3FYUB

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
318
structure length
317
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 119
structure length 317
sequence length 318
chains with identical sequence D, H
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuB00
4ZI5A 2GZSA 4BDSA 1IUOA 3D59A 4GI1A 5AK5A 1XKLA 3QBJA 2HRQA 4H7IA 5JYCA 4Q3OA 1TCAA 2PM8A 4JUIA 1EB8A 5A7GA 2JGIA 3VKFA 1XZGA 3H0CA 4IO0A 1ZICA 4HZGA 4FNMA 1MX1A 1A88A 1E8DA 3C70A 2XT0A 1Y7HA 3V1LA 1HPLA 4DM7A 2BKLA 1U4NA 2WTNA 3HRHA 4PW0A 2XLBA 3S2ZA 3WKDA 2C58A 3C6YA 3AZOA 2YYSA 3HYSA 2IX9A 3G0GA 1XLVA 1O6FA 2XUFA 5ALZA 4ZV9A 4BP8A 3O4IA 2WG1A 5JAUA 2VSQA 4FFVA 1MNAA 5HFAA 4AN0A 4QLAA 3IDAA 5CH3A 3D3NA 2HL6A 1EI9A 3G02A 3ZI7A 3KDAA 3IB3A 2HA7A 3HEAA 5ALHA 3FLAA 3DDUA 3C43A 1BCRA 4QDZA 1XZCA 3M83A 1XFDA 2ZJ6A 3M81A 5K5EA 2PU7A 4RGYA 2C4HA 3BDVA 4NZZA 1XRLA 4MQMA 4PNZA 5CTAA 4KAFA 3I28A 5JZSA 4LXHA 1EX9A 3AIMA 4FDMA 4QDOA 5HF8A 1J07A 4HS9A 5AKIA 1OXMA 4DNPA 3W06A 4B9AA 2HFJA 1XZKA 3STWA 4CIAA 1TK3A 1CUYA 1JJFA 1ZOIA 1VXRA 3PF9A 4H77A 2WUEA 2WIFA 2ES4A 5LP1A 1FFAA 2AJCA 1HDEA 4PSCA 2HA2A 2XQGA 4K5QA 1Z68A 2WU3A 4UFOA 1N5RA 4AZ0A 4LYEA 5C8VA 2QRUA 5CT5A 3WIBA 5T4HA 4CG3A 1G5FA 1R50A 2JGJA 4XWGA 5AKZA 2PSFA 4AO6A 2E3JA 5HZGA 4H18A 3S8YA 4TVKA 2R8BA 4MEBA 2HFKA 2GBGA 4UHHA 2ACEA 1EVQA 4Q3KA 3E1GA 3WWDA 2BGRA 2XMZA 1T2NA 3HJUA 2PUHA 4UBLA 5DJ5A 1XZIA 2AJBA 3IUQA 5LZ5A 2XQFA 4A23A 4UHDA 1X2BA 2C5FA 4CI9A 2H7XA 3R3WA 3SC2A 3I1IA 4X7BA 1QIKA 1VE6A 5EFZA 1CEXA 1CV2A 2QT9A 4W1RA 1G42A 5AI0A 2H7CA 3A6ZA 4K6KA 1CIJA 4M0MA 1ODSA 3D5EA 2Z3WA 1W4LA 3YASA 4Y2XA 3PDCA 2OG1A 3E4DA 4BAZA 4QZVA 2J4CA 1SFRA 1UWCA 4GBGA 4I3FA 4MQLA 3F9CA 3ZLVA 3PUHA 4Y2SA 4HAIA 3DOHA 3LIPA 2JGMA 2Y6VA 3HABA 5IVHA 2JGKA 3G7NA 4QWWA 4BCCA 5SYNA 1K63A 1CVLA 1TAHA 3I2FA 1QIJA 1ZIYA 5JASA 5E4JA 3QYJA 4TGLA 5JADA 1F0NA 3WZMA 1CUWA 2XE4A 2BFNA 1E3QA 2PX6A 5DTIA 1OILA 5CBKA 1UXOA 3WQHA 2XUDA 5DYWA 1LPOA 4IH1A 2VQ6A 5EHNA 2CEKA 4HRXA 1L7RA 1QO9A 4CG2A 3STTA 1E5TA 3W2TA 3B5EA 5I7UA 2OQVA 4QLOA 3DOIA 5IVIA 4E46A 2QJRA 3WLAA 2WILA 3AJAA 5E4TA 4FLEA 1EK2A 5AK4A 3WWPA 3I6YA 4C6HA 3FLBA 4LKOA 2QKYA 4OSEA 1CUCA 4BC0A 1B6GA 3FAKA 1E8MA 4PQEA 1XZBA 3CN7A 5BOVA 3WL7A 1CUEA 5AM0A 5K3FB 1QJ4A 4NS4A 2QTBA 2XUKA 5AKGA 3FYTA 2XUQA 5CW2A 3ICVA 4V2IA 1WHSA 5LZ9A 5H3HA 3U0VA 5LYYA 1H2ZA 2I78A 4BB0A 3FLEA 5JATA 3QMVA 4KRYA 3NGMA 1IUNA 3WWEA 5JIBA 3VVMA 1E66A 3E3AA 3WWOA 3TRDA 3OURA 6YASA 4G4GA 4Y2JA 5JD5A 4H35A 4BDTA 1ZJ4A 2BAGA 4H7EA 3V1NA 3I2JA 1F8UA 2XLCA 5EHXA 2IIVA 5FKJA 2RIPA 3BXPA 1DT3A 4Y2QA 4J03A 3H17A 2HA6A 2Z8XA 4L72A 4B80A 1DWOA 2I3DA 1K6EA 1P0MA 1PV1A 2HM7A 2VJAA 3JYHA 2WUDA 2P8SA 4X97A 1TKRA 3FVRA 4G1FA 5CT8A 2WSLA 1QIMA 2PSEA 1YS1X 2ZYHA 2JGFA 4Y2UA 3FCXA 4P93A 2GBIA 4U2GA 4W63A 5FRDA 2AJDA 1EK1A 3IULA 4G8CA 3F67A 1EHYA 4AQDA 3WKBA 4N5HX 4EY5A 5K3CA 3WK9A 1QTRA 1XZEA 3DCNA 4F5ZA 3I6ZA 5D6OA 4BTLA 4Y7DA 2FX5A 2VTVA 4S0XA 1R3DA 4H7DA 5KWIA 1XQXA 1QE3A 5JANA 3CCCA 4DMFA 4UBMA 4QNNA 4N8EA 3F8SA 5DYYA 3R3XA 1GQRA 4ZV7A 1WPRA 3NUZA 5A6VA 2RHWA 4RE5A 2Q0XA 4B0OA 5IVKA 1ORWA 4UHCA 4QDUA 4A16A 5YASA 5A2GA 2XQJA 4B6GA 1LGYA 3IA2A 3ZPXA 4FKBA 4MYSA 1F6WA 1C7JA 1MTZA 1DX4A 2XMDA 2DHEA 1MO2A 4B81A 2VAVA 3WYDA 1CUAA 4W1PA 4X00A 4D9JA 2X76A 3WK4A 4W1QA 4WY8A 1MU0A 3FSGD 1KU0A 3C5WP 4J0IA 1VA5A 3D2BA 2Y1KA 4QE3A 2DSNA 4GEGA 3LCRA 3WWCA 4ARAA 4OYYA 1NX9A 1UZAA 1FFBA 3R3UA 3HI4A 4L9AA 2WFMA 1GXSA 4QDTA 5LKRA 3WL5A 4DNOA 2HHAA 3GA7A 3PI6A 2BJHA 1UKAA 1W52X 3STUA 2OLEA 4RNCA 4B9EA 4EHBA 1FSSA 5FPQA 1MX5A 2OXEA 1UK9A 2GBCA 1ACLA 3VJLA 4ETWA 1CUZA 2DQZA 1Q0ZA 1ZD3A 2RONA 1GQSA 1CUGA 1DU4A 1XRRA 1JU3A 1ZGCA 4E15A 4NVRA 3D4LA 2UZ0A 1EXWA 3ESDA 4AO8A 4AX4A 5AIBA 1DTEA 1QIIA 5C8XA 5KWJA 5FOQA 4P08A 3UMJA 1TCCA 5K3FA 2ZSHA 5K3BA 2GBFA 2PU5A 4BP9A 2G4LA 1XQWA 5DYTA 4C89A 3QH4A 1S8OA 1AMNA 2I03A 3DS8A 5ALSA 4XIIA 3KSRA 2JEYA 4EA6A 2WHQA 5ALPA 4EY4A 1USWA 2OCIA 4HTAA 3ZWQA 4X90A 5FDFA 2D5LA 5JAHA 1VE7A 5JAOA 5KREA 5AM3A 3Q8WA 5AKYA 1DX6A 4J0KA 3G0BA 4LIPD 3KWJA 3R41A 1MAHA 2CB9A 2OGTA 1H2YA 4X93A 5AK3A 3WK5A 1AGYA 1ZI9A 5HCUA 2OQIA 3V9AA 4BCBA 2OPHA 2VAXA 2ONCA 2JF0A 4G9GA 2B9VA 3GELA 3OC0A 1IUPA 2R11A 4WFIA 3MUNA 5ALWA 1RP1A 2CJPA 5FUMA 1A8UA 2ECFA 1CUUA 4GECA 3LIIA 2C0PA 5CT9A 3C87A 5CMLA 1LBTA 1A8SA 4LHEA 4Y2VA 5EI5A 4G5XA 1GKKA 2PKYX 4XJVA 3R40A 1GGVA 4B85A 3A70A 2DCMA 5FXMA 1CPYA 1AZWA 5HF9A 3A2LA 5DWDA 4FFWA 2ZJFA 3B3QA 4B83A 5FV4A 2XMBA 4E14A 2HDWA 3JWEA 2J3DA 4H7FA 1XZJA 5D7BA 4IHAA 1N8SA 1LPAB 5EGNA 2WM2A 1TCBA 3CCBA 5ISMA 4A5SA 2H7YA 4DMCA 5LIPA 4OPMA 3C6ZA 4B84A 4KACA 3H04A 5AKXA 2QXUA 4LYDA 4G9EA 3W9BA 3UUEA 1XRMA 4AMZA 1CFJA 2ZYRA 4C4XA 4GDMA 4KEAA 1SCQA 3HACA 3DNMA 4N8DA 1UK6A 1XZFA 1MNQA 2QZPA 1X2EA 2VJBA 1GZ7A 2O2HA 3R3YA 4PF1A 2HRRA 4J3JA 1Q83A 2HA5A 5AH0A 2VF2A 1UOPA 4KE7A 4TPKA 5JD6A 4I19A 1HBJA 4UPDA 3AUKA 1C4XA 1VXOA 4OU5A 2PVSA 1CUVA 5AICA 3FYUA 4MYDA 2G5TA 3QMMA 5ALKA 5FP0A 2Y2UA 3WIOA 3AZQA 2XQIA 4BATA 4E11A 4U2CA 5JARA 2WFZA 1A7UA 2WJ4A 1CQZA 5AI5A 4BVLA 1QLWA 2DFPA 1CUXA 5T4FA 3HLKA 3L1HA 1XRPA 1RWQA 1AURA 4OUKX 5AM1A 2C5GA 3O9VA 2ACKA 2HU7A 3WA7A 3WZLA 4DMKA 5ALFA 5D3ZA 1GPNA 2ZYIA 3NWOA 2XQKA 5AM2A 1A8QA 3N0TA 1W1IA 1WPXA 4JYPA 1H22A 1QO7A 5CXXA 1DWQA 3GBSA 3I2IA 5EIEA 1R9MA 1QFMA 4Y2TA 3OG9A 4PO3X 5HKAA 1ORVA 2V9ZA 1BS9A 3C6BA 5EHZA 1OCEA 5AI8A 1ODCA 3A2MA 1ZIXA 4F0JA 2JBWA 3ANSA 1UKCA 1UT6A 2Y6UA 4X6XA 3STXA 1JJIA 1GT6A 5AIAA 1BU8A 4P9NA 3NOXA 2W6CX 4ZGBA 1UOOA 5DNVA 1IMJA 3WKCA 2VJDA 1QFSA 3L1IA 2OCGA 1JJBA 1YR2A 4UHBA 3LS2A 4BYMA 1XZDA 2VEOA 2X5XA 2GYVA 4EY8A 5I8PA 1EVEA 2OCLA 2BCEA 1HQDA 1MJ5A 1ZD4A 2O7RA 1FFEA 5E4YA 2PL5A 3D2CA 5AP9A 5FLKA 1T4MA 4MXDA 2XUPA 3O0DA 3PFCA 3PICA 4GW3A 3EQ8A 4H0CA 3G9ZA 1DQYA 1C7IA 4GXNA 4BAUA 3F97A 4M0FA 1O6GA 3I2GA 2WLSA 3WK6A 3WYNA 5HF6A 3IURA 3BWXA 3ESAA 3TEJA 4EB0A 1THTA 3FCYA 4FLFA 4I4CA 4AXBA 1G66A 4U2BA 1UK7A 1M33A 2H1IA 3HC7A 2H9YA 4Y2RA 3H2HA 5KBYA 1SCKA 1JT2A 2CKMA 2AXEA 1ZJ5A 1K8QA 1XZLA 2IITA 1BN7A 3G9UA 2V98A 5C7YA 2X8BA 3W9UA 2V96A 5AHXA 4JH0A 4OU4A 1FFCA 4C4YA 1ZI8A 1AUOA 3HSSA 3UUFA 1I6WA 3VISA 1WHTA 1ZGBA 4KAAA 2JIDA 1P0PA 4DGQA 2LIPA 1CR6A 4UBIA 3VJMA 3O95A 2RI6A 2OGSA 4QDXA 5ALVA 3ANTA 5JD4A 4AO7A 2RAUA 4RE6A 1VOTA 3BDIA 2PSDA 3BL8A 4RPCA 3F96A 3QMWA 4IQ4A 5ALIA 1JI3A 4EZIA 4ARBA 3WL8A 1WM1A 3O4HA 1UK8A 3PE6A 4X91A 1H23A 2WG0A 3X3HA 4EUSA 5AJHA 1TIBA 1R88A 3F98A 5AKJA 2JGLA 5AI9A 1MAAA 4Y9SA 5E2IA 4WJLA 2B61A 4YK7A 3WMRA 3BF7A 3B12A 4MEAA 2ROQA 2HA0A 5BV7A 1E8NA 1Q84A 2YH2A 2J4FA 1QTIA 4X3CA 4FNGA 5AOAA 3DYVA 4BRSA 1LLFA 5AKLA 2B4KA 4CG1A 4KE6A 3K6KA 4J0HA 5LZ8A 2YASA 4FBLA 1DQZA 2WIGA 2XMQA 4NMWA 1J1IA 3GUUA 2OAGA 3QPCA 4J0DA 2HU5A 3O4GA 1MT3A 1YCDA 2QR5A 3KXPA 3KWFA 2VT7A 5T4EA 2VATA 5DNUA 2BUBA 1N1MA 3BJMA 3DL7A 3FSGA 2WFLA 1NU6A 2WU4A 4KE9A 3DL4A 2D0DA 2EEPA 2O7VA 1EINA 3FYUB 1XLWA 3LLCA 2XUIA 1W75A 1HL7A 1LZLA 4GWLA 2QMQA 3L1JA 4BZZA 1HLGA 4HRYA 4WCVA 4IH4A 3OTQA 1FJ2A 3D2AA 1XROA 1THGA 2HU8A 2QJWA 3CN9A 4HVTA 5JZBA 5C81A 3OM8A 3RARA 3G8YA 4AMYA 3G9TA 5HQ3A 3O9MA 4M0EA 1UFOA 1XZMA 5HKBA 5ALMA 5CXUA 2QOEA 4XX1A 1L7AA 4EBBA 2QS9A 5AM4A 3FVTA 4X85A 5AOCA 4Y2YA 1IVYA 3I2KA 4DNQA 2HA3A 3IUJA 5ALEA 3R3ZA 4X71A 1BROA 5AM5A 1CUFA 3G9XA 4QA9A 4OB6A 3VVLA 1EDEA 1CUBA 1YSCA 4UUQA 2XUHA 3VJKA 3T52A 3TJMA 5JAPA 4B0PA 2PSHA 3GZJA 4BE4A 1LBSA 2V97A 4ZXFA 1BEEA 3M3DA 2RHTA 1QOZA 4X6YA 2HADA 5JALA 1GPKA 1QZ3A 1VA4A 4DLNA 3A2NA 3EQ7A 1Y37A 4U2DA 2BUAA 1EDDA 5A62A 3I1YA 4X6UA 4HXFB 3RLIA 4FBMA 2PSJA 2XUGA 1CUJA 2ZYSA 4PV7A 1DWPA 1TQHA 2GZRA 2O2IA 4G8DA 4UFPA 5ALUA 5AO9A 2CUTA 3D7RA 4C4ZA 3IBTA 5EIAA 1ZI6A 2XUJA 5SYMA 3RKSA 5AKEA 3P2MA 2WHRA 1BRTA 3C8HA 3DJYA 5EIHA 3R0VA 5IH7A 5ALOA 4OB8A 1Y7IA 4FMPA 4FHZA 4N5IX 2QUAA 4BZWA 5ALDA 4J0CA 1JU4A 1LPBB 2JGEA 3SX4A 5K3DA 3C8DA 5ESRA 1GPLA 2GYWA 3H19A 5CT6A 3VXKA 4FLMA 4DSAA 4ZWNA 1XQYA 3ED1A 2XMGA 4J0GA 3LP5A 3JW8A 2WIKA 3H18A 4MJ3A 1LPNA 2QVBA 4JYMA 3IIIA 3DEAA 5A7FA 5AI4A 1D07A 4MWTA 2WG2A 1RYYA 4IH9A 1YAHA 3H2JA 3OPMA 4ROTA 2AJLI 3QM1A 1R9NA 4N8SA 1LPPA 3OOSA 1LPMA 1JKMA 3MUOA 2O2GA 1YAJA 3AILA 5K3EA 3DKRA 5DNWA 2WJ3A 1QIEA 2BGNA 3HXKA 1SOMA 2C0QA 3RM3A 4PSDA 5K3AA 4K2AA 2EDAA 3H2GA 3ESBA 2ZJ7A 5CURA 1JFRA 4B7ZA 3G0CA 1IZ8A 3E0XA 5T4BA 1G4HA 2WHPA 3EQ9A 1H2XA 4J7AA 2Z8ZA 1BN6A 1J2EA 1AX9A 1ODTC 1ZD5A 4ZREA 1WB6A 2VJCA 4F60A 1QIHA 3H2KA 4G8BA 4YPVA 2XB6A 4K6GA 2HIHA 3ZLUA 5HFNA 3QPAA 4UHFA 4Q05A 4MWSA 1Q0RA 4U2FA 4DTCA 1EA5A 4WFKA 3BIXA 2DQYA 2WIJA 4QEKA 1AC5A 2QXTA 5A71A 1ZD2P 3AINA 4X92A 2C7BA 4Q3LA 1YA8A 2B20A 2EDCA 1JMYA 4AN1A 2WTMA 3WA6A 5DTJA 3STYA 5LZ4A 5AI6A 4DYHA 3AIOA 4X94A 3T4UA 4PSUA 1FFDA 4UBJA 1DT5A 2QM0A 3C6XA 2WKWA 1ISPA 5CRIA 5D3KA 1BEZA 2CZQA 2PBLA 3BF8A 2WIDA 4CCYA 1LNSA 3SK0A 1X70A 2VA9A 1YB6A 2CBGA 2QUBA 4WY5A 3GFFA 2WFLB 3V48A 4H7JA 5CH5A 3V1MA 1H2WA 2XMRA 3PFBA 3DLTA 3ZV7A 3C5VA 4UBNA 3BIWA 3G0IA 4EY6A 3TGLA 3QPDA 4DIUA 4CIBA 1R4ZA 1VJ5A 1BCSA 4WDQA 5DLPA 4KJXA 2WQZA 4OYLA 2RGUA 4P92A 4W1SA 4Z49A 4L3WA 4Q82A 1U8EA 4WDRA 5HQ3B 3STVA 1QIDA 3U1TA 3I6MA 4GLBA 5AKHA 3IUMA 4H7HA 1EDBA 4ITVA 2JEZA 7YASA 1CUHA 1YB7A 5ALNA 4UBKA 1VLQA 4OD0A 4Q1VA 3CXUA 2Z3ZA 5EHQA 1K5PA 3GROA 2Y2VA 4Q34A 2PUJA 3AIKA 1LZKA 3FWHA 4EY7A 4O08A 3EIOA 4BRZA 1PJAA 4HXEB 4UBOA 1ETHA 2OCKA 4F21A 5ALLA 5IVDA 1MPXA 1NU8A 2BUCA 1R1DA 1XRQA 5AK6A 3WK7A 5ALRA 3DKKA 2Z5GA 4KR0A 3R3VA 4BCDA 4G4IA 1E89A 4BBZA 1XZAA 1WB4A 4C88A 2OGZA 4C01A 4G4JA 2WUFA 4LXIA 4FWBA 3BE8A 5BWCA 2W22A 4X95A 3PF8A 1CUSA 4KRXA 4FTWA 1UOQA 3IUNA 3WI7A 4L0CA 4AB1A 2XUAA 2YXPX 5J3JA 4OCZA 1XQVA 1P0IA 4INZA 3W04A 2CMFA 4UHEA 4CCWA 3WL6A 4K6HA 3FOBA 2FUKA 1QONA 2VT6A 3FBWA 1W76A 3AZPA 5LZ2A 1CLEA 5ALQA 3C45A 1GKLA 2HA4A 4JEIA 1UKBA 4GHWA 5CT4A 4JNCA 2NW6A 2K2QB 5ALYA 1KEZA 3ILSA 3KOOA 5F4ZA 3RK4A 4J0JA 4CFSA 2GYUA 2XUOA 3W05A 3QZUA 4KE8A 1J06A 5CH8A 3O4JA 1U2EA 4W9RA 1MN6A 1XRNA 3WKEA 1VZ2A 3ESCA 2XMSA 4BE9A 3H1BA 4DMHA 1YASA 1QIFA 1XKTA 2PPLA 5HF5A 4ZRDA 1CRLA 2G63A 2XI4A 3QITA 1TRHA 3KD2A 1P0QA 4C87A 1EH5A 1U65A 1QGED 3DYIA 2G5PA 2XDWA 3SWWA 3DQZA 4KYVA 2J3QA 1WCYA 4OB7A 1L7QA 1CQWA 4BVJA 5IKXA 2OAEA 1VKHA 3H2IA 3I2HA 5AKKA 2DR0A 3FYUC 3WK8A 3ZLTA 5I9IA 3ICWA 2WHPB 4H7KA 1JMKC 4QWMA 1XLUA 4YX9A 2DHCA 2WJ6A 4LXGA 3MVEA 3BJRA 5HK8A 1AQLA 1PFQA 4B82A 1YS2X 4BAGA 3PUIA 1MX9A 3QVMA 4KAJA 3D0KA 4Y2PA 5BWBA 2ZSIA 3Q0TA 3EBLA 3MGAA 2FJ0A 1LPSA 1W6RA 1B41A 1WB5A 1IZ7A 3V1KA 5LKAA 1SC9A 2I3ZA 2XMCA 4FOLA 1WOMA 3HZOA 4HXGA 3K2IA 3N2ZB 4UFNA 3WKAA 1DINA 3H1AA 1F0PA 1N5MA 5ALGA 4U2EA 5ALTA 5JZ9A 1HKHA 5A7HA 5C8ZA 4BVKA 1QIGA 3DD5A 1SCIA 3FNBA 4CCYB 1BE0A 1EB9A 5FPPA 1K4YA 2ORYA 4BTVA 4DNFA 1ACJA 3AFIA 4BC1A 1AKNA 3K9BA 2WUGA 4AZ3A 5LZ7A 2FJPA 3WJ2A 4DSZA 5AOBA 2AJ8A 1KU6A 5HK9A 3G0DA 2ZVDA 3VDXA 3EF3A 5ALJA 1VZ3A 5LLSA 4YASA 3WJ1A 1CUDA 3IVMA 3M82A 5ALXA 1YA4A 1XZHA 1CUIA 4XVCA 2DHDA 4WFJA
chains in the Genus database with same CATH superfamily
1U2DC 4ZAWA 5GAJA 1BCSB 1DAHA 2VOEA 3B1FA 3ECSA 3HYRA 1DOZA 3ND5A 2YYAA 1J7KA 1X1DA 3LDGA 4YUYA 1J25A 1ZINA 3D7KA 1MEJA 3DQPA 5SY4A 3ZE8A 4GI1A 5KPDA 1GZHB 2C1XA 2RG1A 3QBJA 3VVCA 3QKSB 1FSPA 2JRCA 2IH2A 4L4UA 1KVSA 2BV3A 4GF5A 4RUKA 9ABPA 1GA6A 4S2UA 5AMXA 4N3NA 4DQUA 5EMJA 1ZRHA 1RPJA 3Q7EA 3BXHA 3KSMA 1T5LA 3PX3A 5E6UB 2PZFA 4JJZA 4OHOA 3VFDA 3VSAA 1XF9A 4TVBA 3C3XA 2DP4E 5JG7A 1C9KA 2H5LA 2JGIA 4I14A 5BNTA 2ZTLA 1XZGA 3QVXA 2YRFA 3X43A 2Q5CA 3H0CA 2NYVA 4IO0A 4Y3UA 1ZICA 2IZ6A 1KQNA 2FN3A 3BMNB 3WIEA 3OCJA 4IVRA 3AQ4A 4RK0A 2ZIFA 1NHWA 2UUCB 1NM5C 2VHTA 4N41A 2UYYA 2G72A 1CR1A 3C70A 3UK0A 5LMCA 1L1QA 3AY0A 4NR0A 3PYLA 2XT0A 1JDUA 1TKBA 3V4VB 4B3XA 4M1MA 2IXDA 1HKUA 1XRSB 2P6MA 2WSMA 5DM2A 4ZVOA 1NUQA 3FVWA 1HO3A 3KDPA 3LPLA 2AOTB 2RHGB 2BKLA 3NHJA 3BOSA 1UANA 2PX0A 3MJDA 2WTNA 2X5KO 3RASA 3LT1A 2P3LA 4LZWA 1DAFA 3A25A 2FW1A 4I9HA 4ZEVA 2VRCD 3CGGA 4ED9A 4K9LA 1VHQA 4JNKA 3S2ZA 1PUIA 3WKDA 1E3TA 1DHRA 4EEKA 2HLHA 3AZOA 1P1RA 3VZCA 3RVNA 3HYSA 1C1XA 3BHMA 2C9OA 3QELA 5KOIA 2W6IA 1DRJA 2M6LA 4CL0A 2X1LA 4CIYA 4YMWA 5KOJA 3FNRA 5I7RA 3W9SA 4WMLA 3I9NA 3NUQA 2RGRA 4B6FA 4PICA 3NKVA 2ZJBA 4E2WA 2W90A 2VSQA 3ZWMA 2WKQA 3AJEA 4TTVA 1WKCA 4JQOA 5C5CA 4G8JA 1MNAA 1WUHS 3FPKA 4HDNB 2R5WA 2WTEA 4TZTA 4YAIA 3PIRA 4UVDA 3SYNA 1KJYA 2Q50A 3VDQA 1L7EA 3RDPA 3NHMA 4YGXB 2WP0A 2Y0BA 3IDAA 2E82A 2DZDA 1NBWB 2HT6A 4MIEA 1QGUA 2C5EA 1EI9A 2VHQA 3H2SA 3KXDA 4R8RA 1NVMB 3TI7A 3IE0A 3GRFA 2J3IA 3LPDA 1AN9A 4DQVA 4FGJA 4RJIA 2ILVA 4OJMX 1PG5A 4ENQA 2HA7A 1EVZA 3HEAA 2M6RA 5ALHA 1HEYA 2F43A 4RVFA 1OZ0A 1A1VA 2XDAA 1O97C 1UBHS 2ODBA 3DDUA 3CMMA 2W93A 3KT8A 3T9DA 2GBLA 5BWOA 1O4VA 2RARA 3D8NA 4PQRA 5HKKD 4FGLA 2I33A 3J7TA 2OLKA 4BNDB 4XTCS 3K0FA 3OJCA 3LA6A 2ZJ6A 4HY3A 1PLLA 3BXZA 3LW7A 3FPFA 4LVNA 5G3YA 2VKQA 5KDDA 2FMFA 2Q21A 1B93A 4MQFB 4BTEA 3UWMA 5DM4A 2CNBA 2J32A 2RGXA 5FPYA 5LCXA 1GV1A 4MKGA 2P4UA 4Z4HA 1WABA 1IBSA 3SE0A 3AFMA 1X1SA 3ACCA 3I28A 3PD0A 3GT7A 3B6IA 4KAFA 3X1DA 4QFCA 5KVVA 3A3PA 3QVVA 2GD1O 5EINA 4GX1A 4Y9TA 3WYBA 1VKOA 1XXHA 2N47A 3WO1A 4QDOA 1RAGA 5DNEA 2W37A 4RF5A 1UJ4A 2FW6A 4C7XA 5AKIA 1JSRA 2PUDA 1LB1B 1VQ1A 3PHBE 4F71A 1MC4A 4NU0A 5AYVA 4BLWA 1M2OA 4MUFA 1UKEA 2XBLA 1UC9A 3OO0A 4QUJA 4MKFA 4RDHA 1LUAA 4HAXA 4M22A 2O20A 3RUAA 1QPBA 1TK3A 2H48A 3F8WA 3K5WA 4Y2GA 5JC1A 4E6EA 4HNAB 2WHXA 3FY4A 1EFDN 1JALA 2Z2ZA 3V8BA 1W4AA 3AEKA 4B6RA 4KODA 4LPSA 4OREX 4QOHA 5F12A 4MW0A 4Y7CA 4X65B 1ZESA 4NF2A 2ES4A 3A4VA 3RAPR 4M9UA 4W5HA 4UUAA 5E2BA 2CVZA 5KMGA 2Z6QA 1S2LA 5ADWA 1KI4A 4HFNA 2HA2A 2XQGA 1XWIA 4NYJQ 1EUDB 5E9QA 3LDUA 4IOLA 4K5QA 2JDID 3O4FA 3S27A 4R9SA 3D9QX 1JEAA 2Y0CA 1OWLA 3BRWA 4QM7A 3OIWA 1N5RA 2H1CA 1DNPA 5BV8A 2BHSA 2QRUA 1CY1A 3MS7A 4G1CA 4HFJA 1M34A 4CG3A 4E6PA 5DB4A 4P58A 1UF9A 3NXSA 1W36C 3WNZA 1ZVJA 4BQRA 3URKA 4AO6A 2EC5A 2EARA 4AX8A 2C84A 2VCYA 3RTEA 2BGLA 2XGMA 3Q6IA 4R8MA 3U0BA 4DSNA 3FPGA 1UZUA 3PEUA 2HF2A 4H18A 4UVGA 3G2IA 4MEBA 4AY4A 1Q0LA 1QBGA 4URYR 3BTSA 4EH1A 2Q5QA 1KY5A 1NNSA 4LGVA 4UHHA 2V5AA 3HNOA 3QE2A 2EWMA 5ENDA 2XD4A 1EVQA 2HJRA 3E1GA 3V2GA 1CF9A 1SVOA 2X4GA 4V2UA 5EP4A 2W70A 4P3YA 3W7VA 4AL4A 4CM5A 1E5QA 4TM8A 2QTVA 3UANA 2BEUA 1SHZA 2OB1A 4JU9A 4TKMA 1LTKA 3WWZA 3GJ7A 2IWRA 1P1KA 3B1VA 5BSMA 1E4VA 2G40A 2PGOA 1W1WA 3IUQA 5LZ5A 3MG9A 1OZAA 3CTPA 3A9VA 3KWMA 1X2BA 2RGDA 3CLRC 4I99A 4YJHB 1K08A 3W7BA 5H1YA 4EW3A 3EG5A 2W43A 3MAGA 2BMEA 3NC0C 3SC2A 1S9DA 3ZNPA 3EXHA 2FEWB 3G5AA 1NUPA 4Z53A 4XD7A 5EAIA 4GBMA 5CB4F 4KITB 4RACA 1VE6A 4QBHA 1QMGA 3A28A 3K1TA 5G0SA 4CN8A 5K0BA 1DQPA 2L0XA 4FYHA 1NW5A 5HRUA 1RRCA 2ZI7A 4W1RA 3G17A 4B2IA 5CFMA 1ADGA 3M4YA 4B71A 5I4BA 2DPGA 4WI1A 1Z6TA 1BH2A 1PFWA 2WWRA 2XNCA 1VIAA 1W7AA 3A6ZA 1SHUX 3UHPA 1E1NA 1OXXK 2WNIA 2NO1A 1CIJA 4J3FA 1XMPA 4YJKA 3JQPA 1NQOA 1VGQA 1EFUA 3BKWA 3UJ8A 3KXIA 4YRIA 1DOHA 2ZUUA 4PSAA 3RUPA 1ZHHA 3PQFA 1OU0A 1YHZA 3QLTA 1QFJA 1TF2A 4OAPA 4TT8A 3WV5A 2YJTD 3ISTA 3ZN2A 4CHGA 4F96A 2YDXA 4UC0A 3SEQA 2HCRA 1ODFA 3IVXA 4C6TA 2OG1A 4BAZA 2JLUA 1B0PA 1ZO8A 1NDHA 5FYQA 3TLMA 5IH3A 2ESRA 1SFRA 2J4CA 4GBGA 4I3FA 3ZJYA 3ZVMA 2IYQA 2GHRA 1EUCA 3ASUA 1M73E 4KGVA 1X8KA 1B6SA 2AEJA 5EHIA 4ZT3A 5F77A 2P9QA 3IT1A 4RAOA 4I1SA 1USIA 2LTAA 1SK9A 2CNKA 2JGMA 2Y1XA 2Y6VA 4M9ZA 2JHFA 3UWSA 4BEJA 5IVHA 1ADBA 2O2ZA 3G7NA 1PGNA 3CZPA 4E2FA 3G2JA 5E7MA 1T9AA 3P52A 3VH3A 5CA0B 3D6VA 4OJTA 1VPTA 1VIVA 1P91A 4P7JA 1R3UA 2NO5A 5TMPA 4V1CA 1I4EB 3PD1A 3BJZA 4NESA 2PFSA 3LKBA 4ZVPA 3KAPA 1U9JA 3S1LA 1E64A 1ZG3A 3M2TA 3VH2A 3MYYA 1IPEA 3T5MA 3UXEA 2ZVQX 1Q20A 3ZK9A 2ZVPX 1KO7A 2CXXA 2BD0A 3S70A 4MROA 2WFAA 1RMTA 8LDHA 4CKCA 1ZNWA 3F1KA 4LY3A 4TGLA 1E4YA 2PG3A 3AUJB 3RS8A 3U62A 5EJ6A 4NBNA 3BEOA 1CUWA 2A1TS 3E5HA 4J7UA 4OXYA 3L1VA 1CZNA 4OMCA 4Q4AA 4KBFA 4AMVA 3O75A 3S7ZA 1XTKA 3PR3A 1A5BB 1M83A 4NU5A 3NOOA 4FMBB 2P41A 7MHTA 5TT0A 1T0IA 3QOYA 1GTZA 1TZJA 4U9HS 2L2QA 4LF6B 3LZDA 3S55A 3R5JA 1KVRA 4IH1A 2NN3C 1NJ8A 2V6JA 2YC2C 3M5WA 2PLAA 2YV3A 1XLTA 3KFLA 2CEKA 4EWLA 4HRXA 1E3WA 2D5AA 2J9YB 3STTA 4AZ3B 1ZH8A 1KKUA 1E5TA 1OKKD 2AXPA 5I7UA 5TEVA 1RHRA 1DARA 1FMLA 1UFQA 3IMKA 2OQVA 3X2SA 2CXTA 3DOIA 1GNQA 2J9FB 2B0JA 4MRAA 3GRCA 1O6CA 4GP7A 4C4AA 1A0OA 3LOQA 4MWCA 4ACAA 4E46A 3TG2A 1P3Y1 1IBRA 2B8WA 2J07A 3WLAA 2WMYA 2GUGA 4NCHA 2A1TR 5LMZA 4EX7A 5IAAA 2GI4A 4OI2A 1LBHA 2BCGY 1SO8A 1EK2A 3CMCO 2BELA 3WLLA 4BNJA 3WWPA 1ECLA 2TMYA 2YVUA 3F7TA 3K6SB 1FJXA 2VJYA 4ARUA 2XB9A 4Z3KA 1HQCA 2GH1A 1NW7A 3VKVA 3FLBA 4BB5A 3NTLA 1TZ2A 1I3CA 3B6KA 3G2HA 4PLYA 1XV5A 4MRRA 1JMVA 1DWUA 4JGBA 2PKWA 4BC0A 2F1JA 1KMIY 4QYIA 5E6SB 4CCAA 2CHFA 5SY6A 3ULKA 1P4HA 3QBDA 3UCFA 1QRAA 5AJVB 5MN5A 1FPQA 2H8KA 3JSXA 4GLJA 2PKEA 3OPQA 3Q3HA 3NVMB 4N3BA 1OTXA 3DZBA 1XDBA 3A6HA 3EOBI 4K9OA 4DKJA 1V9CA 2I22A 4GPBA 5K3FB 3FB1A 5C5IA 1W4BA 3PUJA 1BFKA 1KY3A 3EW7A 4NS4A 4LRYA 4C76A 2EFYA 4RMGA 3VNUA 2VZLA 4HEJA 2EKLA 5HOQA 5K1ZA 4MPJA 3LXMA 3T3DA 4UTRA 2B69A 2XUQA 2ZB4A 2C2YA 4RW0A 3RG2A 5LQCA 1Z0IA 1MOQA 5FI5A 4DZTA 3PEWA 4WNCA 4DKXA 1UWLA 4RL4A 1IXRC 4PX5A 4LY6A 4RHXA 5LZ9A 2Z8YM 4Z0HO 2AHOA 3GJZA 5F73A 3FOZA 5BSVA 1G55A 2QLLA 3RRMA 4I4NA 5A3QA 4BZPA 1OWPA 2VHWA 3DTVD 4ZHQF 3MGGA 3W9YA 1U8XX 1Y9JA 1G2IA 1WXEA 1RR6A 1RAAA 1RQGA 2PX5A 3FMGA 3CPSA 2ZCUA 3QMVA 4IWYA 4FT2A 1WL8A 5I8ZA 5TXGA 5LD2B 3INYA 1OFIA 1RRKA 2V0CA 3HNRA 2EIXA 3MHPA 4NLLA 5COBA 3WWEA 4B4OA 1WP9A 2C2WA 1QANA 3E3AA 1C8BA 3WWOA 2R7LA 3SVZA 4BWYA 3GEGA 4WCDA 5EMHA 6YASA 4Y2JA 1LBQA 4IOKA 4YECA 4J1TC 5A04A 2J9RA 4TN1A 3N8HA 5JD5A 3QXJA 2JA1A 1E6KA 4H35A 3RHFA 2G71A 1ZJ4A 2HNBA 3JWIA 2EW8A 4A8JA 4H7EA 4AKHA 5TQ0A 1PWXA 2R96A 1M0WA 3SX2A 3I2JA 4QAQA 2ZETA 3UO8B 4C7MA 5B1IA 4W5OA 1T9GR 3ICQB 4WZBE 1G8SA 4PX9A 5EHXA 2R7MA 1C1XB 5JBQA 1Z6PA 1A4RA 3K5PA 1U94A 3KALA 3QELB 5FKJA 3D64A 4EYOA 5KOJB 5BR7A 1SEVA 2C83A 2IUEA 3F5DA 3D31A 1H4VB 2RIPA 2PNJA 4CEHA 1VJRA 2IUUA 1EAYA 1ZOPA 1EUZA 1U8TA 2NZ2A 1EE2A 3A37A 5E2AA 1DT3A 3G7UA 4XR4A 3SIXA 1V6AA 3VSCA 1KAQA 3RVBA 1N25A 1SVKA 1GUBA 2CCGA 2I4TA 1JWBB 3JVVA 2JEOA 1RM0A 3VZBA 2Q3MA 1VBFA 2D74A 2WJGA 1D1SA 4CKWA 4LHYA 3CPJB 3IAS6 3L0ZA 3U61B 3H6KA 3QWFA 1QGUB 1PV1A 1Z4QA 3OIVA 3JYHA 3SYRA 1F8GA 1M67A 2D1YA 1G4UR 3H8VA 3NHFA 5BV2P 3HXOA 4B87A 4YAGA 2VG8A 1OHHD 2CFRA 1YE5A 4O5OA 3HJCA 3ZHQA 5TGZA 5BWLA 2ZYHA 4JUCA 1V4NA 1ZSYA 3VGPA 4HNRA 2F43B 3EGXA 4D4JA 2GBIA 2GCOA 2AJDA 4GNRA 1EK1A 1T4BA 1JH8A 3SM3A 1HX7A 3I42A 2YVAA 1EHYA 1B1AA 1U0TA 1N6PA 3GLIA 4E30A 4MW1A 4K9QA 4E32A 4FFBB 4QU8A 5D84A 3K0FB 3R3JA 4Y6RA 3WKBA 4F11A 2GR9A 1ISMA 1DBPA 4N5HX 1XPOA 2NVWA 4OI4A 3U9LA 4RELA 3PWKA 3WRWA 1EE1A 1QTRA 3SZUA 3DCNA 2DVMA 4F5ZA 3N74A 3U3MA 2YHSA 3UKDA 1HLDA 2VTVA 3T8YA 4WFQA 1NQXA 5BT9A 1O3YA 2FDXA 2QMYA 2SKDA 4IIHA 2EJVA 4QUGA 4EPWA 4NECA 2Z6UA 3F78A 4P34A 1XQXA 1XXHB 1JEYB 4ZQEA 3N7TA 3P0RA 4L6CA 2Y1WA 2HSEA 3KS9A 4O4IF 1KVQA 2QRGA 4DMFA 4XKJA 1U04A 2FQYA 2R4QA 4N8EA 4QYWA 1VSBA 2YN0A 4YUAA 5DYYA 5KU7A 1M2OB 1E2QA 1TUEA 3QUQA 3K70B 3COSA 1XWFA 2B2XA 2H1VA 5EJ9A 3GAZA 4WLEA 4PZ9A 3FSRA 4RGBA 5IJWA 4OQYA 1K3UB 4P36A 2CGEA 3ZCSA 1EX1A 1GQ2A 1JN0A 2OCYC 1ORWA 4B0OA 5IVKA 2Q3LA 3PEFA 3AEKB 1AO0A 1NJ5A 5DCWA 1LLDA 4PGHA 1JR3D 3EMDA 1TJNA 4E70A 2G06A 4R2LA 3OTIA 2QORA 1DC3A 2VP2A 1KK3A 1IVSA 3DDOA 2WA2A 3ETDA 1EXNA 1UJ6A 3IA2A 4B6GA 4DNXA 4DDTA 3AWDA 4UZEA 1NI3A 4YT8A 2OBNA 2OO5A 1HL3A 2PX8A 2FWAA 4WGGA 5H7XA 4MYSA 1F6WA 1MZVA 2VPWA 2WVAA 4FZJA 4RIHA 1J90A 1MTZA 3EVCA 3R09A 1AZSC 1QKJA 2YBDA 3D3EA 3BE6A 2FLVA 4FIZA 5JSKA 4Z7NB 1EESA 2JJQA 4B81A 5H0IA 4ZXPA 4BUZA 1M34B 1VLHA 1DMRA 1YJBA 3RU7A 3OX3A 4MHTA 3USZA 4X00A 2ZSJA 3MELA 3VOAA 2GO1A 1L4EA 1KH3A 5IABA 4V0QA 4RY8A 3FSGD 3C5WP 4JLBA 3FKQA 4IILA 1U7ZA 3D2BA 1OV4A 5HRAA 5FYDA 5J2TF 2GDJA 1BVRA 2QD4A 4QE3A 4HHEA 5LBIA 2I99A 2J30A 3JD3A 4MV5A 1PT5A 3A4IA 1G3MA 1QZZA 2X2OA 2DSNA 4KVAA 4BNLA 1JUDA 4GEGA 2FETA 2W00A 3WWCA 2JLVA 1U2QA 1PJ2A 3NEJA 5K0CA 4OYYA 5E7QA 1BW9A 3V8VA 4QZVA 2BEUB 1P4GA 1RIFA 1EP2B 1GQYA 1RWWA 4X8OA 3AF1A 3O92A 1FIUA 3EIHA 5F1YA 2WFMA 1PO7A 4DPMA 2J67A 4UOQA 4ZZ3A 4ZZ0A 1WNTA 2VAPA 1VJDA 3VOBA 1NQUA 3PI6A 1TE2A 1DEXA 2BJHA 4B9EA 2GCGA 5AW8A 2F67A 2QQ0A 4K3VA 4UCXA 4E5MA 1UFVA 3PDUA 4E7PA 2P5SA 2QV0A 3SC2B 3Q8LA 4J0QA 4YHBA 3EXHB 3L9WA 2GBCA 1W2WB 2WOOA 1V71A 1AQYA 3RIYA 5FI1B 4ER7A 3ROZA 5FUYA 2ZOSA 2PEYA 3DFIA 1G19A 1Y48E 4JJFA 2E6KA 2VRWA 4QTYA 5B7PA 1QX3A 3H65A 1ZD1A 2DH5A 1QC5A 5IF9A 1Y7LA 3VJLA 5L3SB 1GUDA 1S1MA 1ZEJA 4Q48A 4R68A 3R3HA 2R6CA 5EUBA 3OZVA 2J5RA 2LDXA 3UCEA 4OHUA 2ZIZA 3DEIA 2HXYA 1GG8A 2Y0EA 3EDYA 4D8VA 1FQOA 4NEHB 1CUZA 4G3XA 4HUTA 1JPJA 3B8EA 4NYMQ 4U5QA 5ER6A 3MJCA 4LXUA 4AYTA 3QE0A 4X1KA 1Q0ZA 2H63A 1A4UA 1ZD3A 2PGIA 4FP9A 3W5HA 5CVTA 4DWVA 1CUGA 1DU4A 3ZS9A 5J2UF 1V9LA 3ASZA 3ILYA 4PYMA 2NXWA 4XLZA 4C6TB 3MNFA 2VDNB 4LF8B 1TQ2A 4DV4B 3X44A 1QH0A 2OBXA 2UZ0A 3R7SA 5JMOA 1EXWA 1XDDA 1MOZA 3C3JA 3IEXA 3VHXA 1U98A 2BR5A 3OPYI 3WRXC 4AX4A 4BO5A 5DNDA 4AJKA 4L16A 1RMYA 1B2LA 2I6SA 4OHKA 4RK6A 1SA0A 3TTUA 1KE2A 4NHEA 1TTHA 1XVTA 2QGFA 3IT0A 4G2TA 4W4TA 3T41A 3FPBA 3D7NA 4Q7JB 1IOVA 1V2GA 3C3WA 3ZJVA 9LDBA 4IDAA 4YDRA 3RKRA 1KPGA 4V1CB 5LQDA 3ZIAA 3DULA 2HQBA 3UMJA 5UKDA 1D0IA 1ULUA 1JVSA 3Q5GA 2H2AA 2PU5A 4BP9A 5TARA 2I71A 2JD0A 4HGYA 2DWQA 3ZBTA 1XQWA 5DYTA 3VO2A 3QH4A 5JLJA 4IUCS 3LTNC 1NI5A 5IXYA 4DLVA 1RZRA 1F06A 1FLDA 4KYIB 4CKCB 4LOHA 2HRZA 3DS8A 4HQOA 1U0OC 2KQUA 5HX7A 3KSRA 4XZ3A 4GKKB 1NLYA 1YVUA 2WY2D 2WW8A 1Y8CA 4Q4AB 5JD3A 3R23A 3JQBC 5EGSA 4X90A 4QLBA 1FS6A 2EXXA 2K5UA 3DMHA 1T9HA 3HJGA 3LOPA 2A9OA 3H8SA 4MITA 4TRMA 7GPBA 4IQFA 1KI8A 3SZ3A 3ZXSA 2IIQA 2D5LA 4UEJA 1VE7A 4ZAVA 5TT1A 2H0RA 4P2GA 3RC1A 3PU6A 1TT5A 4NXMB 2PX3A 2W0MA 1I4LD 1EFPB 3KQWA 3OQMA 5ICCA 1WMBA 1UMDA 3WRVA 2PS0A 3LA8A 2P3OA 3K0EA 3MCZA 3GLRA 5JXGA 5FUBA 4GIBA 1MRSA 3OT4A 2ZAMA 3ENKA 3G0BA 4J0KA 5H70A 4AC9A 3TZLA 1QR2A 1NLZA 4XCXA 5EG5A 2XNKA 4GGMX 4RD0A 4TRRA 4GOMD 2FKNA 3DTTA 3DV9A 1RYFA 1H2YA 2KWIA 4L15A 4NC9A 1DKNA 2W0SA 1D2RA 1KMMA 2HMTA 3PBKA 4RCYA 3FOCA 4UM8B 4L3OA 5AK3A 3CVWA 5FJJA 1J00A 4MOWA 1ESEA 4BCBA 4IIVA 1RZVA 4M9QA 3GRVA 5KSWB 3TLAA 2BHRA 2VQFB 4HDQB 4ZT5A 3PLAE 2JF0A 2BE7A 2B9VA 1SURA 1AS3A 2QD5A 4F84A 1Q22A 1TLTA 1V37A 2AF3C 2FP4A 3BREA 5HP4A 1IUPA 1PJZA 3PHGA 5AVTA 1G9XA 2ZWAA 4O6VA 4WFIA 4Q7QA 3I92A 3NNSA 5I48A 4DBLC 2NU9B 4XAQA 1N2ZA 5DIZA 5JXWA 4FFNA 1UXGA 1IG0A 1DIGA 2OGWA 3C87A 4NCIA 1P31A 1BMTA 2UZ3A 3CRRA 5TGDA 2I87A 5CMLA 3EIXA 3H05A 1LBTA 4PNPA 2VHYA 5TE9A 5TRTA 4EUEA 2I6XA 5IM4A 5D01A 4URZR 1W6UA 2Z2XA 3GG2A 1L5VA 3NHLA 4X6LA 3UHJA 2VJPA 5B1DA 5IASA 4YV7A 1FVOA 2XKKA 4TTTS 2CDAA 3OT1A 4LZZA 1Q0QA 1T0HB 1V41E 3H5NA 1VBKA 4GMDA 4NMHA 4XJVA 3RREA 1XC7A 1WCXA 3CSDA 3ER6A 3GYGA 3B8HA 3O4VA 3NHKA 6Q21A 1NW3A 3ZWOA 4Z3OA 2ABWA 4RJJA 2DCMA 3L7OA 1IY9A 4OHFA 1UDWA 1KXJA 1BZYA 4HVCA 3A2LA 3B6ZA 4LDRA 4DV1B 2BEWA 1AQ6A 3L05A 5DWDA 3I3OA 4D9HA 1MXFA 3SNKA 5LWHA 3PTAA 4C7OA 2LD4A 2BTEA 2BW0A 5EZYA 3BKXA 1RAHA 2HJWA 2X5OA 4FS8A 3D3JA 4KX3A 2BP7B 3BIOA 4TKUA 4K40A 3TS1A 4CMCA 4EI8A 1Z0KA 5EJ5A 5KNBH 2W2QA 1Y9AA 2V3WA 4D9BA 4K6OA 5I4KA 2H0QA 1UAGA 3FW1A 2HDWA 3QKTA 4YO8A 3UMBA 3ZW8A 4EUNA 3MSXA 3K32A 1M2HA 2IUTA 3RK1A 4KDCA 4NONA 3N2YA 1Q3KA 3WY9A 3IOEA 4MS1A 2ZATA 4EFDA 4IHAA 3L79A 4I5IA 4XGIA 2VF5X 1LPAB 3DW3X 4Z9BA 1AE1A 5ISMA 2ID7A 3CCBA 1R0SA 4PS1A 2LXNA 2E5FA 4EGSA 4NPCA 1DAIA 4URUR 1GPH1 3K53A 1O0CA 4DMCA 4JLJA 4MGEA 1DL5A 3C6ZA 3DE2X 4A8JB 4KACA 4B84A 1AU9A 1F8FA 2NNLD 2XNDA 4NENB 5TQ0B 5LXTA 3H04A 2MSWA 2DX7A 2QXUA 5L95A 2OYCA 1MA0A 4DIOA 1XRMA 1SWWA 4IMJB 3FBGA 5A4MS 4TKVA 1WXDA 4GZ6A 5E95A 5L3RA 2IU0A 5K45A 5FI0B 1Y5RA 3C4JA 3PNKA 1WTAA 5B5SA 4CEHB 3ZZ0A 4K8RB 1V26A 1I6LA 2GX6A 1U0BB 3WJ7A 3EB9A 3ACDA 4KTVE 5IUJC 5KJFA 1MDBA 4F06A 3HEMA 1OYVA 3TNLA 4II7A 2CNWA 2R00A 4R69A 5DHQA 5B3LA 2WIAA 3VGJA 4N8DA 4XRRA 3NEAA 1UK6A 1NN3A 1SXJA 1TW2A 2VJBA 4WKCA 1GZ7A 2TYSB 1LVHA 2FG5A 3M3HA 3T7IA 4UTOA 3R3YA 4QQKA 3W1WA 2EAUA 1AHHA 1M66A 2I54A 3VR5H 2XR1A 8ATCA 3RFFA 3T4PA 4H6WA 4H60A 1QRTA 4JQSA 4HAOA 1DKOA 3N2IA 4M0LA 4EHDA 3WDLA 3UK2A 4Z4EA 1H4SA 5AH0A 4L6AA 2WAOA 3OEYA 4DVJA 2GVZC 1Z5UA 4JYZA 3OCCA 3ZDZB 1N2CE 1OF1A 2XSZA 2OBFA 1IN6A 1P72A 5U4XA 4EYQA 2H5EA 1HBJA 4RWEA 3EGXB 4BO2A 2V9CA 4UPDA 4DCCA 1E63A 2GCOB 1C4XA 5KTSA 2PVSA 1S2GA 1NFRA 5F76A 5KSPA 4X7RA 4V39A 5F2EA 3WDKA 4U7DA 1D7AA 3FYUA 3M5CA 1ZVMA 1YQTA 5BUSA 3QMMA 5FP0A 4TL9A 3H0KA 3GLIB 3WRYA 4EB8A 1A98A 1FNSA 2XQIA 1YE8A 4TWIA 1X94A 3OJEA 2VQEB 2JFUA 1NRWA 4TTRA 1HA3A 3Q8MA 2F8TA 5MHTA 3AV0B 4FN4A 1XDGA 1Y8QA 2HSJA 2P9EA 2ZITA 3KBOA 4HLUC 4BQSA 3DO5A 5IARA 1Z74A 3M33A 4TV9B 3WSVA 1H94A 1TPYA 5ARBA 2F62A 9GPBA 2FPKA 3NIDB 4BOYA 4JLPA 1GCIA 1K2WA 1BJKA 5U9CA 3VZSA 4GWKA 2WSSD 4XA8A 2P68A 3L1HA 4BNTA 4D46A 3Q3EA 3WOVA 3IPAA 2WJVA 3F6RA 4KO2S 4TMKA 2JFZA 5FIUA 3TMYA 1K6IA 3T0FA 3LF2A 2PHZA 3AI1A 2HU7A 1RXUA 3KJGA 1GTJ1 1PTJC 1RWVA 2O0HA 3ZXIA 3GL9A 1H4QA 2O0KA 2R751 3HPRA 2FSPA 2P11A 4ZHSA 4DMKA 1XWWA 1QE0A 2D2XA 3GZTB 2ZYIA 4ZTUB 4EAQA 3MBIA 3V6MA 4ZO8A 4FCTA 4QQ8A 2W2MA 3NWOA 5FTKA 4YCMA 5CFLA 1Y7PA 4AS2A 3JRNA 3UW3A 3PEYA 1Q16A 3FPJA 4RMJA 1GSHA 3LUPA 4QDJA 2E5LB 4NEGA 1H22A 1Z3IX 2ZPTX 3SIRA 4IVNA 2C5AA 1HG0A 5WRFA 4WOPA 3QVLA 3Q2IA 1ZA2A 4AWBA 2JFNA 2ZDGA 4LFCB 2NU6A 1V5WA 3L2OB 1GG2A 2Y1GA 1Q0HA 3DR5A 1BMFD 2BFAA 3LP8A 3RS2A 5T6MA 4AJJA 3QF4B 3C3EA 4YR9A 5BW8A 5DNAA 4P3OA 1ORVA 4M1ZA 2YZMA 2V9ZA 4ZRMA 2X0JA 1Q3TA 1W5SA 1UR5A 2OHJA 1BS9A 4OQNA 4B09A 4DPKA 5EHZA 1KJIA 3EE6A 5I7FA 1DB3A 1EJ2A 1KQPA 2QX4A 5A03A 4E08A 1ZIXA 1WVMA 4FZVA 3PCTA 2JAHA 5CDTA 2A0FA 2R6DA 2HSDA 4YV2A 1DC6A 3GF4A 2ZRAA 4X7MA 1KRWA 3H5AA 1UT6A 2DTXA 4X6XA 1KFBB 4AUEA 3Q0EA 3FGPA 1P2BA 1JJIA 2EGHA 1YH3A 1JW9B 3KHKA 4NICA 4F38A 3EXG1 3OBBA 3WC4A 1JWAB 3U44A 4ND8A 1BW9B 2AYZA 5J4HA 1RSZA 1QYWA 3PE3A 1YUBA 4FYMA 4TMZA 2XRZA 4RAQA 1WDLA 2O8NA 3M1AA 4KPUA 2W6CX 2QENA 3JZIA 1PT8A 4NOLA 4D0NA 1H5UA 1W59A 3DHYA 1U5CA 3IAEA 5ENZA 4BO3A 4CR7A 2JA2A 1IMJA 3IUYA 4V03A 1H8EA 3VPSA 5HNKA 2IE0A 3DHNA 2V1UA 4XJSA 2VJDA 1WETA 3L1IA 1ZL2A 2OCGA 3C4QA 4JI8B 2F48A 2MSCB 1WRBA 2ZJ0A 1SQSA 2I7VA 3HUEA 1YR2A 2R6AA 1I2MA 1MG0A 4JBWA 4B5LA 3ZY6A 5DF1A 2AFHB 2NT3A 2ZI9A 1W0CA 3A6LA 3LS2A 4R2JA 3HRIA 1PEDA 1JQKA 3M6VA 1GGNA 2VEOA 3TCKA 2RCNA 3DHVA 1KIFA 5TR9A 1WAMA 1C0EA 3B1ZA 2DUWA 1K8XB 3T3HA 5I8PA 1QC5B 3OD1A 4CMBA 5JS2A 1ZNQO 3PJRA 4V0RA 4OJYA 5LB4A 1UKZA 5BQPA 4AIRA 2BISA 3HDVA 1YD7A 2NPOA 1P6QA 4P7GA 1P80A 5DDIP 6AT1A 4I4LA 2N42A 4O29A 3VYVA 4TV8F 5KVAA 2FOXA 4KUEA 4OUDA 4ZT4A 5C32A 721PA 2O7RA 4BNZA 1U7XA 2JD2A 2ZZMA 3T12A 2DMRA 2I7CA 4CTKA 4X1KB 3I05A 3UJNA 2PL5A 5CJPA 3FMVA 1QV7A 5AVRA 4AJ9A 4P84A 3K0AA 1IY8A 4O2AF 3TDKA 2GF2A 5KTPA 1E1DA 3GXBA 3L07A 4IIGA 5LB2A 4Z6KA 5I4CA 4RHFA 4LSGA 4Q39A 3FNGA 2IL1A 4N6NA 5H16A 3S28A 3V4RA 4HP8A 1J21A 3PICA 4GW3A 3VHXB 2C4VA 1ZW1A 2F17A 2Q2QA 4YT4A 1FPMA 3IOYA 3NFRA 1TYEB 2PZAA 2WK1A 4K9DA 4RH0A 1SA0B 2GK6A 2UXDB 4INAA 1OBOA 2OGUA 4RA9A 1FFSA 3I2GA 1M6VA 4ZQFA 3WMEA 5IN4A 3C48A 4KUHA 2B36A 2WLSA 4JP1A 3ZNQA 1PYOA 1S3IA 4HH0A 4D9IA 5LN1A 3ZD6A 2IF2A 5KTRA 4CL2A 1HE8B 3I5YA 1YQWA 2DETA 5DISB 4CDRA 2XKJE 4I4CA 4Y0NA 4BP1A 5JQWA 4F5DA 1T5IA 4KWTA 1H2FA 3A1TA 4DR1B 4F9EA 1ZJJA 1U9IC 4LJ6A 5H59A 3H4IA 3RRBA 5I7WA 5AW4A 3RAEC 1VRWA 3TBHA 4RLQA 5DW3A 3P0IA 4Y2RA 3A31A 2H4HA 3H13A 3H2HA 4MKXA 4QUAA 5JCPA 3L1KA 1R6BX 5P8WA 4IKPA 2CKMA 1MJHA 1ZJ5A 1NNEA 1NE7A 4NNJA 1XZLA 4NYJR 3PXBA 3OEED 3HWX1 4LWZA 2YS7A 4NOKA 4RLSA 2VNJA 1Z56C 2ZYDA 4U8GA 3WGZA 4XWKA 2CNDA 5AHXA 4P3PA 4JH0A 2A9VA 1E99A 1F8YA 1TT5B 2GA9A 3GVPA 2DOKA 3M7IA 3O47A 5CVUA 4ARZA 3SGLA 1ZI8A 1K5DA 2VP9A 4LK3A 3GFGA 4WA8A 3IHWA 4QQNA 4F97A 5BN4A 4B8ZA 4U3JA 1L1RA 1Y98A 3HDJA 4L7QA 5KX5F 1PT6A 2CVPA 4WERA 3SDSA 1Z6AA 5JQGF 1HH4A 2W6JA 4KN9S 5BN5B 2RFLA 2FUG1 1E4EA 1OU4A 1SN7A 4J9UE 3BORA 4HZUB 4OGLA 1FQKA 2XUZA 2JIDA 2J5QA 2IDKA 4DGQA 1CKEA 4TS9A 1HXHA 2LIPA 4EHJA 2L69A 5K4GA 3GBVA 1CF4A 4A2PA 4A0HA 4I6JA 3UMGA 1IXSB 1OXTA 5GJCA 4UTPA 4RYDA 4AUMA 3TI9A 1OLOA 4RHEA 3IOMA 5IAJA 3IAM1 2G04A 4ALNA 4R9VA 4DLSA 2RI6A 3IVCA 4YCLA 4QDXA 4PANA 1ZN7A 4Q9HA 5I9SA 4EECA 1COZA 1MEOA 5AVKA 1Z37A 3UAWA 2WF5A 4FI3C 4AO7A 2BWJA 4ZMSA 3BDIA 2FP4B 5CFRA 1YR3A 2FUNB 3HU3A 5KVQA 1Q2XA 2RG7A 4WRRA 2HIAA 4G5OA 4Z7QB 4IQ4A 2G08A 2IZ1A 4DLXA 4TM7A 4ARBA 2WD9A 4PWYA 5ARCA 3VR6D 2RGGA 5L4NA 1PNQA 1H23A 1L6IA 3E58A 4M49A 4XQ0A 3VBCA 1NIPA 1ZN8A 2B82A 2ILTA 2QD1A 1U9CA 1GN8A 3PA8A 4FZ3A 5CPBA 4YRCA 2G82A 3ADCA 2QSZA 5CIWA 3EPJA 5FBVB 2LNDA 1B8VA 1VYTA 4ZOLF 1BEUB 1JEDA 3PDJA 3FVQA 5I8WA 5IT0A 3NPAA 1R5BA 4ZO9A 5IUKC 4ZI3A 3I9MA 3RYCA 1ECPA 4IIUA 3LBHA 3ENQA 4BU1A 5D86A 2OP1A 3L41A 4HR7A 2MJLA 4Y9SA 5AQEA 4B6QA 1WLSA 2PVPA 4G23A 4GLLA 1EIWA 2BEWB 3HB1A 4B17A 4BO0A 4C7OB 4JR1A 1T3GA 2FR8C 2MSLA 5EZYB 1D0SA 1M8GA 3BF7A 4OK6A 4TKUB 3HCWA 4Z9YA 4Z7OB 1RXIA 2P91A 3TH5A 3PFHA 2B83A 1FSFA 1AKUA 2RHMA 4KR2A 4P0QB 1TU4A 3I04M 5B6PA 4IO1A 1XDSA 2JARA 2V55B 1XZPA 1M34E 2J4FA 2HQSA 4JR2A 1OC2A 3EDOA 3Q3IA 4MS1B 4RMHA 4Q1DA 4TMYA 1D09A 1P4AA 1IXYA 2LW7A 4L0DA 2X2FA 1JQEA 3M4JA 2A5YB 3UPTA 3CV3A 3HR4A 2MYPA 4L8GA 1K68A 5TDHA 3V2UA 4Z86A 1YMQA 3HHPA 4A03A 3VBEA 3O8CA 5LQRA 1ACMA 5IP5A 3V4FA 1TVCA 3A6EA 3COVA 1EK0A 1LSUA 2CFOA 2XADA 4IJVA 5AVWA 5LXTB 2I2BA 4PY2A 4R05A 1YR8A 4EKNB 2JPDA 4F4CA 3EG9A 3TLKA 1Q7CA 5EJFA 5HA5A 2NO9A 5AHRA 3EOZA 5J5CA 2IHKA 4C0XA 1NWCA 4TKVB 3ERCA 3W4JA 3QENA 4C78A 2PL1A 5HKBA 3W5AA 2RCYA 1AGRA 2WIGA 1FLVA 2XMQA 1Z0ZA 2E37A 3EMBA 1PFGA 3OHMA 4KPYA 1CT9A 1RYZA 5K03A 2CK3A 3EFBA 1FSZA 4IV0A 2G0TA 4EF6A 3BL5A 3WLNA 4TTQA 3U5TA 3TOXA 3A9UA 1TYBE 3AX6A 3NBUA 1YCDA 4XYLA 2ZE7A 4YACA 1IIRA 3DXYA 1SXJB 3KXPA 3OLCX 5HGXA 5KO2A 1XQ9A 2A59A 1P77A 2VT7A 3GCDA 3GFTA 4XJTA 5D6NA 5T4EA 2HN9A 1RHUA 3NX4A 4Q16A 5H9VA 1EA7A 1P61B 2HEGA 4C0WA 1HE4A 4PYKA 5SZJA 2RAVA 4RY0A 2HH9A 2YKGA 2ZBVA 3TKLA 3PIIA 5CCBA 2ZTMA 3BFXA 3HV2A 5BVHA 4MVJH 1GUAA 4D9NA 4QUIA 1WY5A 3MWJA 5KAMA 1U4OA 2AW3A 1GUFA 2ZIAA 2G07A 2Y76A 4Q12A 3KVRA 4MX8A 2FG7C 1N9ZA 3FYUB 1XLWA 2EQAA 4TLMB 3EPPA 4M1KA 3ZGLA 2AXQA 2XUIA 4CJXA 1LZLA 4GWLA 2QMQA 2GARA 2W6OA 3ZVRA 1IWOA 4F04A 2CHUA 4BZZA 1KI2A 4OOFA 5CYGA 3P9QA 4W8HA 3ZQKA 1GZSA 5L3QA 2NV2B 1PVOA 2MT9A 3IOBA 2OXFA 1Y8QB 2ZUTA 3OTQA 2Q9BA 3OX2A 3EAGA 3NRCA 4C0SA 2RH9B 3DDZX 1YI8A 3KKEA 4LTMA 5E8RA 1DEHA 1NULA 1THGA 4JCOA 3MCAA 1HRDA 3ME5A 3QF7A 4HVTA 3B1YA 3ZV5A 3C3YA 4S1TA 2APJA 2AG5A 2C1ZA 2HJGA 4IG9A 3T9EA 4JP5A 2XECA 4UNSA 4XUDA 4ZJUA 3AVUA 2WKSA 5C81A 4GSYA 4PEVA 4GOOD 1IJKA 4OY3A 3UHOA 3EOAI 2OWDA 3K9QO 4S0ZA 3FCUB 3CH7A 3NAQA 5AW7A 1B8UA 1W8DA 4A92A 3A3KA 1UFOA 4AROA 2WOJA 2P78A 3O8OA 1XZMA 1KRHA 3FMPB 1JBEA 1EP9A 2DT5A 1H2BA 2WT9A 2Q3JA 3HB4X 1VKZA 2H4ZA 3IO3A 3GUCA 4Q1BA 4YY3B 3BGIA 4XX1A 1Z75A 3ZZ1A 3PNVA 3W3AD 3HDTA 3UWDA 3H5IA 3FVTA 4MUGA 2JKYA 4X85A 1IFXA 3MRSA 4MI9A 3SJ7A 4DHEA 1ULSA 1H93A 3AM4A 1IVYA 3ISJA 3I2KA 3MMZA 2RJ3A 2OHGA 4OA8A 3RODA 4ETMA 5KPJA 3DCIA 1CEYA 1QUEA 2X4LA 3M89A 1YTLA 2NU6B 2ZUVA 3TD9A 2FRVA 3JQ9C 4JZYA 4X71A 3TPCA 2WAXA 1CUFA 1GYRA 5JO0A 3ZLJA 3LVFO 1XX6A 3T5CA 3R3SA 5FOVA 1YZGA 4G0QA 4OB6A 5LP6B 1EDEA 4AWXA 3PKZA 1VPDA 2J46A 4EO9A 3PZRA 1LI4A 4UUQA 4RPLA 2WI8A 2XUHA 2GEDA 4UOEA 5JBIA 3MD9A 5F98A 3OCVA 4JP3A 5FBQB 2V97A 5B58T 2ZI5A 3LGSA 3M3DA 2GETA 2CUNA 2WD8A 4CUJA 3IQHX 2VAMA 4FU0A 4J16C 3RRNA 1MO5A 2BJVA 2TECE 2VQ3A 4K86A 4X6YA 3WBKA 4H6VA 4REMA 1BJRE 2QX9A 4U1RA 3V7NA 2WRZA 4RH3A 2MSNA 3GRPA 3SI7A 2C42A 3C85A 1UZNA 4ND8B 1NIJA 4WV3A 5KU1A 4DLNA 3TW8B 1V5FA 1JQ3A 3EQ7A 3L8CA 3H87A 4KPUB 2YJ5A 3BVPA 4M53A 5EHGA 2SNIE 3F6PA 2Q1WA 4FGWA 4U2DA 2ZRPA 4YQZA 1TXGA 5CTJA 1WBBA 2Z1DA 3TK1A 1EDDA 1Z4NA 2F6RA 2O4UX 3GJXC 1ICEA 3NQ41 4BL5A 4RTPA 4KCGA 4BUCA 3RLIA 3W1VA 3FBTA 2Q5FA 4RPGA 2UUAB 1ZK3A 3W5JA 2OC9A 3S1AA 1Z28A 2ENWA 2CHEA 3KFXA 3P2KA 5ICMA 1FP2A 1NG9A 4EYKA 5CK4A 2Y9MB 1O5IA 3AYXB 1QU3A 1AQJA 4PV7A 4GKBA 2VJLA 3PC8A 4Y8VA 5KNDA 1AS2A 1TQHA 5IVPA 5IEJA 3QUAA 1AKYA 1L5YA 3RBAA 2OE2A 3BH6A 2GCPA 2D1QA 2QNIA 2R1UA 4R31A 2I34A 2OAP1 4OLHA 4G8DA 3HUTA 1Z8NA 3B89A 1TKCA 3LM8A 2FSSA 4J7XA 1L4HA 4UFPA 3QEAZ 1XD9A 3MS2A 4E88A 3TO5A 2GPNA 3O4RA 5AO9A 1CB7A 1U31A 2CUTA 3PPVA 4KXQA 4OUDB 1D2GA 5EJ4A 1HNXB 1Q57A 1VL0A 2EFCB 3IBTA 3P9CA 3KHUA 4RETA 2QYTA 5CVVA 1V1MA 5EIAA 1FP7A 4BMDA 3QU9A 5DLEA 3H1PA 2UXBB 3BILA 3K0AB 3EISA 2XVMA 4KDFA 2QN6A 5D5HA 1PSDA 4WEQA 4ZOQI 3C8HA 3P20A 3E84A 3QYPA 1ECGA 2G5CA 4LRSB 1ZK2A 3IQFA 1OT5A 1YCGA 3BGSA 4P54A 5IH7A 3FPHA 2H1OA 1OTYA 1Y7IA 3OMXA 1VE5A 4HADA 3EZGA 4Q21A 4RIGA 2BFEA 4LHSA 4RU1A 2QUAA 3CCFA 3UF0A 1RM5A 2M98A 1JU4A 1UXHA 2P4HX 3ES9A 2EJTA 4ZI7A 4MRMB 1F14A 2O5RA 4K9PA 4RA9B 1LPBB 2Q0QA 1M6VB 4R2MA 1KI1A 1Z62A 1KERA 1XD8A 1PV2A 4UHJA 4KXWA 2INGX 4ZPJA 1FP1D 5ESRA 1GPLA 3MAAC 1EG7A 2FZLA 3HJTA 3L49A 3CUWA 3SVTA 4BFVA 5J1SB 2NO0A 1A9RA 2G8LA 3BK2A 1F5SA 3O9ZA 4DIMA 4CT5A 1XPUA 4IQ0A 1MP0A 3O1JC 1VL6A 1TU0A 4EBFA 2XMGA 4FUQA 3KR1A 5KHAA 2FR0A 3UJAA 1LEHA 5IZCA 3CUUA 2PJDA 1GVHA 2YXBA 5AD1A 5FTNA 3UOWA 2XITA 1RKUA 1YR1A 3PUXA 3LO8A 3THXA 2YCLA 4JBXA 2V7QD 1B8PA 2VXCA 3FMIA 5AOVA 5KDOA 2Q4BA 2CFCA 4PPYA 3S2FA 5GADl 1SAYA 2CFSA 2GFIA 1XA0A 4UE3S 4JYMA 4CKEB 7REQA 1JFTA 1TEZA 3DEAA 3ZHZA 4ZDJA 3FYDA 1K9SA 3A04A 1AK1A 2CC2A 3VYTB 2I4RA 3I9FA 1DJNA 3D3WA 1C0IA 3E18A 4K9SA 3UQZA 4ARZB 5BSWA 4OA5A 2C2ZA 2BFOA 4UZSA 1JHOA 1T3SA 3PRKE 3VU0A 2DR3A 1YAHA 1ZIOA 3UT5A 3PFFA 5DN6A 1S3GA 3F1LA 3BBLA 3OPMA 2QEQA 2BPOA 3ZEIA 1YR7A 1NLUA 1FJHA 1MDFA 2I76A 4TXMA 1Q19A 3S2GA 4QOGA 1E4EB 2GAAA 4M1TA 3I9JA 2VQSA 1JQDA 1YDGA 2IBTA 4N12A 1NJ2A 2K87A 1HMPA 1T8TA 1EM8A 1JKMA 1GGJA 2O2CA 3AR4A 3K9NA 3OWXA 4YCBA 1K0FA 3AILA 1YAJA 2E1RA 5ENVA 3DKRA 4EYSA 1FYVA 2WJ3A 1QIEA 3IQGX 3JVUA 2F9FA 2HWUA 2OEPA 1TI7A 1BSVA 4Q3NA 1N2HA 1TQ4A 2DHRA 4IRXA 1JF8A 4M1SA 4RVHA 1RJEA 2QTWB 1NC3A 3KQMA 3NHAA 4WKBA 4X9XA 4N47A 5C1PA 3A0RB 4CPDA 3PFIA 4TYNA 2GM4A 2OA0A 5T4BA 2CNNA 3AONB 4F6CA 1NVVR 4L57A 2AG8A 4P98A 1ZQ1A 3ONFA 1E1RD 4HUQB 3VC7A 2WHPA 1M0EA 2R7NA 1GU7A 1H2XA 2Z8ZA 4K0RA 4KWHA 3TSZA 2RGBA 1OZGA 4LQDA 1BN6A 5BPFA 2I6FA 1WB6A 3GVXA 4ZREA 5LLTA 2R79A 1OX4A 1IRIA 2FZVA 3T4XA 4ER5A 4JA0A 1ZRSA 3AU8A 3GNSA 1D6SA 4CETA 3Q9LA 1TK9A 2FK8A 1CJVC 1PZEA 3C74A 3DAPA 3P71T 4M9SA 2GJSA 3RYCB 4CNQA 2HMAA 2D6FA 3SHQA 1R7RA 4EFLA 1R6XA 2IUYA 2AD1A 2AMJA 2VPTA 4FUTA 1NDQA 4OGFA 1EJ6A 5DRTA 3PLRA 3ZLUA 3CVJA 3QJYA 2NO4A 3QPAA 4Q05A 3PQDA 4EELA 4U2FA 3AR8A 1EA5A 2M9MA 5FBLB 3QVTA 2GKSA 4TTJA 2BFCA 2JFFA 3ZY3A 4ZI2A 4NYIR 3HB0A 5FUXA 4Z2AA 4FYVA 4TYPA 1KA9H 2WIJA 2A0YA 4KH0A 2TSYB 4H3SA 5BQ3A 4EENA 3BRQA 4A8TA 3DMNA 5G53C 4U7GA 3LY7A 4CDMA 4GSLA 5CA0F 3A32A 3CE9A 3E3MA 1CX9B 4O2BB 1N5OX 1NUTA 3NIBA 3RC2A 4A2WA 3SU8A 3H75A 3B38A 3FTCA 4HUJA 3PUYA 3NBMA 1WO8A 2EDCA 2ASEA 1P9WA 4MB6A 3RSZA 3A05A 3NWJA 3H0EA 4NG5A 3OI7A 4OBEA 4W9MC 5FCDA 1SR8A 4YMHA 1H5NA 4MQUA 3WA6A 2YXEA 2NO6A 3R75A 1TA9A 3ABIA 3OPXA 4PGAA 2QD2A 3EDRA 3L8FA 4S1WA 1S9HA 3RHZA 2OLJA 4CMJA 5PNTA 2IS1A 4I1VA 3HWWA 2FXVA 3A1WA 1VJ1A 5JSUA 3OTHA 1OOEA 2ZS7A 3TLYA 1WNFA 4X94A 1S2DA 1EBFA 2OD7A 3EG9B 4PSUA 3T4UA 1Y8ZA 1ICIA 3R5FA 4U0KA 2O8EA 1M1YA 2ZJZA 2VWHA 2EQ5A 2QM0A 4HVLA 2GAOA 1C5KA 3H9GA 4C3ZA 3IT2A 4QGAA 1W5AA 1BEZA 4JI2B 5LBUA 3USCS 3HYCA 1JDZA 5DP1A 2QX6A 3HYNA 4FMCB 4XWAA 4BN5A 3WFJA 4WZZA 2JHCA 2Q3FA 3DDSA 2FZKA 1N5LA 4ERNA 4II2A 1X9GA 2H2IA 2NWQA 2ZRBA 4JP8A 5LOVA 1DCFA 4U5XA 4XEHA 3B1JA 3GDFA 3V8QA 1ORTA 3IKJA 3EGIA 3RUHA 2D8MA 4RL6A 2AFHE 3U9SA 4DY6A 1HOXA 1OI2A 1CIPA 1F2DA 3MCUA 3MK31 4V3BA 2QVXX 3BWCA 4JB2A 1EWTA 2QVCA 4PBSA 5LQSA 3V48A 1RRPA 3N3AC 1W9MA 4MW9A 2WPDA 3GCWA 3QOWA 4PZEA 4XX0A 5CH5A 3A1UA 3JQFA 3SJAA 4JITA 3WBFA 3I5MA 2WYUA 1V4BA 3V1UA 3HYTA 3M49A 4Z54A 5LNK1 1AA6A 4Z51A 2IF0A 2I1VB 4UEWA 2R25B 3ZJ4A 3F6SA 2ZQ5A 3A9TA 3JYQA 1MCZA 4NCJA 3ZDBA 1AM4D 1U6KA 3PZBA 1UP7A 3BWDD 3F7OA 3KLPX 4QYMA 1QCYA 4WL0A 3R7LA 4MYRA 3T9CA 2JZNA 4JX8A 5LL6P 1FTQA 5L3QB 5FLXA 1W2HA 3QSYA 3DMPA 4YJFA 3NCHA 4Q1EA 3QFCA 3ZV6A 4CL8A 3IUPA 4EHAA 2JIRA 4EY6A 2Q49A 3TGLA 4G0VA 5D3MB 4CIBA 1KO5A 4LKRA 2IUFA 4RDXA 5IANA 3KAQA 4G2NA 4WOKA 1M0TA 1G64A 1YS7A 1R2QA 1Z39A 2JW5A 2XGOA 2ZJOA 1XCGB 5T8KC 2ZWPA 3V8RA 5DLPA 1Y4ZA 2JC3A 2RGUA 3FHLA 3ML1A 3U4HA 4U00A 2QU7A 4FK8A 3SMVA 4Z49A 4ZCMA 1O89A 4RIIA 2FAXA 1NFQA 1K7SN 4NS1A 4UU0A 4BASA 3PJFA 1M76A 4QTUB 5DZSA 3WGUA 4LOKA 4V38A 2O3JA 4QC2A 4UUNA 5HQJA 2O48X 3U1TA 3U4QA 4IFIA 3EN0A 1E7QA 3UEOA 3ZDFA 2IXFA 3O8OB 5JC8A 5JNLA 3KJXA 3FHTA 1J8DA 2VDMB 3GMTA 4H7HA 3QFSA 4HSEA 4Q0MA 4L9WA 1XA4A 4HCJA 4JR0A 7YASA 3UUGA 1YJCA 4DR2B 1UPBA 1CUHA 1VB5A 1BIFA 1HDXA 1U2DA 2D1RA 1KS9A 1TJ3A 1NNLA 2OXTA 4A7PA 3KQSA 1NOKA 3U7HB 1EFCA 2YV5A 2FPXA 1CY2A 5D1HA 1K2VN 2C59A 3D7LA 1JEYA 4ZAGA 1VLVA 4E33A 3GZNA 3TNFA 1R0LA 5KB3A 2ERCA 2OFWA 3GROA 4M6WA 4XWTA 3WMFA 2Y2VA 2Q2VA 3Q6MA 2P7IA 1LZKA 3FWHA 3GGJA 3HJRA 3G2NA 4LZOA 1Q7BA 4EY7A 1MJNA 1LW6E 2PBRA 2V7GA 2WEKA 4M0PA 5HYVA 3C6QA 3HR8A 3TM5A 1KGSA 2WWVD 3BN3A 2XODA 4UBOA 2CHQA 3AY6A 1ETHA 1F9AA 3TTTA 4URHA 2ET6A 1L1EA 5ALLA 3KYDA 3I6IA 1CR4A 4WECA 1MVNA 2YWRA 3ETEA 2O5CA 1TX4B 2EEZA 421PA 4YLYA 2AK2A 3T0GA 3U5ZB 3ELYA 4K87A 4A0GA 1VHLA 4LRXA 1H42A 5AK6A 5ELLA 1WDTA 1P4RA 2FZEA 1M7BA 3DKKA 1CB0A 4FX2A 5FQNA 4ENPA 1NM5A 2Z5GA 2C54A 3L4EA 4BFUA 4BV2A 5FL3A 4POAA 1NVUQ 3L8YA 1BXGA 1U0LA 4HDSA 4LMBA 1XJCA 3FCOA 3PGJA 3LKVA 4RHTA 5FEMA 4E07A 2V6IA 4KFTA 4EGAA 1UJNA 3W0LB 2OBBA 2VDKB 3D6AA 1QKKA 3M6WA 3LYLA 3N8GA 3H4MA 1QP0A 3S1AB 4NU6A 1JX6A 1OI7A 2CEAA 2E4UA 1E89A 3GK3A 4UJ5A 4BBZA 1XNJA 3G9QA 5BRJA 3LGXA 1PT7A 4DCMA 3G8BA 3GCZA 2OK8A 2PGLA 4FDTA 4UM9B 2YMPA 2I2CA 3U60B 1UBLS 4LRQA 1SIOA 5DYIA 2GUWA 5K09A 3B52X 2RD2A 4WAUA 1LC3A 1L4MA 1ONPA 2XTJA 4LXIA 1NBEA 3ZXXA 1P1FA 1I3NA 1KETA 3ZZTA 2WD7A 3IMEA 4YUZA 4FWBA 4FGZA 1JB1A 4HL6A 1P17A 4YUVA 2F55A 1EFRD 2EG5A 3HKDA 2YCBA 2W22A 3IRVA 1J99A 1GL7A 1NBAA 3ZWVA 4IGIA 3K9WA 1OBVA 1V1MB 1WVIA 2WINI 5FWAA 3QHPA 3K5HA 3EW9A 1X74A 2PUCA 1J09A 2W9XA 3EYAA 4I5DA 1XU7A 4P4GA 4INZA 3V97A 3W04A 1H9BA 2TMDA 4JN6B 5K6RA 1LDMA 1N7GA 3AUXA 1A9XA 3FOWA 3R7AA 4K6HA 3O74A 1R0YA 2VYVA 3ESZA 4NCXA 3EGEA 4D74A 3MJSA 4GX0A 5F1KA 3T94A 1QONA 2VT6A 1JT9A 3FBWA 1W76A 3VOSA 2BFEB 2W8BA 3PC6A 2PFKA 4KNYA 3G0HA 5D3QA 5LZ2A 1A9SA 2QZJA 1Z16A 3C45A 3OA0A 1QBKC 5M04A 1MQ9A 3OZGA 1T5OA 1T6XA 2I2FA 1V3UA 4D4LA 3LFUA 4YS6A 3VVBA 1JHZA 2JJ2A 2OXCA 2QTLA 4JNCA 1R5OA 3W90A 2YZKA 4X1OA 4MYTA 3NETA 2K2QB 4JXKA 4AT1A 1YKFA 4AM8A 3HA2A 4ASUD 1JG3A 5I9TA 4ECEA 1N8TA 3MOGA 3DAOA 3MW8A 1OROA 3RK4A 4EA8A 1NYLA 3DVLA 4B79A 2BFMA 3LX6A 1FJGB 1DTSA 1V8DA 4NDZA 3DF7A 3KUCA 2N0SA 1YZKA 2IK8A 4WGFA 1VM6A 2Q1XA 4HQLA 3N70A 1JDVA 5M3BA 5P21A 1T24A 2QE6A 2HNKA 4UM5A 4RHYA 3THXB 3IMGA 2FH5B 4GU5A 4HMPA 7REQB 1NXTA 3NONA 4CW7A 3M6AA 3EJ6A 4GO1A 4TXHA 5DEIA 2M1XA 3W6OA 2REBA 4CR8A 4AQYB 3GQBA 2AYXA 4F7WA 4HQ6A 2PYZA 1PEKE 1T3ZA 4W7HA 5F9HA 2A14A 1N78A 3D3WB 1L5ZA 4IOMA 4WQMA 5I7AA 2WKPA 3ROMA 4BE9A 5CFPA 1GAJA 5IG2A 3RVSA 3OZSA 1F8XA 1ORHA 1BE8A 2P27A 1EM6A 3DONA 3QLJA 4IFTA 4KXLA 4IV8A 3MS4A 4GI3A 3JARA 2IP1A 3L7LA 3THRA 3UT5B 2P2SA 4DCPA 5JS1A 3ZGOA 1SWVA 2P6PA 2C82A 2AI1A 1BX1A 2PPLA 1VRVA 1TGVA 4KIUA 4MUKA 1B3BA 5HF5A 4XM2A 2X0EA 2Q1YA 2XDYA 4DC0A 3KQPA 1JB9A 1EM8B 1YFLA 3CIFA 2COKA 4M8SA 1YULA 4Q7MB 4NH4A 4BNFA 2XXJA 4OYRA 3SS8A 5IWAB 1DRKA 3F6EX 5DHAA 2QM3A 4OV6B 4Z4QA 3VSDA 4BO4A 3IAAA 5F4BA 4YWHA 1KJ9A 1U81A 4GI5A 4O33A 3SWWA 5KYWA 3DZGA 5JRZA 4N82A 3VPAA 4KTTE 1Q11A 1WCYA 1GPDG 5JDCC 3F90A 4NBVA 1NMEA 1L7QA 2PT9A 5AHKA 1GNVA 5G4LA 3KPWA 1FVXA 3P0FA 8ADHA 4GOXA 5IKXA 2HQOA 1KJZA 3AG5A 3H2IA 3LT2A 1P62B 3C3DA 2FN9A 3PXEA 5E1BA 4J1SA 3AWIA 3WK8A 4O4HA 5I9IA 3ICWA 4Q9KA 5TMEA 5DK4A 3Q15C 1E3MA 4I46A 2WHPB 1KMHA 3DO6A 4FT4A 1K8YB 1XLUA 4OBBA 4UUMA 2AG0A 4HB3A 3K0CA 1PLKA 1M2GA 2DHCA 4B40A 4R98A 1BDIA 2I0FA 5LDHA 3AJRA 3R2JA 1K88A 1LI5A 2ZIGA 1IDOA 3RAGA 1SELA 2JAWA 1UKVY 2ONJA 4L08A 4CQMA 4MGZR 2H08A 3MVEA 4HGNA 3V8PA 3VU9A 2F3PA 1E6UA 2HDNB 1A7KA 3E9NA 5TSDA 4RBNA 1OD6A 5KYVA 4XFDA 4KNWA 1AQLA 1ZYUA 2VN8A 3KJNA 3JZMA 4TS3A 5DRYA 5HK8A 5F5XA 5B37A 3RKUA 4B82A 2Q7XA 4JL6A 4ND3A 3HU1A 3PRYA 2VHUA 2BFCB 5DEOA 5EESA 3W8DA 1W87A 3IEPA 1YDEA 1TYAE 8MHTA 1MX9A 5T3YA 1NMYA 1OVMA 1YHYA 4TS1A 3M6MD 3G59A 3SXJA 2FVYA 4F3RA 2ZULA 3ANNA 3Q0TA 2RI0A 4YBZA 1F2VA 2FXIA 4DWOA 4ZU6X 4M37A 4CTOA 3F7NA 1L7DA 5SYAA 1AV7A 1NP7A 1R15A 4U6QA 1O95A 4XFKA 2O50A 1GR1A 1RADA 1B41A 1WB5A 2OC4A 3DG9A 4YRDA 1G5TA 4ASUA 3UH0A 3FNQA 2QZ4A 1FU8A 3JQ7A 1Z35A 2QTAA 4N0DA 5LKAA 1CVRA 1G8FA 4S3MA 4I3HA 1BXRA 1UZLA 1WOMA 3JX9A 3PFGA 4HXGA 4PG5A 5K3SA 4AS1A 2AFRA 5BQFA 1M6WA 3P2OA 1C41A 5KOYA 3JZDA 2OFOA 3QY9A 5CJJA 4GPEA 1AKQA 3T35A 2O8EB 1FYXA 1M1YB 2VP6A 3GR6A 4U2EA 5ALTA 2IRWA 3TQQA 1DBWA 1L4NA 3L84A 1YS6A 5LC1A 2QM7A 4OXXA 2A35A 4FC6A 1HKHA 2CMKA 2E1PA 3ZK8A 2V1XA 3GV0A 4JVNA 2ADOA 2BH9A 4WEOA 2Z43A