A 4TTJA 5FUYA 3NALA 4BIMA 4MWOA 3LECA 2XZDA 1LH0A 3H6HA 1DAMA 3VYRB 1W1WA 1PJ2A 1ZWLA 3X1ZA 5EKTA 3L0CA 2GPYA 4JJ6A 3AHGA 3KPJA 3K72B 5TEVA 3SC6A 4LN1A 1P7WA 3W9BA 2CFCA 1O94D 1MD9A 1LBEA 1YZHA 4OLJA 3QUAA 3A4NA 4DM4A 1LWNA 3CY6A 2ZETA 2O1XA 3CRVA 4QO8A 4XSVA 1XD2B 3BB1A 4DDTA 3PITA 3LNTA 2ECFA 3N8KA 1M2OA 3KJGA 5JJLA 4WSOA 2OZVA 1ZRMA 4JYCA 3SI7A 5M3BA 2RGYA 2C7QA 4OSEA 2D2VA 4HNGA 2ZT5A 3PFIA 1EVYA 3SJUA 2PMDA 1S3FA 2J5QA 2Y3IA 2ADMA 2HK9A 3TNDA 4JIMA 4TSFA 1VHWA 4FK8A 5DW0A 4EGCB 1JHDA 2JGAA 3BN3A 1L5YA 3IR7A 3PGJA 4ZWNA 3E8XA 3QFHA 3WLSA 4QWMA 3ITDA 3KFVA 4Z9YA 1DAFA 1P7YA 1N9GB 1QO7A 1ULZA 1Z88A 2ATCA 1OV4A 2HSGA 4EF6A 1QIIA 1X74A 3NHAA 3T8YA 5EYPA 1TO2E 4MAMA 2QLLA 1CDOA 1NHGA 1OFHA 2CY0A 3GFSA 3GLKA 5IXJA 1S5PA 1IZZA 4L75A 1DTWB 2Y8EA 2H4WA 3WL3A 2E48A 1AT1A 4RGVA 4R40A 3SQLA 1YB1A 3AI1A 1PHPA 1CY0A 3A2KA 3SSNA 1UBEA 4PYRA 4YJGB 4C4PA 3K20A 3WWDA 3AH8A 1P3JA 4YRIA 3GH3A 1ESDA 2Z58A 3BDIA 4KLRA 2J0UA 4E6PA 2F3QA 1TJ3A 4NFHA 3CF2A 3F97A 2WU4A 1GHTA 1UM9A 2AIRA 4YJ3F 5JZBA 5KNCD 1EP9A 2OORA 2W8ZA 4U3JB 5LIRA 1QQAA 2FWNA 3HUTA 4CMEC 1JILA 5KYYA 2IYUA 4BNTA 3BIOA 1HSOA 2VRBA 3EDMA 2PMBA 2C5LA 1W36D 4UHKA 2OAEA 4J2OA 1MIOB 1PZGA 3WYEA 1XLVA 3OLZA 4RY8A 5F76A 1GPH1 2CMGA 5ALEA 2V0GA 2Y9MB 3R7WB 1RLTA 2OZPA 3PDIB 4FMCB 2OCYC 2Q2VA 5FFFA 4IHJF 3RARA 3H9GA 4A8HA 5HF9A 3MWKA 4IIVA 4OREX 2J4DA 3T54A 4Y7DA 4TRMA 4H27A 4QQFA 1RM4A 3GRZA 4PLTA 4RHXA 4CQMB 6NULA 2IP2A 2JB9A 1U1IA 1UC4B 4MUFA 4KFTA 1VKRA 4I81A 4RF4A 3UT5B 4ZYYA 5D5QA 1NQWA 2WYWA 3B1VA 3DR3A 4XIJA 2IYYA 3ZWXA 2WB4A 3WHPA 3H3JA 4BNDB 4QGFA 2AN9A 2D8AA 4OU5A 3VZDA 1RXEA 4ZXPA 4EARA 3LX5A 2FYTA 2R1UA 3ELWA 1U0HC 3D4OA 3EQ2A 3R3WA 4XDHA 4F56A 3G6KA 1R3DA 4NR0A 1E9DA 3BH0A 3EQZA 2IBTA 1U98A 5CH5A 4CKWA 1GZ3A 4GM1A 4QLBA 3U7HB 2WDZA 3G0DA 1B0AA 1ODFA 2ATVA 2JRCA 4M9UA 4UM5A 5EIFA 4ZT2A 5G0VA 4DZTA 5I8WA 2I67A 4UUQA 4ZCMA 4ZCPA 2JAOA 3F73A 3PXCX 3SLRA 4PPFA 4FQ7A 2HMYB 2WIGA 2FR8C 2XWQA 4FLEA 2GEDA 4KITB 1PD1A 4US0R 2NACA 3WLJA 1LB1B 4XUGB 2H4YA 1H4VB 1ONSA 2OBLA 3CU5A 4I4TA 3UK7A 4EO4A 1PVDA 1UADA 3LNCA 4JGGA 4KQ9A 2C4VA 3TO5A 2GSWA 3I37X 2YHBA 4RMJA 3K16A 5GGXA 2BI7A 4ENWA 1GKUB 1UIRA 3OM0A 4ITUA 3RVNA 4LDZA 5JC8A 1NMSA 2C42A 1RLIA 2Y76A 3BPSA 3NPMA 5A6SB 3NEYA 1FFHA 4LC1A 1K0UA 2W2QA 4PLHA 3I6QA 4WXMA 4D79A 3JASB 1ZICA 3T7SA 1NIJA 4FOOA 3ZV4A 3VO2A 1TC2A 4BFXA 3FGNA 1PZXA 3GLIB 5ALNA 1LD3A 2YBDA 4E4YA 1E2KA 4QDXA 1YJQA 2YOHA 2RONA 4MLCA 4WJKB 1RHRA 2GZAA 1NT4A 3ZGLA 1NUTA 3I0ZA 3IT2A 4R9VA 3PGMA 4NH0A 1CR2A 3RV4A 4BDTA 3N53A 3LBHA 4TLCA 2DHCA 4QM7A 4HGNA 3LT5A 3OZAA 1YVUA 2GTHA 4UFOA 4QYIB 3QEAZ 1Z4JA 4UVHA 2O8VA 1E62A 1JTVA 2VSXA 1W34A 3VR1A 2WNIA 2C20A 4IR7A 1UWLA 4P22A 3AUSA 2DFLA 3JPYA 5C1IA 4DLNA 2ZE5A 3O26A 4K87A 4I1PA 2DLDA 1YBVA 3ETJA 3N5KA 4Q1DA 2VOEA 4F2WA 2QVBA 3OHPA 2QA5A 3GRRA 1P77A 1NNSA 1EDDA 1W0JD 5JD4A 2ONZA 5T3YA 1IBMB 5G0UA 1SQ5A 2QNRA 1P4JA 4Z7OB 7MDHA 5ALLA 4YCCA 2AC4A 4D80A 2CXRA 1SCUB 3GBVA 3JVEA 5EWLA 3P2IA 2C3MA 4LZLA 5BW8A 3MRTA 3ONDA 1VJ1A 3OQNA 2Q1SA 1W19A 2YV4A 3B3JA 2GI4A 3K53A 1F9EA 2IEAA 5LYYA 3ZHBA 4CN8A 3KYDA 5JY1A 3G85A 3OM9A 1U7WA 3FRHA 4CFZA 1AF4A 1TJ5A 3NVDA 5L53A 2VSNA 2CBXA 2OHIA 2OXRA 3HWRA 4FFRA 3H9EO 4Q34A 3O4IA 2JHAA 3TZHA 3O74A 4WOBA 1TYBE 3D1VA 3V4ZA 2GKGA 1C7QA 3GGOA 3RH0A 2C3OA 4F21A 2NZ8A 2C5SA 4HFJA 2OHGA 2QN9A 5H68A 5BUCA 5KYXA 1FX1A 3DT9A 3MELA 2I7VA 4NL4H 1T2DA 4L76A 2W83A 5JC1A 1CUXA 3D81A 4CNBA 3IOEA 4DWOA 2PL3A 4GQAA 4AXBA 4CI0B 1VPDA 2LRHA 2HWUA 3ENVA 5LA6F 4JBYA 3QPWA 5I9BA 2ADOA 2LKDA 4GZMA 1ZITA 2HDWA 2G07A 1F14A 2EGGA 3GZTB 4FIDA 4UBLA 4GO1A 2A2ZA 1U9IA 3Q2OA 1MV5A 3TH5A 4B5LA 1F60A 4RSMA 3GLHB 3OQJA 2W6QA 2Q3JA 3RRMA 4BQOA 1P9RA 3GJXC 4FLMA 3V48A 4DRXA 2UVPB 4NJMA 4QSMA 4UUBA 4Y0NA 4BCCA 4BVJA 4Z4EA 2X0IA 3KVRA 1T0BA 3ZDCA 1F12A 2ZTHA 4U2KA 1RVDA 2AKAB 4XWYA 5EMKA 5H16A 3FMPB 4CM8B 1ZDMA 2GPSA 4X1OA 4BNNA 1TU3A 2CXQA 3MXTA 3UUGA 4PS1A 5JSZA 3PFFA 4MYUA 4RY9A 3OFSA 2WPDD 1NQUA 1A0OA 3TXXA 1RKQA 4B44A 2FKNA 1DJNA 3GZNB 3SR4A 3HP1A 3MRSA 1PDWA 1AKMA 3Q3GE 3QTLA 4B0PA 4KG7A 2GUGA 1G8AA 4C21A 4IVQA 1DAOA 2MR5A 1O03A 2GXUA 1E66A 3LPCA 3D5QA 3O21A 2Y1GA 3R2JA 5ESXA 4D4HA 1DBPA 2PUDA 1BXKA 1ADGA 4AJLA 1XZGA 4ADSG 1P6XA 3AOEA 3GEIA 4HPXB 4OBXA 4S04A 1GTVA 4FDMA 1L5HB 1N3YA 3RQIA 2GEBA 5FOSA 1HI9A 5K0FA 1JG6A 2H1RA 3KYBA 5DBGA 3MILA 4G07A 2GHQA 3EASA 3KBBA 4H1UA 4M7PA 1W0KA 4GR4A 2QRGA 4HNAB 5LP6A 4ERNA 2G9RA 5B7QA 1DCFA 3M6AA 4WUTA 3H4IA 1VM6A 1BMFD 5L8VA 1CB7A 1PAUA 3RVBA 1TCUA 3SY8A 1Q7TA 3MNFA 1II9A 2NADA 3HKBA 4C0BA 1GCUA 1GAXA 3LT1A 1H9AA 2J1LA 3LOQA 5HJ2A 5A3JA 1WXIA 5D3MA 5E6SA 3GJQA 3QU2A 4DMHA 1SUAA 3K0EA 4EP1A 2FQYA 4DYVA 1DG9A 4UQOA 5DIFA 3F9CA 1R37A 2BMVA 3BERA 2Y1DA 3UQYS 4G86A 2OGTA 3L93A 3L8HA 1YI8A 4R9RA 2VTDA 1VIYA 4PPGA 4PSKA 1X1TA 1BVHA 2BMJA 4RKEA 3MLBA 3PF9A 4LXQA 1VIMA 2YJ4A 3X1XA 2VT3A 2VDNB 4F85A 2F67A 1QVAA 3OJOA 4F3RA 3GJ3A 2PO7A 1ZJJA 2EFDB 1K08A 1H2XA 1ZSYA 2PKCA 3CNHA 3ISTA 3NWPA 3O0TA 3PHGA 4INOA 4TV9B 3CA8A 4NENA 2I4NA 1A7UA 3PCXA 4U5QA 5CFNA 5KJ1A 1TQ2A 2MYUA 4JJ8A 3AU8A 4YHBA 1YR7A 3CN9A 5TPWA 3T1VA 4YUYA 3DLBA 4HYTA 1T34A 3M4YA 1JIIA 4XOIA 1QCDA 2M9MA 2V6FA 4GPIB 1T4DA 3V1UA 4E94A 5IT0A 1TU4A 3AJRA 4JWTA 4YQYA 1E8DA 5KOHB 2ZYAA 3WSVA 2A1UA 5A06A 2IYQA 1NYLA 2WYVA 4UD6A 5IBQA 3SC3A 5HJEA 2FEWB 3FPKA 3HDQA 5AWFC 1L2TA 3K70B 2NXEA 2C54A 4JR1A 2YY7A 5CG2A 3ABIA 3AERB 2DM6A 1A27A 2HIAA 2QIPA 4MP6A 2P2NA 3T52A 1DC6A 3LYHA 3MMPA 4HYEA 3E3OA 3QIAA 4C0JA 5JNWA 3DMTA 4DB2A 3AZQA 4M6WA 3TEJA 4C7OA 4HUTA 1UFOA 5GVSA 1Y7TA 3T9DA 2XIQA 2XRZA 1IJFA 5BSGA 2PU5A 1GLVA 4KAXA 5BR4A 5K8VA 3TPZA 4EJMA 5JVDA 1T3LA 2FPWA 2VCHA 4F11A 5IAOA 1CUGA 1UKZA 4U6SA 1YK1A 1FYWA 1NFQA 3IO3A 5I8ZA 2XTAA 2X9GA 4LCBA 2A5YB 3O8OA 1Q1QA 2YNMD 1QYVA 2RE8A 1P31A 1A8UA 3GOHA 4RQBA 3RM3A 4RTMA 3H9CA 4DVGA 1G6OA 2JAWA 4L8LA 4AJ9A 3W8DA 4C03A 1XCPA 3UM9A 4O33A 5CA0B 3C8HA 1EJ0A 2WW8A 4IG4A 3DZIA 1VGQA 1PQYA 3ZTWA 3QHQA 4EY3A 4HQKA 4L02A 3HTXA 3KSZO 4Z9AA 4GWLA 3A1VA 5U1PA 3LRTA 2ZJZA 3C2QA 3M6VA 1F8GA 1ZIOA 2HMSA 4DLBA 4I14A 1V2HE 3W8FA 4XDYA 5DT2A 4D3YA 2QSJA 2V7BA 4H35A 3W90A 2Q6IA 3DPSA 4TT8A 1K68A 1P4HA 1WD5A 2AFHE 3I45A 3PNLA 5DW3A 4GLOA 2P75A 1SJ9A 3FKSD 4NEGA 3VVLA 4KPUA 4C22A 3B6IA 2ROQA 4LGCA 1B41A 5TXGA 5C81A 1GXSB 1CR4A 2YWGA 4IYRA 4X6UA 4QYWA 1Z6YA 1ZU5A 3ESYA 3SHOA 4EUHA 5AW3A 5EIXA 4HRAA 3N74A 1GFIA 3LPMA 3LXMA 4B7AA 1R10A 3G8DA 3L6DA 4M99A 3DLCA 3VR0A 5HJ5A 5IXYA 1SMKA 4S1TA 1D4OA 2QW0X 3GFRA 1R0ZA 3LW8A 3QHPA 4MWEA 3T5AA 1SC1A 3NP7A 2VHQA 3LJKA 3CPJB 2XECA 4KO4S 3CXRA 4HWGA 3D8RA 1BW9A 4JB0A 4X1KA 1Q2UA 1XKTA 3FH0A 3NC1C 1DAEA 2XA9A 3QE3A 5D5PA 3BCUA 1FTQA 3SKXA 2GPWA 1Z35A 4MZDA 5I7UA 2UZ4A 1YJ5A 2O3UA 4KXNA 3UHJA 1DEOA 1AN0A 5JQGB 3IEMA 2A1TR 1KJIA 2LZ0A 4LSMA 2HIMA 5J47A 1F4LA 3PJEA 4CF4A 2N42A 1R9GA 1FQKA 2O48X 3G7NA 5BQ5A 3SSMA 4JI0B 3X1MA 4DREA 4DY6A 5J5AA 5AVTA 4UBNA 3IKMB 3KBOA 5F98A 1PR3A 4MIOA 1WZUA 3IDZA 4HMPA 1YBHA 3OCWA 4Q4JB 4INZA 2Y0PA 1ATZA 4AIRA 1JWBB 1T5BA 1VC2A 1X13A 2A5GA 1H5UA 3UAYA 4YV1A 1DKQA 4UVIA 1UK8A 2DGDA 2WQ6A 4XPIB 1QTNA 5B2FA 1L1FA 4JODA 4BXOA 3F96A 4K9SA 2Q9CA 1IFXA 3CX8A 2UZ1B 4FFWA 3QYJA 4O4HB 2MSEB 5AK0A 1A88A 1VMEA 3M9LA 1VDMA 4J0QA 3WB9A 1U4SA 4N0QA 1WY7A 3DDUA 5CNJA 2Q5LA 4BMZA 3QU7A 2DR3A 1CRQA 5CX4A 2VH5R 6Q21A 4FWIB 1V6AA 421PA 1YWGO 1DNPA 4QSHA 2G67A 4XYMA 1QRTA 1QVVA 2GZDA 2VEDA 4LUCA 4QTUB 3OM8A 4U7WA 4AJ4A 4UREA 1BHQ1 1Z2PX 3Q6MA 2ZB8A 1T43A 1XJCA 3B9BA 2WYIA 2XUOA 4U63A 3MUEA 1JFFB 1ICEA 2AYZA 3COPA 3LHKA 2P4HX 4JJFA 1ODTC 2L0XA 4L22A 3K0FB 1Q1EA 1IZYA 1Q3TA 1Y34E 1XJ0A 3FDZB 3CPHA 4F4FA 2L18A 2NTVA 1T5DX 2R1VA 4D44A 1THTA 2GLUA 2C9MA 2WFLB 1LQTA 3C5HA 3DM9B 3LT2A 4O5AA 4OOFA 2AD1A 3BXEA 4D96A 4DA8A 4JNKA 3DA8A 1PBNA 1PN3A 4XRRA 2VH2A 4FBMA 2FFHA 1GKKA 5JNRA 2XCOA 1WDMA 1RXUA 5LBIA 5T4FA 1YQXA 3ROXA 3SCZA 3UQZA 4CQJA 1Q21A 1ZHOA 1EK1A 3DGEC 4HZUA 4BVBA 5E1DA 1XQVA 4C4XA 3N07A 3VDXA 4QREA 3V4RA 3WMFA 1J2EA 4BHTA 4BGDA 4ZO9A 3A2LA 4QGHA 2ETXA 2WILA 5AIBA 4JBNA 4TL6A 5HKKD 3H1GA 2HDHA 2ABWA 1M2FA 2QR2A 4IJKA 4BNZA 2ZB2A 3NDPA 3SVLA 1JYEA 1ZS9A 3DMRA 5JISA 2ERCA 3QE0A 3FOZA 4LV8B 4MQEA 4QYSA 2VT7A 3CRRA 5ALHA 2XBMA 3AR2A 4HCJA 5CTAA 1X7WA 5D3ZA 1GTJ1 1AN9A 4KN8A 1E63A 1NXSA 1YR2A 2VLIA 3NBZC 4JB2A 4LIPD 3TZLA 1PF7E 4WFIA 1GUYA 2TECE 3M1IA 5CDGA 5J2TA 1Q6ZA 1P91A 2RI6A 2JJQA 4L08A 4RVDA 3ONFA 3LBIA 4DKXA 3AESB 5FNVF 3RCBA 3UKDA 3KKMA 2XMRA 3H1EA 3LM8A 4RUKA 4DLRA 1COZA 2NUAB 4PX3A 3ILXA 3FPEA 1YR1A 3RVOA 4Q1AA 4L07A 2VJBA 4IINA 2BFBB 4TQGA 3CPEA 2Q4EA 3B5EA 3NX4A 3GUYA 1RC1A 3S55A 3LBNA 3SVTA 1OH8A 1EK0A 1MZPA 3GLFB 3TNFA 1ZI6A 3RSZA 2FN4A 4J3NA 3RC8A 5TX7A 3GNLA 3T0IA 1MABA 2GYUA 2J3MA 3PF8A 3PFKA 4GPD1 4UATA 1K8YB 4CM6A 4IXNA 4YIHA 4LXXA 2QM3A 1J8MF 2W6NA 1IPEA 1NJ5A 4IMPA 5IAAA 1VP9A 2LCIA 1O4VA 1T6ZA 4ZV9A 3BWMA 3IE2A 2BZ0A 4WEQA 4CMGA 3S2FA 1LZLA 1GL6A 1I1OA 5ARDA 2FOIA 2YVLA 3TIVA 4C01A 1J0XO 3FW1A 1KH1A 4ENSA 4ZVNA 2FMTA 1GG2A 1MXHA 1D04A 2R6DA 2NU7A 3GXOA 3LX4A 5C46F 1BE8A 1TJPB 1EWTA 4K9DA 5DHAA 4ZK2A 4WESB 1RHQA 4MEAA 4OPMA 4DSNA 3WGJA 1VLJA 4A7PA 3CWQA 4D99A 2IEYA 5F33A 5EXDA 5FJIA 2HLDD 3DO8A 1MIHA 3TB4A 1UQTA 1TEZA 1Q0SA 4MQ6A 3AV0B 4Y2YA 4B31A 1OWMA 3VR6D 2G1PA 1F4VA 3HBJA 2R4QA 4GBED 1QM5A 1G63A 3EQ9A 1G42A 1YZ3A 3D5TA 4C9BA 4JELA 2GO1A 3LCVB 3OLWA 3JAKA 1HMPA 4PO3X 1L7BA 1QH1B 2XV1A 3UVEA 1R6TA 4N76A 2ZUCA 1XR3A 3ZKAA 3FGPA 4DCNA 2CNBA 4DR1B 3EXG2 3K0CA 1GA1A 1U7OA 5LZ8A 3NUQA 3V1MA 1K92A 2LKCA 1TVEA 1XDBA 3EA4A 2CMFA 3JQAA 1VKZA 2ZRKA 4C6TA 3KQWA 5AJHA 2GBLA 1JI3A 3WWOA 3P9NA 2XZLA 1MQAA 2YY5A 3GFBA 2HXSA 3OZGA 4JP1A 2CLSA 1I6KA 1B2LA 2J3JA 3DZDA 1VDZA 2MSLA 3E0XA 1JV2B 4ABTA 1WO8A 2OFWA 3ZHCA 4IILA 4AQ7A 1GARA 2P11A 1ULUA 3D6AA 3SN6A 3UUFA 3W5DA 1ESNA 1H8ED 2IUFA 5ED4A 4U8GA 5A4JA 3FBGA 2R7MA 2AG6A 4GP7A 4QE3A 3WOVA 4DIMA 3NU1A 4TMZA 4DSAA 1U7UA 2F62A 3NKFA 1VA5A 1JVBA 1KDTA 2CLHB 3MVEA 2DBRA 4PFKA 3ZI4A 2ZBRA 3BX1A 2CHEA 2HA3A 1X1QA 3E23A 3L0PA 3UGKA 1UBKS 2B0CA 5D86A 3ST7A 2W6PA 5CVDA 1MO6A 1Y7HA 4F3KA 2L42A 1M83A 1P0CA 3RVSA 3CQ9A 3BFXA 4LY0A 2GK7A 5T64A 2LD4A 2WNSA 3C4JA 3LBFA 3F5MA 3Q7QA 4FKZA 2W70A 3UW1A 4LA4A 3JATA 2ODNA 3ZHSA 4AQYB 2FFQA 2JLAA 1DAHA 2VJCA 3CZRA 1YTUA 1MVLA 3HA7A 1XLTA 2C0CA 2K6GA 2O2XA 3L18A 4RZIA 5CURA 5D1HA 5KYVA 4DILA 1V5EA 1R6DA 1UXIA 3FTNA 4E14A 1Y6RA 4IIXA 1BKSB 3PHHA 4GVXA 5E6UB 3T06B 3KWMA 1Z29A 1GA4A 3DP9A 4CM9D 1OSNA 1HEYA 3JR3A 2UYYA 3O7WA 1DELA 4KKVA 3QVTA 4L5JA 4PZAA 4KRXA 4D45A 5M04A 1YZYA 1RMQA 3GRFA 4IG9A 4W9NC 4XCQA 4EMBA 5BYJA 3HKCA 1KR2A 4J4BA 3HLKA 3KLPX 1QIGA 1B3BA 1SO8A 4INAA 1ISMA 2GJSA 4E5YA 4R1PA 1E0AA 3MJTA 2OL4A 4HDOB 3W2TA 2C7RA 4DLAA 1M1YB 3INRA 1ONPA 2FJ0A 2FHPA 1JAYA 1YRYE 3KT3A 3ZTTA 1A9ZA 2BP7A 3ADBA 3WLPA 4AZ3A 4GGPA 4Y3UA 4UVDA 1R5NA 5LQCA 4RM2A 2HWYA 4A03A 1D5CA 1KE1A 3JTEA 4LJSA 4PHTA 4LK2A 3QW4B 4J7CA 1ZPDA 4F2GA 2V7TA 2AQ8A 3JCZA 4P84A 5DMHA 4HAXA 1Y5NA 3GHYA 3FM9A 2M6KA 1A4XA 3W34A 5KYUB 1XB2A 4KO8A 4YO7A 3R7BA 1ETUA 2GPNA 5B30A 4US2R 2NQTA 1SOAA 4YP0A 4YJ3A 4PCAA 1DIHA 3WC4A 3C15C 3GJSA 3F5FA 2D2FA 1OTXA 2Y0BA 1JKJA 1QZXA 1UUFA 1ICIA 1XF1A 1S8AA 3HU3A 1OFGA 3V2UA 4DHEA 2F1OA 2IV7A 3N0XA 4KRGA 4KWEA 4ME6A 4Y9UA 2AI3A 3HBFA 2I7TA 5IC5A 3ZVRA 1GNSA 5K1ZA 3UPUA 3L7DA 2DB3A 1ZH6A 4KLCA 3BSFA 4K9LA 4GX5A 5CLGA 5F3RA 2H2WA 3V8NA 1AXGA 2RG1A 4YX9A 1Y5IA 3W2EA 1LW6E 4RU1A 1OXUA 3O82A 3A9TA 3EZGA 4IHJA 4RBNA 4DG9A 3QEOA 1EX1A 1ZD8A 3KQTA 3QJGA 1CZLA 4KXQA 4JI3B 2X9QA 1DVRA 3L49A 2VQDA 5IJ9A 4S24A 1OYVA 3EB9A 3L82B 1USUA 1MC1A 1GFZA 3P97A 4GNKA 1M76A 4LDNA 3F6YA 4PSAA 3RK1A 1KSFX 4EFDA 2O8DB 4NBNA 5JDIC 2PGNA 3OQ6A 2QS9A 4G8CA 1Y1KE 4J0JA 5IC4A 3QENA 4C7BA 3OCZA 2UXCB 4KGVA 5K0TA 3FBWA 2A88A 3GXBA 4OY3A 4XAQA 3GCZA 2ZJ7A 3NHMA 3WZMA 5BORA 3BOSA 3I2YX 4L8WB 3WIVA 3SWWA 1BJKA 4QNMA 4WW0A 5B1YA 4L28A 3I9OA 4D9MA 3T0FA 3B6ZA 2Z08A 2QR5A 4Z53A 3QEJA 4AYXA 1VSQA 1V45E 4DIUA 2FGKA 2W71A 2RH8A 1X15A 3UAWA 4E46A 1I1HA 3VO1A 5IT5A 1YK0A 1J39A 2NZJA 5IYZA 3A6LA 1E58A 4LFBB 1V25A 3N5CA 2C2YA 2BGUA 4QJ3A 4ZICA 4RK4A 3AKEA 4HLCA 3VC1A 5HOQA 2B1IA 1FFAA 1BD4A 4QLOA 4RJIA 2M32A 1G8FA 4GC9A 4UEWA 3VKFA 2JIBA 1KI8A 3LO5A 2RBKA 3OT4A 4N54A 1X1RA 3DAHA 4NOJA 3TX2A 3OZCA 3U62A 4BU1A 1NUHA 3LF1A 1YIOA 3WQHA 4A6DA 3OT1B 4DMRA 4QDOA 2VJPA 4FFMA 2ZBGA 3FLEA 4YRDA 3KM0A 4ZMSA 1MR3F 4YRMA 3E9DA 2R86A 4PU0A 5EJ7A 3U81A 4Z4HA 2FRXA 1U81A 1C9EA 3FLMA 3I2GA 2UAGA 5A5FA 5H5JA 2VBIA 3IKVA 1JEYA 1R9NA 1TA0A 1E2HA 2JASA 2Q1XA 2ZAIA 5C1BA 2I4IA 1X77A 1DAGA 1FFXB 2BMEA 4J6EA 3RIYA 4MRMB 1IXRC 4NU5A 4TROA 1ACJA 3RWOA 3T9BA 3WDLA 1NJ6A 3SE7A 1Z2OX 3ZR4B 3OJ0A 5EFOA 3NT5A 1J0AA 2P9FA 1BX0A 3TD9A 2C7VA 3EXFB 3L02A 4BVAA 3E2MA 1N5KA 2RJNA 4YJFA 2PIDA 4FEEA 2Z3VA 3KLNA 3S29A 3GT0A 1V0JA 1KZYC 1M1ZA 2G40A 4AZVA 3K4PA 3MMSA 1CZOA 4ZOCA 4X20B 2I9KA 1RWWA 1H3EA 2IUSA 1KYYA 5FA6A 4ND8B 1CUHA 2ECPA 3GPBA 3LFTA 5G1PA 1DAKA 3IJRA 4MW2A 3HXMA 4KSYA 3TGWA 2L82A 3H8SA 5IDWA 2PWZA 3LMKA 4FQ8A 4K6GA 3UWMA 1Z13A 1ZWKA 3L4EA 2X8JA 3ZJTA 4RMGA 1ZESA 1SUBA 3STHA 1FTGA 2MHCA 3JRNA 3VGJA 2BFPA 1Q15A 4O2BB 1CNEA 4YH1A 3WFJA 5EJ8A 5I9NA 4RXUA 3T7IA 1QZUA 5EEGA 4DBLC 3K5PA 2C88A 2JEOA 3NTVA 3LUFA 3OCVA 4J76A 4LZNA 1QGDA 1SD2A 1BHO1 2YCBA 4A10A 1Z5ZA 2X7HA 2JH9A 1F0PA 4WBNB 4PLFA 1H9CA 4C1NA 2I29A 3ICPA 5C1OA 3RYFA 1ZLYA 5BN4B 5L3RA 1XRJA 4EGSA 2AMLA 1JBEA 3FSGD 3OIYA 5K0NA 1NN5A 3SBOA 4MW5A 1YDEA 2XYRA 4JOCA 4XVUA 2GFIA 1DEXA 3HBAA 3G9ZA 1N9ZA 3DBRA 1NQOA 3AY3A 3PFCA 1R8JA 4CHGA 4XTRA 5HIIA 1P72A 1QV7A 2QT0A 3EYWA 4Y2UA 2YL2A 4FGWA 5IKEA 2V7UA 4B3MB 1KDVA 1QYRA 3IVMA 4NOMA 4HDMB 1NI5A 3SEZA 2VUSA 2NSLA 1KYTA 1E2LA 3AW9A 4MHSA 2Z95A 2PD6A 1JVSA 1V9SA 1QJ4A 1TECE 3HV2A 1XRLA 2X5XA 4HDNA 4XX0B 2CE2X 4EJFA 5IVKA 1KK3A 3EFEA 5LQAA 1OU0A 1MN6A 4TYPA 1QRRA 4BLVA 3KUCA 4TZ0A 3A6KA 5IVHA 1LS1A 3M33A 4Q93A 2OENG 5F2OA 3UA4A 3BIWA 1PE0A 2NT3A 5F9MA 5I7RA 1IBSA 1CY4A 1JI0A 1R6AA 2A1IA 2YZKA 2FPIB 2M6SA 4YT4A 1O6BA 1SOUA 2OMEA 4Z2AA 4F45A 1H8HD 4P93A 3VR2A 3KEOA 5BQFA 4KAJA 2PBRA 4LJ5A 2CYCA 5TGZA 1L4BA 1L7OA 2I7DA 4GWKA 4X6XA 1LPNA 13PKA 3ESXA 1H1LB 3DDCA 2CMDA 3KKKA 2W7TA 1JHRA 1VL5A 4AJJA 2CL6X 1CP3A 1QUFA 4BP8A 1I7DA 5CK4A 5K8CA 2FX3A 1K4YA 1X1SA 2QD2A 5CU7A 2BEVB 4J9UE 3GJ4A 5IFKA 2C7OA 3JYHA 3PEYA 1MTOA 3AEUB 3TQSA 1FA9A 1HT2E 1OUMA 3GG9A 4NF2A 3VC2A 4ZN6A 1PL7A 1T25A 3GN2A 5B2EA 4AY6A 2VYVD 1O97C 2XNDD 3S70A 1QAMA 2OZEA 4TYMA 3O3MB 3CJQA 4XQCA 2BISA 1XG5A 2NIPA 1V8OA 4DNQA 4ESVA 1FBNA 5B4TA 1RM0A 1VSBA 3G0CA 1E3MA 1IAQA 1Z4OA 2IZ1A 4ARUA 4BEBA 5D00A 3A1SA 3I9KA 3KTOA 2BV3A 1GCGA 1K9SA 1X2BA 3DVAB 3LIPA 4GXNA 2K7ZA 4L9SA 3N2ZB 1I1NA 1KMHA 4HATA 3Q9SA 4IGAA 3N0WA 3LXXA 2PTHA 4AS3A 1OVGA 4CLOA 4L7QA 1N6HA 1W5TA 1TTPB 2XDAA 4XGRA 3WI7A 1QG6A 2CNKA 2QAGB 1QG0A 1IHXA 1VYVA 3BF7A 3DFUA 4JJ7A 1IH8A 3HO8A 3CM0A 4HNUA 4DANA 5BVGA 1AVTA 3MFYA 4OD0A 3ZCQA 5ITVA 2OFXA 3KZVA 4N7JA 1MNAA 2HM7A 1N8TA 2R8RA 4IKOA 1UM8A 2NU9A 1S4QA 2IBMA 4Z2YA 5KAPA 3WJ7A 4Q9HA 2G0TA 2HB6A 5EXSA 4JUBA 3ZCUA 5EXPA 3ZG6A 1FFSA 2FN9A 4X3OA 1J0BA 3AY7A 3EXHB 3KQSA 4DSZA 1ZW6A 1XTZA 4ACBA 3GJZA 1H4TA 2PKQP 4AF8A 1W85B 1C3OB 4RF2A 2QBYB 4CEIA 5AYVA 1ORHA 3OHSX 4L8FA 3HG7A 4UNQA 4RZ2A 4URHA 3S2IA 5BMOA 1M6VA 3KPVA 3F3MA 4J3JA 1GT91 3EEBA 1G5IA 3NUGA 4GIBA 3OFJA 3CNNA 5JZMA 1USIA 3SQDA 4ITVA 2OXFA 4E33A 2ZE8A 5LBUA 3CLHA 1AQUA 3FG9A 5BQPA 1PSWA 3SYTA 4P82A 1WNTA 3GYGA 4H7HA 2AFIB 3C6XA 5F7ZA 1WSDA 3ED5A 3R5KA 3CH6A 3K70C 3KX2A 1P2VA 1J09A 3UUWA 3DKVA 3O3OB 4Z0PA 3QYPA 2WU3A 2BZSA 4Y9TA 2WB2A 4D9JA 1KJ8A 1YGYA 4OCZA 1H2ZA 5I51A 3I2IA 1JR6A 5HCIA 5JZSA 2BM1A 2ZGVA 4UPVA 4C04A 1ECJA 4F5ZA 1IN7A 1MJNA 2WUEA 1TJYA 4X1IB 3CRNA 3L0BA 4O6VA 2NYAA 1C30B 3VZPA 1ZHFA 3VAYA 3CS3A 5SV2A 3EQ7A 4QDTA 4NMWA 4QXPA 4GBMA 4PG8A 3PQCA 4GICA 2X0NA 4NBWA 2QORA 4AU1A 5TQVA 3WRYC 4PNZA 3IP6A 4KO3S 1WV0A 4TUYF 4ZDJA 5B55A 2OK7A 4ZQCB 4JC4A 4DMMA 3AM5A 3H2YA 4CV2A 4XWKA 4H6VA 5B1DA 1RS0A 3VNSA 1CK4A 3WLEA 2WT8A 3KU1A 4ZCSA 1SCQA 2A5FA 5LN1A 3PL1A 2W6JA 4U0JA 4UBMA 1NF9A 1E0KA 3LRPA 4HQ6A 4EF5A 1FFEA 1EUDB 1KQ3A 2ZEJA 3VDNB 1NJSA 3DKRA 3NJ4A 5J2UB 2E5WA 4BEVA 2ETVA 1I4TD 4PHFA 1TM4E 3ELYA 4KQ2A 4B87A 1XKXA 1AXEA 3CJTA 4I55F 721PA 1IUOA 3AR8A 3L4JA 1WBDA 4QRHA 4X44A 4Q1VA 2B5OA 3R7LA 5CFRA 3ECSA 5MFPA 2Q5OA 4J07A 4FW8A 4X92A 5C80A 4GXTA 5F5XA 1A9RA 3PYLA 3T5DA 3QYAA 4D1YA 2ZYWX 4UMFA 1MZVA 4WGGA 2EGHA 3W4KA 4TTPA 3LXRA 2MMGA 4OXRA 1IM5A 1GDDA 3MOSA 1EKXA 1QIEA 1RWVA 1XWWA 2I2BA 1TAQA 3IVRA 4KQCA 3A4VA 3S8YA 3B1WA 3R5XA 3CF4G 1XZCA 5LQNA 3T7DA 1U28A 4BFVA 1HFJA 1XRSB 1E4EA 4ESEA 3VYWA 1J0EA 1JHOA 1JHYA 1W4AA 2XKJE 1RAHA 2CFRA 3EHDA 1D6MA 4FD3A 2FUEA 4ODIA 1P0MA 2JAPA 4XH9B 4QTYA 1E9CA 2CJWB 3ITKA 2RGUA 3ZNQA 2PX5A 1NVTA 1I9CA 1AA9A 1SUEA 4L3OA 1KR5A 1PVOA 1W1UA 1IK6A 1F06A 2AK2A 3ACBA 2ECQA 3MWGA 3TZBA 3HR4A 4LF7B 4MW0A 4AT1A 1M2GA 2X3YA 1IL0A 2BE7A 4EA6A 2IELA 3O8LA 3LDGA 3UJPA 1CYEA 5CGQB 2ASEA 2ADFA 4Q00A 4JP3A 2VJNA 1X38A 3ZZ1A 3P7MA 1NPYA 4X00A 3MGGA 3SXJA 3TVDA 3VR3D 5EJ4A 3IULA 1NTRA 4P1ZA 3DHEA 1FUUA 2I2CA 1LK5A 3C4QA 3KZXA 1T9CA 5K6AC 3Q8KA 1XNQB 1EU1A 4A6EA 1KP3A 1DEKA 1V37A 2H51A 1M0SA 3DLPX 4J49A 1MAUA 3E8MA 4B84A 4EPWA 4J0EA 1MOZA 4CTMA 5T67A 2SBTA 2R7NA 3RF7A 5LMZA 1H1DA 3A0UA 4LQDA 3PWSA 4KMMA 1U7PA 1XMIA 4YN3A 4EJ6A 2BZGA 1JDNA 3L46A 3B1FA 4QOJA 4EYQA 5LNK6 4YXWD 1U8AA 3DO5A 3IQGX 3R41A 1JH8A 1PR2A 2XDYA 5DN9A 3EXEA 1JPJA 4I50A 2CWDA 1OF1A 2YWJA 5IC6A 3UMJA 2R5FA 1KQFA 2YQ4A 3I5AA 1Y7LA 1FJGB 3IUPA 5CEJA 3HYCA 3O8QB 1ESMA 3A3OA 1W30A 1T8WA 1WMEA 1YR8A 1MKYA 3MHPA 4BLQA 2PD4A 3N2NA 3K9QO 3L1IA 5I9TA 2B5VA 4AY5A 5LQRA 2W22A 1II8B 1N25A 4CL0A 1MHTA 1JG1A 5ALTA 3SXUB 1YA6A 1YB4A 1JHZA 3COJA 2W2LA 4B79A 3LVQE 4CEHB 4TT3A 3V9AA 2PUHA 3THYA 2VNKA 1BE1A 6CHYA 2AEFA 2ZR9A 4I5GA 4WGFA 3F5DA 2B21A 1XALA 2H31A 1XGKA 4MQFA 4LMPA 2FV8A 5FHRA 3MT0A 5LMCA 4I5EA 1XEXB 3Q8LA 3JS5A 1DG3A 2AMYA 5ALJA 5EJIA 4RV4A 3FCXA 2FAXA 5ULLA 2RH9B 5DM1A 3UWOA 4F1JA 2C2HA 2RHTA 1U8ZA 3H0CA 4AC9A 2IIVA 1SHKA 3N8DA 3H04A 4KR3A 2A9OA 1Z22A 3PCRB 1WOYA 1YSCA 4C0AC 4EBFA 1OJLA 3HJFA 3P9SA 2WP8J 2J0QA 3UHAA 2D7CA 5JT1A 1P62B 3PUWA 5DE3A 5BWBA 4CKCB 3GWGA 1KSGA 1XQ1A 4OLHA 1JMVA 1L4EA 1BIFA 2I6TA 1XVIA 1YJ8A 1CU1A 1U1EA 1OAKA 4QLAA 5EQFA 3IVCA 3WWYA 1Y3IA 1VJ5A 2VI5A 2HIHA 3UCFA 3NDBB 3AUAA 5EG5A 3LA6A 2OC9A 1V96A 1BO6A 1R3UA 1S02A 3LC7O 2REQB 5AVOA 1ZAYA 1FXSA 1CQIA 1E3SA 1TVKB 3JQ8B 4EDFA 5DM70 2HR1A 4A0HA 3T1YB 2G7ZA 3J81A 4LZAA 4XM0A 3DNPA 4PYLA 4KLZA 2RK3A 2I6FA 3HGTA 2C99A 1QQBA 4L57A 4HLUC 3H87A 3M5WA 5FBLB 4M8IA 1RI2A 3OOYA 4PCLA 3BGOS 3B6JA 4EG8A 4L3VA 4NE2A 1TM2A 4TVBA 3GHHA 5DRYA 5LQMA 2PSHA 3VISA 1R6BX 1XZHA 2QF7A 4R8LA 2Q8PA 1CIVA 4X93A 2R8PA 1WPGA 2O2HA 1QQ6A 2IODA 4O4LF 4YLEA 3ZY6A 3VH2A 4QQKA 1ELOA 5LMNB 4OI0A 2LTAA 1IB0A 3E7WA 1KBOA 2VUHB 4JQYA 3M7IA 3L1KA 4DUGA 3QTBA 2QJRA 3N75A 1CQPA 3ZWWA 4E2FA 4BGUA 1GNTA 4IDCA 4BNHA 5ADVA 1I5EA 4AQDA 1GAEO 3PUYA 1MPTA 2EL9A 2F9MA 4CMEA 5DOZA 3T5TA 3O8RA 1LLCA 5B64A 2VK1A 3C5EA 3NFRA 3GX1A 1VKNA 1XCJA 2ZJ0A 4L95C 5HJ7A 1X7YA 4IDDA 4IL5A 1OWNA 1D2HA 5CMLA 3IB6A 1AD2A 1PR0A 5LDDC 1KJQA 1MVOA 4IIJB 1K8XB 4M9XA 4IS3A 4XPZA 2WHXA 3GLVA 2A0YA 3EEFA 3IESA 1L6RA 3ONWA 4OQYA 5EHGA 3U3KA 2BLNA 2P9GA 3AI3A 3N39C 3T7JA 4BFYA 4LX0A 1HBJA 2JDID 2QK4A 4XWTA 4GXQA 5DB4A 3A0RB 2G1UA 1EX7A 3IXLA 3HVRA 2V0CA 4JT8A 4CCSA 4CKXA 1KIAA 2OB2A 4KFCA 1CDEA 1JIXA 2DFKB 2DUWA 3EWAA 1OFUX 1JQLB 2VH1A 3QKSA 4FNGA 1C0LA 1YCGA 3F5QA 1KEEA 1AURA 2H1FA 3B3GA 4ALLA 3H4VA 4WY2A 4ZHQB 3IO5A 3S6JA 1MB2A 4PAGA 1MX9A 3RWBA 3RVMA 3UH0A 3H75A 5K99A 1P5RA 1W4RA 1MORA 1WSWA 3ADOA 3IOCA 3W1EA 3SC2A 4E2WA 5JYEA 1TRHA 1M1NB 1NX6A 1VZ3A 1Z68A 2RBGA 2ZLBA 3LLMA 4ZIRA 4KYIB 3IQZA 5F1OA 2PXAA 1ZL2A 4YRLA 4G0MA 1VSTA 4KBFA 4KXYA 4Y6QA 3T4UA 4MUEA 5COQA 2A33A 1UDAA 1WIWA 1PLLA 2Y0EA 2L69A 4PLZA 3DV2A 5EUMA 4BFLA 4EABA 5K8JB 1UKYA 2ZE6A 1GQYA 4CEJB 3WS7A 4GZ6A 4JUAA 2FR8A 2XGJA 2H4FA 3PQFA 3DE4X 4PLYA 3K2QA 1USKA 1ZIXA 3NBYC 4Q37A 1QWSA 5TSDA 5BPFA 1E2QA 4EWLA 3EODA 1NV9A 3E61A 3KHSA 3OE7D 4Y30A 1KU6A 4R2WA 1Q1AA 2C7GA 4NOKA 4R9UC 3H5LA 3HDTA 1DAPA 4Y1FA 3ZDZB 4CF6A 3DUFB 1AG9A 1TT5B 4ZTBA 2ZWAA 1GVNB 2JJ1D 3IKJA 2DJ5A 5IF9A 1Z5OA 2ESRA 2NV6A 3LDUA 4L5AA 1G4HA 3EGIA 1W4LA 3KJHA 3BB4A 2BN4A 4D8YA 1BYIA 1HQDA 1FNCA 4GKAA 5I5GA 4MMXB 4BV3A 5FUBA 3W5AA 1NBAA 4Q48A 3BRWA 1HG0A 3F74A 5AXDA 2BKEA 2IPOA 3SBXA 1IPFA 1PNQA 1NVDA 1B6RA 1YUBA 2F3SA 3ORSA 4KH1A 3VNRA 1GZVA 4NBVA 4KX5A 2ZRIA 1WRBA 1MPXA 1UOQA 2HLPA 4BNKA 5J63A 4LBZA 2EIXA 5F51A 3TQCA 1OX4B 1QX3A 2CCJA 3WWZA 4HOYA 3BBPA 4J0GA 4LXGA 3S4YA 3MLAA 4LOIA 2RGXA 3BREA 4KQGA 3VJKA 4EW6A 3IUNA 1NF3A 4BMCA 4V02A 4N41A 1BH6A 3NHPA 2A9KA 4G1BA 4QXAA 4EW3A 1US8A 2I4MA 2FRDC 3A27A 4M1TA 5E7JA 2V8BA 3O6VA 1FYXA 3TR0A 3QFTA 5A3VA 2R7KA 3T7RA 3DB1A 2GBFA 3DV0A 4FGJA 1S1CA 2ACKA 4E5KA 3C7CB 2C4WA 2P27A 3R0VA 4ANFA 4JQSA 3F9RA 4CIVA 2C84A 4UARA 4LSZA 3KIPA 2G63A 1HNNA 1OOEA 1HZJA 1RWMA 2V7EA 4LNUB 4Q4HB 5MGNA 3O90A 2FW1A 2EEPA 2X5JO 4IV5A 2D8MA 1Z0KA 1SKYE 2B36A 3R4VA 2HZ7A 4NPCA 3U17A 4BC0A 2O6LA 2Q6KA 1NZFA 1VHTA 2JGEA 1HXHA 5DK6A 3FDFA 2WKQA 2PS1A 2LCQA 4A23A 1G98A 1PLJA 2FXVA 3BMXA 5JTTA 2VWPA 3CNEA 3LH5A 1DWQA 3SEQA 1MXFA 4N0EA 1G66A 4IF4A 1M10A 5FADA 3W8RA 4PYJA 2B4YA 1E1CB 1FW6A 1JU3A 1UZNA 3CEHA 4JX8A 1NLMA 4XYBA 3OAAA 5JARA 2YYSA 5DNDA 2C98A 3T34A 3CUSA 2XVAA 3AM4A 3MS2A 5CAEA 1FZTA 4EQ6A 3ZD8A 2VXCA 4NK4A 1XDZA 2PH7A 3VBEA 1KQPA 2CLOB 6LDHA 2IXDA 4UNIA 1KMCA 1DRKA 1RBYA 3EZLA 1Z2CA 2IVFA 3KOOA 1LJ8A 1UBSB 1SEVA 5EIAA 1YZFA 2C58A 1OXMA 1WW3A 1K6MA 2HXGA 2ZSBA 2RHLA 3B1YA 4L8VA 1SVIA 3WBFA 4DC0A 4XIGS 4MV4A 4V03A 3PT9A 4E07A 5T3UA 5C37A 1E92A 3D6JA 4G0UA 1E4YA 3U44A 1NLYA 3MCAA 4JU9A 4L4ZA 1T9GS 3GRAA 4PAQA 4DPMA 1G8HA 3ZYZA 2OQ2A 1T9DA 3V7WA 4AFNA 1U65A 2I80A 2Z6AA 2P2YA 1HX7A 3ILVA 1JT2A 1HYGA 1MTZA 3PB3A 4GX0A 2OK8A 1Y7IA 3IDAA 1KP2A 1EK2A 3IBGA 4ND4A 3U48A 4YPOA 5BMVA 1J70A 1IY2A 3HR7A 2CF5A 4JYBA 4QWWA 1KZHA 1QMGA 1VLLA 1Q12A 2CZCA 4DIFA 1GGNA 1T1GA 5A4DA 3GUHA 4HEJA 4DWWA 1I2MA 2QP4A 2JATA 1E2GA 4EM6A 4BMNA 4M2LA 4RPGA 3CNOA 4MMYB 4IM7A 1QRDA 2O9JA 5BOVA 4JIGA 1Z0DA 1GYQA 3I12A 4NYMR 4HVLA 3NB0A 1E6UA 3NKLA 2J09A 2VQEB 3D4BA 4ICIA 1C9NA 2QN1A 3OQVA 1Q3HA 2ZWPA 2GM9A 4R2MA 4L0CA 3BXOA 3KKEA 2DHRA 2JS7A 2GNOA 4WKOA 3UCXA 3QZUA 4FHCA 1UDBA 2DHDA 2PSSA 5F5LA 3NV9A 2PMFA 1CIJA 5BV2P 4G5HA 4OP3A 4HDKB 3GAMA 3OG9A 2V96A 2DOKA 5REQB 3MYYA 1IAVA 3B7PA 4MKRA 1GLGA 1ND6A 4RVUA 4HS9A 2QUKA 3L6UA 3RSFA 3B12A 4WHMA 4B4VA 3ZQJA 1NQAO 1U0OC 2EYQA 2XTZA 1KAOA 3TRFA 1LXCA 1X92A 4D9HA 4OHFA 1H23A 1NN0A 3LFUA 2XF8A 3HNOA 2PSDA 5E7QA 1USGA 2J9GA 4TLMB 2OKGA 3NBUA 4N7BA 5JFOA 3TUZC 2LNDA 2O0HA 1DLIA 1Y3BE 1UK9A 2H4ZA 2PPLA 1UBGA 2W11A 2WJZB 3BTOA 3FF1A 5EHIA 4ZI7B 7YASA 3GLRA 4BLUA 1PX2A 3N3BC 5AK4A 3M70A 5GV7A 3I3SR 2Y66A 2DRIA 1XVUA 1RKVA 3QKUA 4TV9F 1A2BA 4RF3A 1GTRA 4ZGGA 2XGMA 3CKLA 4Y0AA 1GR0A 2Q5EA 4II2A 5AW6A 1GPBA 4LOKA 4KQXA 2QGNA 2GJAA 3OIFA 3C87A 4AF7A 4N7MA 5LOVB 1CFJA 2PZGA 3TJRA 2HRRA 3TOSA 4QT4A 1JJVA 2A67A 5CFPA 3TCNA 3BJZA 3AQ4A 1DDGA 3B70A 1ADYA 2BBWA 2NUBA 3DBOB 1TW2A 1ZRHA 3PFBA 3EC1A 1RZRA 3HFRA 1CNFA 3ZGNA 3K9FC 3K1YA 2SECE 2Q27A 3NHWA 2Z5VA 4W8GA 5K2MA 1O89A 1EM8A 1S8NA 2JKZA 3KHKA 4D81A 1NHWA 1YO6A 2CE7A 4ALKA 2NQ8A 1DDOA 5JXJA 1Z4LA 3GPCA 4BBAA 1GCOA 4BLSA 1BDHA 1QBKC 3BRCA 3OFND 5CW1A 4WTOA 4KE9A 5G40A 1OBHA 2DU8A 3DJFA 4PGFA 3WDSA 5GINE 3S1AA 3WWPA 1NBIA 2XXAB 3V8PA 1COWA 1WNFA 1I3KA 1RWQA 4QHTA 2ZJAA 2Z8ZA 2JLRA 2DFVA 2V6MA 2WBLC 3M5DA 3OICA 2IA5A 5H70A 3L8GA 4ABYA 1G7TA 3OTWA 4RMNA 2IKQA 4HGPA 4MQMA 4MWBA 1Q0RA 4BPBA 1C80A 2O7RA 2P3QA 1XQWA 3GFOA 3GWZA 4UZSA 5HIJA 3KVVA 2IRWA 8GPBA 3WLTA 5AMXA 1RHUA 1NNLA 1QHXA 1A7AA 2IHUA 3DGFC 1VI2A 2QEQA 1N2ZA 1XN1A 2QVLA 2P3LA 4Y2XA 2ZUEA 3RUAA 3OX3A 1NRWA 3KOZA 4KQMA 4MPRA 4TOIA 3JZFA 1LNSA 1AS3A 1C4OA 2HSEA 2VOJA 1ZJYA 3G17A 3K92A 3PXEA 3VXKA 5JXGA 3I0NA 3C43A 1UFRA 4OHZA 3H1AA 2R68A 3P2MA 4I8IA 4I8DA 2GLXA 3E9CA 4LWOA 5A7FA 1C5KA 4YP1A 1JIVA 2QDXA 3F6SA 2BM9A 1L8LA 5HK8A 5HKBA 3O38A 4WAUA 2BGMA 2F8TA 2JJYA 1UKVY 2YUIA 4JFAA 5C31A 3KZCA 1PGQA 3DT6A 5TQ2A 5DTJA 4BNFA 2AXQA 3EWSA 5JSKA 2X9VA 1YZUA 5KTYA 4RLFA 2GEJA 1Q0PA 4XJSA 2JGDA 1TIKA 4F84A 2M2IA 4C2UA 3OI7A 1GTG1 1KGDA 1Q77A 2HD4A 2YZNA 4RV9A 2VTBA 1AGNA 2FPMA 3WAKA 2R11A 1BZYA 3WICA 5KQPA 3MJ4A 1LLDA 1MRSA 1YJCA 2XUDA 5IJAA 5IVDA 1L5SA 3EC2A 2VDUE 4BJ1A 1GPNA 4HK4A 1XKLA 2QAGC 4L85A 4MGYR 4WDRA 3UOAB 4PSVA 3W3ZB 4E2YA 2CFIA 2QKYA 2B61A 4FFVA 1Z38A 2CFSA 2A5JA 2I71A 1SN7A 2I8LA 2VPQA 4FYPA 4GU5A 3W9SA 1UMCB 2IHBA 3O9MA 5F7XA 3D8HA 3EH1A 2JHGA 3EGDA 2HHJA 3JQRA 3L0YA 1JUDA 4JU8A 4P4GA 4HEQA 2VDRB 5G4KA 3PYMA 4MVCA 1T1SA 1SG6A 1UWVA 3UXMA 1VBMA 1B42A 4AZTA 4UOZA 3SBDA 3DWGA 2D74A 4QDJA 2FUG1 5A5GA 1HOXA 2BF7A 1HLFA 2EKBA 3L1VA 4EO9A 2QX7A 4B47A 4KZPA 1G8GA 2R8EA 1Z63A 2AOXA 4FN5A 3X1JA 5JFGA 1XXLA 3ZUPA 1JXOA 5G3ZA 1C41A 3CCBA 2IV2X 2IPNA 5J3JA 2VZ8A 4ZEXA 5KYWA 5JFTA 1I4DD 2HHCA 2NO4A 2GYVA 2YTZA 2ZS7A 3H6KA 1C14A 3V1KA 1E1KA 1J99A 1NXPA 2GOYA 3BKWA 4OAQA 4UHDA 1UBJS 3MTGA 3RU9A 4HNTA 1SU4A 3CJRA 4JQZA 2GRUA 1JJBA 4ZVUA 3PYXA 4M0PA 1PK9A 1H2AS 4LJLA 4TWRA 3QEKA 1PJLA 5CNKA 3LE8A 3JQ6A 3LC1O 4PN3A 5F73A 4G67A 3BQ9A 4PTLA 4L8GA 2VWGA 4ENPA 3KXKA 3BSYA 1UJ6A 1RJDA 1SIOA 2E7ZA 1DOZA 2TS1A 2ZSKA 3ZGVA 1CQXA 2EZ4A