3FYUB

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
318
structure length
317
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 119
structure length 317
sequence length 318
chains with identical sequence D, H
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuB00
3G9UA 4GBGA 2OCLA 1G5FA 4HS9A 5EI5A 1LPPA 3BE8A 7YASA 2XMCA 1Y7HA 3JW8A 5JYCA 2O2GA 1GQRA 4KR0A 5AKJA 4GWLA 3GA7A 5DNVA 3O4HA 2OAEA 1CUFA 1IVYA 5JAHA 1XQVA 1DX6A 4G8CA 3I28A 1YASA 3EQ8A 4BDTA 1QJ4A 3FSGD 1TIBA 2VA9A 3QBJA 4PSUA 1ZIXA 3IB3A 3R3YA 2JGEA 2FUKA 4LYDA 1W75A 1CQZA 1VA4A 5AJHA 4QDOA 2ZVDA 3K9BA 3HLKA 3I2HA 1UK6A 1JJFA 3GBSA 3C5VA 5ALFA 4L9AA 4WFJA 1SCQA 3RK4A 1PFQA 3STXA 5FUMA 3ILSA 2XMZA 4B84A 2CJPA 4BVLA 3F67A 1HQDA 1IMJA 3H0CA 5JD6A 4DMCA 4K6HA 4UPDA 1CUAA 2BAGA 1QIMA 1B6GA 3R3XA 2XB6A 4OU4A 4ARAA 4U2DA 2PKYX 1VOTA 3FOBA 2XDWA 1JKMA 1XLUA 2HA6A 1BRTA 3AJAA 3BWXA 1L7RA 1THTA 4EY4A 1A8UA 1XFDA 2ECFA 1Q0RA 3HZOA 4J0DA 4G4IA 4Q3OA 3ZWQA 4UHHA 3UMJA 4DSZA 5EIAA 5AM2A 3AINA 1JI3A 4F21A 1XQYA 5AO9A 4N5IX 2PBLA 3KSRA 3DEAA 5AI0A 2HU8A 1HKHA 3I6ZA 5JIBA 3WZLA 2AJ8A 1MJ5A 2OAGA 1ZD3A 3AILA 4WDRA 1IUOA 1DWOA 5JAUA 1J06A 3B5EA 1LPBB 2XUOA 5A71A 2H7XA 1CUDA 2XLBA 1GT6A 4OPMA 4MEAA 2V98A 2J3QA 1WPRA 4KE8A 1EK2A 3VVMA 1NU6A 3V1MA 1QFSA 2DQZA 4O08A 2XUAA 5C8VA 5BV7A 1ZJ4A 4U2CA 2HA0A 3E0XA 2XUKA 4GI1A 4B81A 3PFBA 1P0QA 3F8SA 3O9MA 4FNMA 1G42A 3DLTA 4LXGA 2AJCA 3A6ZA 2DHEA 3Q0TA 1CUGA 2WIKA 5KWIA 5HF5A 4W1PA 4X6YA 1YA8A 2X5XA 1VE6A 2VSQA 3WYNA 4X90A 1TQHA 1LZKA 1UK7A 3R3UA 2CMFA 3D2CA 4J0GA 1EHYA 5D3ZA 3PI6A 3G9TA 3H2HA 2VQ6A 4LXHA 5JATA 4HXFB 5HF9A 4IH4A 4OUKX 4W1QA 1EA5A 4C4YA 3FSGA 4EY5A 2ZYRA 4X6UA 2CZQA 3QVMA 2WU4A 4AQDA 4BTVA 3IUMA 1M33A 2XLCA 3IUQA 5K3AA 5AOCA 2HRQA 3NWOA 1ZI8A 4Q3KA 1EH5A 2DFPA 1P0MA 1BEZA 5HF8A 2OGTA 1ZD5A 2AJLI 1AQLA 2XUPA 3G9XA 3MVEA 3WL6A 3H2IA 1LPSA 1PV1A 5ESRA 2R8BA 5AHXA 5LZ7A 4DTCA 4AZ3A 4QDUA 1XZKA 4OSEA 4Y2TA 2QM0A 1ZGBA 4Y2RA 2J4FA 2WLSA 3ICWA 4ITVA 3JWEA 4N5HX 4OYLA 4UHDA 3WWDA 2JGMA 1DT3A 1P0PA 1NX9A 2CB9A 2B9VA 2QTBA 4C88A 5CH8A 5A7GA 2V96A 1Q0ZA 2PM8A 1W76A 2Z8XA 4BBZA 4WCVA 4LYEA 3D59A 3BDVA 2WIGA 5ALDA 4L72A 3WK6A 5KBYA 3DL4A 4H7FA 5CT6A 3ICVA 4J7AA 1A8QA 2WU3A 5LZ2A 3DQZA 4MYDA 4ZXFA 5FP0A 5CT8A 5KREA 3WK4A 1ODSA 3ESBA 1ZD2P 5LZ8A 2FX5A 1HDEA 5AKXA 3U1TA 3IA2A 1C7JA 3DS8A 5AM3A 5EGNA 4W63A 3WMRA 1YB7A 2GZRA 1K8QA 2GBFA 2PVSA 3W05A 1TCBA 1FFBA 1P0IA 1VE7A 4X91A 2VJCA 1U8EA 1LNSA 2H9YA 3SK0A 2Y2UA 2DSNA 3C6YA 4AXBA 4F60A 5AK5A 3WA6A 3C8HA 4IH9A 5T4EA 3NGMA 2VT7A 2GYWA 1KEZA 2I3ZA 5EHNA 2J4CA 4RE6A 5SYNA 3EQ9A 4PSCA 5AM0A 4UBLA 4JEIA 4FKBA 3LS2A 1AUOA 1IZ7A 1QONA 3FVTA 1CV2A 1H2WA 1UK8A 3L1HA 3FLBA 1XKLA 3WI7A 3G0IA 1BCSA 2WJ4A 3GROA 2ZJ6A 5CURA 2RIPA 1EDBA 2XMSA 1VZ2A 4MEBA 4TVKA 1XZEA 3FYUC 1XRQA 4G4JA 2VATA 2ZSHA 4FFVA 1QIEA 4WY8A 4FOLA 5AKGA 1QZ3A 1UT6A 1GPKA 4K6GA 2WIDA 3HC7A 3D3NA 4DMKA 2XMQA 2XMGA 5CT5A 4CCWA 1DU4A 2CKMA 3H18A 3A2MA 4J03A 1E8NA 1XQXA 1O6GA 4ZREA 4Y2YA 1ZOIA 2PU5A 2OGZA 2VAXA 1XZDA 2ORYA 2EEPA 2G63A 3QPAA 4B9EA 4X92A 4YK7A 1VXRA 3N2ZB 3PFCA 4H7JA 1H2YA 1L7QA 1EI9A 2RONA 2YH2A 3UUEA 4KE7A 1MTZA 2OQVA 3VJLA 1FJ2A 4U2BA 3PF9A 3OC0A 2HFKA 4QE3A 4UHFA 1UOOA 2QT9A 4TGLA 5AKLA 4H7IA 1SCIA 1F6WA 4EB0A 4EBBA 3SC2A 2PSEA 2GZSA 4KE6A 1MX5A 5C81A 4B0PA 2H1IA 4NMWA 4E46A 1SC9A 2X8BA 3LP5A 1H22A 4OU5A 2WUGA 1BROA 4YASA 5T4BA 3M83A 1JU4A 4H18A 5DLPA 1SOMA 2BKLA 4BYMA 3IBTA 4BAGA 1XRRA 1EX9A 4BP9A 2WKWA 5BOVA 2WHPA 1R50A 3IURA 4WY5A 2VTVA 5DJ5A 1XRNA 2QXUA 3M82A 3FBWA 1K63A 4WFKA 1AZWA 4U2GA 3TRDA 5BWCA 5A2GA 5LYYA 3WL8A 3C70A 4BE4A 4QLOA 5JAOA 1GGVA 1WB4A 1CUZA 1BN6A 4QWWA 3WIBA 2PUHA 3DCNA 6YASA 2WUFA 4AN1A 1SCKA 1VKHA 5JD4A 4AMZA 1WHSA 4IH1A 1UFOA 3V9AA 1F0NA 2ZYIA 4EY6A 2OPHA 1KU0A 5YASA 4RGYA 4BTLA 4UBMA 5C8ZA 2NW6A 2VF2A 4AMYA 1BU8A 3WKDA 3ZLVA 3BL8A 4OYYA 1GZ7A 1XZIA 3HRHA 4BCBA 2RHWA 3WK5A 4Y2JA 4PV7A 3WQHA 2PSJA 3R3ZA 1TCAA 4P93A 1YAHA 5ALLA 4XJVA 1XLVA 3BIWA 2BGNA 4BRSA 1B41A 3O4GA 5IVHA 5AKYA 1ZI6A 3ZI7A 2XMRA 4PO3X 2EDCA 4UBIA 1CUVA 1CUSA 3RARA 3QPDA 1KU6A 2Y6UA 3CCCA 3EQ7A 4LHEA 4C6HA 1H23A 4GEGA 1F8UA 3F97A 1N8SA 3BDIA 3ED1A 5DTIA 2DQYA 3WZMA 4C87A 4BVKA 2P8SA 2IITA 5EHZA 2PU7A 3WLAA 3C5WP 2Z5GA 5E4TA 1ZIYA 2IX9A 5ALSA 2W22A 1UXOA 1E5TA 1ZJ5A 4W9RA 4M0EA 2Q0XA 5AIAA 1XZCA 2VT6A 2WHRA 4ROTA 3G7NA 2C5GA 5LKRA 2OXEA 1HPLA 1DQYA 5ALOA 4J0IA 3LCRA 4PSDA 2HA4A 3RM3A 1MNAA 2V97A 4FBLA 1WCYA 5JZSA 1YAJA 2DHCA 3I6YA 4KE9A 5DNWA 5IH7A 1WOMA 2BUCA 2WQZA 4GHWA 3WYDA 2WFMA 2WHPB 4BB0A 3HACA 5LLSA 5CH3A 4B82A 2C58A 2BFNA 1CPYA 1YR2A 3WWPA 5ALKA 2HA2A 1YA4A 2JEYA 5EIHA 2GBIA 4BCDA 2ZYHA 3R41A 1Q84A 1MNQA 5SYMA 3UUFA 5HQ3A 2XUFA 1T4MA 4KEAA 3X3HA 2WFLB 3PE6A 5I7UA 1U4NA 3GELA 3FYUB 4LIPD 1W6RA 3T4UA 1H2XA 5AP9A 4F5ZA 4PF1A 5HCUA 3O9VA 3MUOA 3ESDA 3DDUA 4MYSA 1TK3A 2QJWA 3KWFA 3V1KA 1AKNA 4V2IA 4HRXA 3AIOA 5EHXA 2B20A 4KAAA 2I78A 4G4GA 4K6KA 4CIBA 1LZLA 3I6MA 2WJ3A 4M0FA 5K3FA 2E3JA 4X71A 4A23A 1O6FA 1MT3A 4X97A 1BE0A 2C0QA 5ALIA 4CCYA 5D3KA 2PX6A 1N5RA 3BJMA 2HL6A 3WKAA 1CUBA 3IUJA 4BCCA 2OLEA 1CVLA 1QIIA 3LIIA 4HVTA 1QIKA 3STYA 1VA5A 2ES4A 1SFRA 1YS2X 4HXGA 3PF8A 1EK1A 1XZLA 3HJUA 2JGLA 2RGUA 4W1SA 2B4KA 4MWTA 3QMMA 4FLFA 3DL7A 2OCKA 5ALUA 1E3QA 3WJ2A 5AM5A 3QH4A 1LLFA 4Y2SA 1ZICA 1U65A 3NUZA 4EZIA 3WWOA 1GQSA 5EHQA 1AMNA 1R3DA 4UBKA 1AX9A 3D2AA 4C4ZA 5JAPA 5FOQA 5A7HA 1GKKA 4H35A 1CRLA 4ARBA 3H19A 4P92A 2XQIA 1PJAA 3QPCA 2VEOA 2BUBA 3F9CA 1W52X 2C5FA 2I3DA 4C01A 3DKKA 4BP8A 5DYWA 3DNMA 4B9AA 2ZJ7A 4FWBA 3VVLA 4U2FA 4BAZA 4AZ0A 4K5QA 4UBOA 3S2ZA 3WKBA 1AGYA 2ZJFA 1DQZA 4CG3A 3I2GA 4G1FA 4NVRA 3T52A 4G8BA 5ALXA 3FVRA 1CUIA 5D7BA 1TCCA 2HA7A 3QMWA 2XQJA 3QZUA 4FTWA 3AIKA 1R88A 2XUDA 5LKAA 5HQ3B 2DR0A 3QMVA 3HI4A 2G4LA 5LZ9A 2XQKA 4H7DA 1OILA 1WB6A 2D0DA 1UOPA 4GW3A 5ALQA 4FNGA 4QLAA 5ISMA 5CXUA 2XUQA 1ORWA 3AIMA 4XWGA 4UFPA 1XZHA 1Z68A 5ALWA 5HKBA 3IVMA 2HHAA 4P08A 1FSSA 4YX9A 5JARA 4G8DA 2VJBA 2J3DA 4ZWNA 1X2EA 3I2IA 5H3HA 3CCBA 4MQLA 4FLMA 5AM1A 1XZJA 4FBMA 3JYHA 3K2IA 5AOBA 5HKAA 4RPCA 3GFFA 1HLGA 4ZRDA 1XRMA 3GZJA 1BCRA 1EINA 3FLAA 5K3BA 2XI4A 1K4YA 1XZMA 1ODCA 4Y2XA 3VISA 3PUHA 5FLKA 5K3FB 1CUUA 1R1DA 2ACKA 3V1NA 1U2EA 2ACEA 1L7AA 2PPLA 4DSAA 4N8EA 4B85A 4BZZA 1LBTA 4YPVA 4CCYB 5IVIA 1CUEA 2OCGA 1R4ZA 5ALJA 4Y2UA 1CUHA 2JIDA 1EDDA 2DCMA 1LGYA 2HU7A 3H2KA 1WB5A 4H77A 4KAJA 4G5XA 1EDEA 3OPMA 3WJ1A 4AX4A 4K2AA 4KJXA 5DTJA 1WM1A 4OB7A 3WWCA 2OG1A 3BXPA 2XUGA 4FHZA 4Y2VA 1CUCA 2VJAA 1ETHA 3HXKA 2JGKA 3HSSA 1JMYA 4UFNA 3H17A 1OXMA 3HEAA 4QNNA 5EFZA 3IDAA 4QDXA 1FFAA 3DJYA 3W04A 1EB9A 4CI9A 3SWWA 4AO7A 1UWCA 1ZI9A 3EBLA 3E1GA 3R3WA 1XROA 4PQEA 5IKXA 2RI6A 4S0XA 2RAUA 1FFDA 1IZ8A 1G4HA 2HADA 1QTRA 1E89A 2Y1KA 2G5TA 4Y9SA 1J2EA 1JJIA 3R40A 4AN0A 2JGIA 4GECA 2WSLA 4Q34A 1FFCA 4QWMA 1QGED 3E3AA 5FKJA 1MAHA 4UBNA 5FRDA 1Q83A 3C45A 3LIPA 2PSHA 4UFOA 2AXEA 5LZ4A 2XE4A 4IHAA 1C4XA 3OM8A 4L3WA 3O95A 3H2JA 3STTA 5A7FA 3F98A 3DOHA 3OTQA 3H1AA 3VXKA 1A7UA 3PICA 5DWDA 3L1JA 3KD2A 5JADA 4EA6A 1CQWA 4CFSA 5HK8A 5HFAA 3F96A 3D2BA 2WUEA 4JYPA 2VJDA 4H7KA 1N1MA 3C87A 1ISPA 3KWJA 4B7ZA 1C7IA 4JH0A 2H7YA 4DMFA 2EDAA 1YB6A 4CG1A 3AZQA 3CN7A 5HK9A 2QS9A 1MAAA 4M0MA 2DHDA 3GUUA 1JU3A 3SX4A 1MN6A 5AH0A 1YS1X 3WKEA 2GBGA 4KRXA 1LPNA 1RP1A 5HF6A 4BRZA 4J0KA 1UZAA 3C6ZA 4X6XA 4BC1A 5JANA 2XUIA 2WFLA 5ALGA 2AJDA 3BF7A 4JNCA 2PL5A 3FYUA 1K5PA 3FNBA 3H2GA 4X94A 1GPNA 4XVCA 4EY8A 4ZV9A 2UZ0A 5K3DA 4INZA 4BE9A 5C8XA 2QMQA 3TEJA 4OD0A 1DWPA 2WTMA 5FPPA 2C7BA 2LIPA 5E4YA 1QIDA 1VLQA 2C4HA 4Y7DA 2OGSA 1R9MA 2PSFA 4ZI5A 3G9ZA 1CUWA 2H7CA 4WFIA 5CRIA 3OOSA 1I6WA 3R3VA 4ETWA 1RYYA 5AKHA 3OURA 1DINA 1TRHA 4X93A 2D5LA 4IO0A 2O7RA 3ZV7A 4Q1VA 3FCYA 3NOXA 3WIOA 2Z3ZA 3KOOA 3G8YA 3R0VA 4CIAA 3AZOA 5D6OA 4E14A 4WDQA 1F0PA 1XLWA 2QUBA 2FJ0A 1CR6A 4XX1A 4QEKA 3WK8A 2WG2A 3D5EA 2Y6VA 3I2FA 1X2BA 4GLBA 1MO2A 3N0TA 5JZBA 3D7RA 2X76A 2K2QB 2HA5A 1HL7A 3C8DA 1MPXA 2XMBA 1AC5A 2B61A 5HZGA 2JF0A 5AI9A 5AI6A 4HAIA 4Q82A 4OB6A 1XRPA 3VKFA 3L1IA 5ALNA 4J0JA 4RNCA 3H04A 1DT5A 1XZBA 4LKOA 5LIPA 1DWQA 1QIGA 4G9GA 5CXXA 1EVQA 3I2KA 1QTIA 3W06A 4Q05A 2XUJA 4UHBA 1JJBA 3VJKA 4J3JA 1VZ3A 2ONCA 3G0DA 2I03A 4DLNA 4X3CA 3QITA 1S8OA 3WWEA 2HDWA 4J0CA 4KACA 4UBJA 1A88A 2XUHA 4N8DA 2BUAA 5A62A 3BF8A 5AM4A 3YASA 3IIIA 4C89A 4TPKA 1VXOA 4MWSA 1J1IA 5CTAA 1CLEA 3W2TA 1R9NA 2PSDA 2BCEA 5AK6A 5EIEA 1H2ZA 3IUNA 2WTNA 4GXNA 4GDMA 1XZGA 4A16A 1A8SA 2AJBA 4X7BA 4HXEB 1D07A 4Z49A 2Z8ZA 4QDTA 4UHEA 1N5MA 2JEZA 3RKSA 1T2NA 2QUAA 3EF3A 1MX9A 4HRYA 3A70A 3WL5A 3W9BA 1HBJA 4BDSA 4MQMA 1UOQA 3STVA 2Y2VA 4N8SA 3TGLA 2JGFA 4CG2A 1YSCA 2BGRA 3DD5A 1CUJA 1GXSA 2YXPX 3BIXA 1UKAA 4ZGBA 1BS9A 3BJRA 3FYTA 1XKTA 4J0HA 3W9UA 2YYSA 4HZGA 2QXTA 5CT4A 1JT2A 4EY7A 4B0OA 3KXPA 1FFEA 1E66A 3ZLUA 4L0CA 1W4LA 4BVJA 1XZAA 1TAHA 4P9NA 3G0BA 5K3CA 1G66A 3VJMA 4I4CA 2WG1A 2O7VA 5JD5A 2XMDA 2PUJA 3ZPXA 1QFMA 4MXDA 1CIJA 3U0VA 1ZGCA 5E2IA 4WJLA 1ACLA 2HIHA 4UHCA 1IUNA 1XZFA 1DTEA 2OCIA 2CBGA 2GYVA 3A2LA 4EHBA 1LPOA 4IQ4A 1ODTC 3I1IA 4KRYA 4I3FA 3O0DA 5AI4A 4QDZA 2V9ZA 5FPQA 4JUIA 5ALVA 3V1LA 2XQFA 5ALHA 5I9IA 3PDCA 4MJ3A 1NU8A 2R11A 2IIVA 2WIJA 3ESAA 1GPLA 5ALEA 3G02A 5CMLA 5DYTA 2HM7A 1QIHA 3FAKA 3ZLTA 4RE5A 4PNZA 4X95A 4DNOA 4DNQA 5K5EA 4E11A 5J3JA 5T4HA 3Q8WA 2ROQA 5F4ZA 2VAVA 4AO6A 2GYUA 4X85A 1AURA 2G5PA 2WHQA 4A5SA 5IVKA 3TJMA 2XQGA 4HTAA 2JBWA 2W6CX 2WJ6A 2HA3A 4XIIA 4B80A 3STWA 4AO8A 5DYYA 1LBSA 5I8PA 4KAFA 5IVDA 4OB8A 4W1RA 5T4FA 2BJHA 1QO9A 5AKEA 5AKKA 3AFIA 1IUPA 2QR5A 5AI8A 4BAUA 1CFJA 1ZD4A 3O4JA 2OQIA 5AI5A 4AB1A 3C6BA 5AKZA 3I1YA 2WIFA 3HYSA 1ORVA 1UK9A 3DOIA 1XRLA 5CH5A 3C6XA 3C43A 4NS4A 5LZ5A 2QVBA 1QO7A 3ANTA 5CBKA 2JGJA 5DNUA 4DM7A 2QJRA 1CUYA 4FLEA 3STUA 4EUSA 1QIJA 3V48A 4DYHA 4X00A 4OCZA 1WPXA 3AZPA 3LLCA 4DGQA 3CN9A 2QKYA 1JFRA 2ZYSA 1J07A 3D4LA 4E15A 1UKBA 1MU0A 3AUKA 3S8YA 2QZPA 2CEKA 4C4XA 4FDMA 4I19A 2WUDA 3PUIA 2FJPA 4KYVA 2CUTA 4U2EA 1W1IA 1K6EA 5JASA 3MUNA 3EIOA 5A6VA 4F0JA 2GBCA 2WM2A 3WK7A 1BEEA 1RWQA 3D0KA 3DYVA 3KDAA 3QYJA 3OG9A 1Y37A 3DYIA 4LXIA 1BN7A 3I2JA 4DMHA 5K3EA 5AICA 2QRUA 3WK9A 2Z3WA 4H7HA 1Y7IA 5AOAA 2O2IA 5LP1A 5ALRA 1UKCA 5HFNA 3WKCA 3O4IA 4D9JA 2HU5A 5AKIA 4PW0A 1QOZA 1EVEA 3K6KA 2RHTA 4Q3LA 1E8MA 3H1BA 3ANSA 4DIUA 2WFZA 2YASA 5AIBA 3E4DA 4Y2PA 2XT0A 4Y2QA 5CW2A 1TKRA 1EXWA 4DNFA 2WG0A 1JMKC 1QIFA 5FXMA 4G9EA 4QZVA 3M81A 3B3QA 3P2MA 4H0CA 4FMPA 3QM1A 1CUXA 5JZ9A 1OCEA 1MX1A 1LPMA 5ALTA 2ZSIA 1EB8A 3FLEA 1X70A 2HFJA 5E4JA 3CXUA 3G0GA 1E8DA 1CEXA 2O2HA 4ZV7A 4BATA 3RLIA 1QLWA 1VJ5A 4NZZA 3ESCA 4BC0A 4UUQA 5ALYA 3HABA 3M3DA 1ACJA 2C0PA 5BWBA 4JYMA 4FFWA 3A2NA 4B83A 5FV4A 2HRRA 1LPAB 3DKRA 1USWA 5ALMA 4DNPA 2QOEA 4BZWA 3WA7A 3IULA 3MGAA 5AK4A 1WHTA 5ALPA 3WL7A 5C7YA 3B12A 1QE3A 5FDFA 1XQWA 4QA9A 1DX4A 5JALA 4B6GA 2WILA 4H7EA 3FWHA 5AK3A 5CT9A 5KWJA 1THGA 3FCXA 1GKLA 3VDXA 3G0CA 5ALZA 1YCDA
chains in the Genus database with same CATH superfamily
2PO5A 8ATCA 2QTLA 1JLRA 2I80A 1R16A 2Q27A 3THXA 3NOVA 1SIWA 2A1TS 4TTIA 4KXVA 1HDCA 2P35A 5EI5A 1LPPA 3LTEA 1R10A 4IF4A 4N9WA 2YKGA 3IKMB 4NFLA 3UUWA 4CKXA 5C51B 4DY4A 5AKJA 4WWHA 1CQIA 3BRSA 1E3WB 3DHEA 3GA7A 5J2UA 1ZAYA 2PO7A 3M33A 4LQCA 3DUFB 1EJ6A 4QASA 1QLHA 2XMPA 1GRCA 3O4HA 3MWYW 1RHMA 2AUTA 2OECA 1ORRA 3CUTA 3LCUA 4TUYA 4YNBA 4RPJA 3TIXB 1UXHA 3HNRA 1KMHA 3JALB 1UL1X 3DE4X 1S4QA 3G17A 2V65A 1WIWA 5CCXA 1QC5A 1FTWA 1DX6A 2CHUA 1B74A 3E15A 5DKFA 3I04A 4UVDA 2NU7A 4PR3A 1Q16A 5C7IO 3GCZA 2FLKA 3WV4A 3G2JA 1N2GA 1UMCB 3FNHA 3LUFA 4H1VA 4IKEA 4O02B 4XJSA 1PWHA 1HQKA 2VA9A 4CKCA 2PYDA 4EHKA 3I01A 1E92A 1P61B 2C5HA 3UH1A 3QBJA 3X2SA 1OAOC 4GBED 4MR9A 16PKA 2EKBA 1BXRA 2EV9A 3A8TA 4LMRA 4FZRA 5JO0A 3F46A 4R8RA 4RFSB 3C1OA 1U31A 2F3PA 1X74A 4F2PA 2CDRA 4GZ5A 4LYDA 4DZTA 5I01A 1TMOA 2I67A 1F9AA 4C1BA 1CQZA 3U9SA 1XXHB 3AF6A 3CTPA 4RF5A 1PZEA 1ESEA 1QGDA 3PX2A 4LV6A 4QDOA 2Z5VA 2HGSA 2ZVDA 3EGOA 4DT1A 4OXYA 4LSWA 3I2HA 1UK6A 4BJ3A 1XRSB 1Y7PA 4EFLA 4MYCA 3GBSA 4IHQA 3O9ZA 4DCJA 4WFJA 1SPBS 1PFQA 1NF3A 2BR3A 1HYEA 1Z0IA 2PRJA 2I65A 5A04A 1Y0BA 4QOEA 2WAXA 1L7DA 4Q7EA 1I10A 3JQ7B 4B84A 1IB6A 4Y9UA 3ZJ5A 1K5DA 5EEHA 1PD0A 1IMJA 4NI5A 3H0CA 5G02A 4KQMA 1I2CA 1KJ9A 3VPXA 5JD6A 3T9AA 3PD7A 3EPHA 5BN4A 1JG2A 4DA8A 3HCPA 2BRUC 2WSBA 2Z9DA 5JQWA 3BRCA 4TRMA 4L5IA 4BO7A 2X86A 2P9TA 1IPHA 1E2FA 2OHGA 2PYZA 2XKAA 3IBSA 3JY6A 4I55A 4MGKR 4UPDA 3RKRA 3TQSA 5A5FA 1O8CA 1PUIA 1B6GA 3T7JA 4WI1A 2XHEA 1MKYA 3WWYA 4CQMB 4GQBA 2B94A 3FPEA 4O5AA 1TC1A 2H1OA 1GTJ1 2OD9A 1ZMTA 4J94A 5LXTA 3QLVC 4LSMA 1HLDA 1K66A 3GUVA 3HA5A 4LDRA 5H3LA 3ZI4A 1LEHA 3IPCA 3RHFA 2ALJA 3EA0A 3K1ZA 3GRUA 1FP4A 3NBAA 4BZQA 1CZKA 1CRPA 4JZYA 1U2TA 3JYNA 5LQAA 2XNKA 2YV3A 3IVRA 1IHXA 4H2DA 1P73A 1IM5A 2OZEA 2DECA 4MH0R 4ZQFA 1FLDA 1JKMA 2ERCA 5HS6A 3C8ZA 5B3JA 2NUPA 1JFVA 3CB4A 3OOJA 3UV3A 4DN6A 1OKKD 3TSYA 2AD5A 1NP3A 2AIRA 3JWJA 1HNXB 2A9RA 5C5IA 3DBLA 2BVNA 4IUDS 5SY4A 4BX9A 4DKJA 1A8UA 1I01A 3E3NA 3R5XA 1I94B 1G7SA 1ZCAA 1I1QB 4J8PA 1YI8A 3VHQA 3HZOA 3GMIA 3QJGA 3A32A 4J43A 4Q3OA 1ESCA 5FO1A 1N36B 3O38A 1Y5IA 4DA4A 2VCEA 3RSOA 1UM8A 3KB6A 1L5HA 3RBZA 1Z2CA 1BRMA 2NZJA 3ZWQA 3IUYA 4OQXA 3AHGA 3DGEC 5EIAA 2KI5A 4DSZA 1FE8A 5B1DA 4I50F 3WB9A 4ZVLA 1RM5A 5CJ2A 5FUWA 2FZGA 1YWGO 1EFAA 1CJMA 1JI3A 4P33A 4F21A 3K1JA 1XQYA 4YDSA 5AO9A 4CMJA 4JD5A 5L53A 4RACA 3H4TA 1NM5A 3PFWO 4BEVA 3BGDA 5AI0A 2O8CB 2HUNA 3TTVA 5D3QA 5FWDA 3CINA 3KLMX 3WZLA 3TIVA 3AI1A 1XUOA 2JBAA 5AVVA 4HH0A 1IUOA 4JX9A 4HVLA 4UM8B 4UVEA 1RLTA 2V4MA 2O14A 4LEIA 1NG9A 1HYBA 2YZ2A 3OHSX 1CUDA 3PEUA 4ENUA 4MV6A 2Q2NA 5LB4A 2JJYA 2AXNA 2P0YA 4YPFA 2O5CA 4MS4B 5K8LA 3NTOA 1NV9A 2F1IA 1E7WA 4X7RA 1WPRA 5FNVF 3T1OA 2O06A 2J0UB 1ZCFA 1ADYA 1EK2A 2CHGA 2IKQA 2OXIA 3VKGA 5TMDA 4F4FA 1UJCA 5TQ2B 1TYEB 3MCZA 4ENTA 2FMTA 4O08A 1NA5A 1M0WA 1SC3A 1X7HA 4HP8A 2FMIA 4RCVA 3D6AA 1N4AA 3R8FA 3MBOA 1PDOA 2H11A 1B2RA 2QY9A 3R6TA 2B6NA 5KQRA 1WP9A 4D8XA 2NO7A 1C4OA 2QZ9A 1AH2A 1Y5NA 3PFBA 1Z6AA 1ILEA 1K9SA 3QXCA 4GC9A 4RAOA 1ZN7A 3I45A 1TVEA 3R5TA 1NXWA 4FDVA 3V1YA 1SIBE 2PEZA 4IQ8A 1QB8A 1GZSA 1TU4A 1GVNB 2DGDA 4LXGA 2AJCA 3LY9A 4TV9B 3SHVA 3UGTA 4F92B 4BMVA 3ZCQA 2K87A 3DLAA 3QBTA 2B4QA 4DVJA 4Q1AA 3CPJB 4GYKA 1Y9DA 4FGSA 4DDVA 1T24A 3FFAA 1FB5A 1JPUA 1XX6A 4P3NA 3DDNA 4W1PA 3DM9B 3DOOA 3ZV3A 1L5OA 1A2KC 1DSSG 4BNVA 3EFOA 4K6HA 2G77B 1YA8A 4YFYA 2GCPA 4FMDB 4OP3A 5AJWA 1FFXB 2DPMA 5D3MA 1OX5A 5DHTA 1Z6XA 3BMOA 3G8CA 1A1VA 4S1VA 5EG5A 1DRKA 3WYNA 1XE3A 2UZ4A 4NBUA 3CVXA 2Z6QA 5GV8A 4JB8A 3VV3A 2AHOA 3EZ6A 5F1OA 4PN3A 2W4QA 5KEIA 2CXNA 1HG0A 1V2GA 2R4TA 4M60A 3TO5A 3LG2A 1LVUA 2ZRBA 3WISA 1FCJA 2V6BA 4XWWA 3PXCX 4KXFB 1MP0A 4HXFB 4D9FA 4F86A 1IBMB 4HWGA 4IBOA 2XRMA 3OCVA 1UFKA 4W1QA 1KNXA 2JIBA 1X1BA 1YVRA 1L7VC 2MSCB 3FSGA 2ZWIA 3GPCA 3N8HA 4LI3X 3V1TC 5CFLA 1BYUA 5ICMA 2ZQZA 3ZVRA 3KBBA 4QKQA 2Y0BA 4FOOA 1IEXA 2OZKA 4LWPA 4JXXA 1SELA 3FY4A 3KB2A 4HWTA 4MTCA 4RZIA 1Z13A 5JLAA 2X9NA 3GIDA 5AD1A 5KU7A 3SYMA 2WAAA 1IRXA 1L1FA 3LWDA 1M76A 1RMTA 4ENRA 2ZJAA 4YRAA 3KQHA 2DR2A 1IULA 1M6YA 1ONNA 1RE1A 3IELA 1OH5A 4MR8B 4GPAA 3TXAA 3FETA 2J9YB 4EJSB 2I8AA 1M34A 4G5QA 1PQWA 3ETEA 4S2UA 1V9SA 2VPPA 3NWOA 3NDBB 5F5XA 4HUJA 3LKVA 3OLZA 3ZHVA 1ZI8A 5AVTA 1EH5A 1TEZA 3DO5A 4HK4A 4UNIA 4F8JA 2P91A 3SF0A 4PEVA 5KYWB 1CE8A 2JFVA 3AU8A 3KHKA 2R25B 3M89A 1CNMA 4MYTA 2CT8A 4CEHA 4FOPA 3IAUA 1EHIA 5GTDA 1ZD5A 1SUEA 2DLDA 4M9QA 1VE1A 1TO1E 2GWRA 4OHVA 4QUGA 1CJBA 3PEVA 3DR5A 3G9XA 4G56A 3MVEA 2NSLA 4Q1FA 3UPUA 1FEZA 2ZRKA 3CEAA 4OGGA 1MMFB 1LPSA 2NTEA 5ESRA 1QFZA 2ZREA 1MHTA 2R8BA 2A33A 2C29D 4E12A 1EU1A 4LPSA 1UAAA 6CHYA 2R84A 2F59A 4I3GA 2HNKA 5JNVA 1QRTA 5F9MA 5K8VA 3GT0A 4AZ3A 4WK4B 4W8OA 2IODA 3KFXA 2XZLA 4QQKA 1NXOA 1Z5ZA 1Y1RA 3MWGA 4OSEA 1TTTA 4Y2TA 5DB4A 4NBSA 2WUVA 2ZBFA 3RCBA 1OYWA 5B1EA 1GKUB 5BSFA 3SXJA 3UMBA 1YB5A 3B6ZA 3OM0A 3R7SA 2WLSA 3KPWA 1YR3A 1PI3A 2ZVJA 4HPXB 4MVYA 1G17A 2OHXA 3LQ1A 4ITVA 3PC2A 5FUBA 3RS8A 3IBGA 1PEDA 4BMYA 2B2XA 2PHZA 4OYLA 4D0LB 2WEKA 4JR0A 2IWHA 4JI3B 2E85A 4KB5A 4KTTE 1C0KA 3SKYA 3UJNA 4NCAA 1VJGA 2OY0A 1LS6A 5IX8A 1NX9A 1EFPB 4OLBA 1N78A 2OQ2A 2QTBA 1FTNA 4LXTA 2PLAA 4D9GA 5CH8A 3N5CA 1N0HA 2QSUA 1JSCA 3BXOA 1E0AA 4PZAA 5A7GA 5ESWA 2C77A 4QDJA 3OTHA 3CM0A 3PXEA 2XCSB 2BGWA 1H1LB 3T5GA 1W2GA 1ZH4A 1FC0A 1GM5A 1W76A 1K0UA 2VJMB 4IFIA 4IRUB 4KV9A 5GVSA 2APJA 2VBFA 4CR7A 1JEEA 5AESA 1CQXA 1GZHB 4BBZA 1SU4A 4UULA 1YBVA 4MWBA 4RF3A 2HIAA 1CHNA 3D81A 3ONVA 3BWBA 3FPKA 3FFWA 5DT2A 2XA1A 3ONNA 1V25A 1VCNA 4XPIA 5ALDA 3HB5X 3I05A 3WVNA 4QGFA 4BGEA 1ZS9A 1NYTA 2J7PA 2JAOA 1SU8A 5DASA 2Q1TA 2FXVA 2V45A 5CT6A 1RYMA 3ENVA 4YACA 4EKDA 1A8QA 2VF4X 3DEZA 4KR9A 4EHFA 3K8YA 3DQZA 4II3A 1JVNA 3LPMA 4BO1A 5TMEA 3IQWA 5FP0A 3TUZC 3AVOA 5KHOC 4YRTA 4Q4HB 2A0KA 4RYDA 2HDHA 1FXWF 3U4GA 1MBZA 2QQFA 4MYHA 5GZ1A 3GLIB 1PL7A 1KHTA 1AUXA 3G3EA 3U7GA 4ALIA 5B36A 5LZ8A 5EYPA 3KVNA 2GBPA 4IX1A 2YWGA 5IWAB 4MAMA 3U1TA 3ABOB 4JBHA 1SBYA 1F8GA 2ECPA 1NFQA 1O4VA 4H7PA 1J5PA 2I1LA 3OECA 3UWKA 5AM3A 4ARZA 5CK4A 3A04A 3RSGA 3H4IA 1YB7A 4ND3A 1Y3HA 2YHAA 1NR7A 4L6CA 4ZI7A 1HZJA 4LKRA 1PNRA 1EMDA 2GZRA 3ZUPA 3UAGA 1KPIA 3EAGA 1QV9A 1L7PA 4R0NA 2GBFA 4TTTS 4W5JA 4NEGA 5LA6A 5DHAA 2DT8A 3UCEA 4ENQA 2XUZA 2CMHA 1TCBA 1FFBA 2I2CA 3RVBA 1E5VA 1DOZA 1LQ2A 1ZOSA 4QXMA 4NV0A 5GGXA 4REQB 4C30A 3AEZA 4ARZB 4X91A 1VCIA 2P2GA 1W30A 4KAXA 1PR0A 4U8HA 3SK0A 3FMFA 5K0JA 1OI3A 3AF1A 1IVNA 5JS1A 1KH3A 2RGWA 2N1MA 2GF2A 3KPJA 4KPFC 1PNVA 4UJ5A 2FHPA 4R9NA 2C07A 2PZJA 1DAHA 4ZCSA 2VP6A 3LC7O 4A82A 3D8SA 4IH9A 2EJCA 5KTOA 521PA 2WA1A 1HE8B 2I1VB 1KKMA 4FEAA 1EGVB 1NUAA 1PFVA 2DFTA 4KNWA 5J5CA 3TW8A 1Q1QA 2QWXA 1KEZA 3A1FA 3SIRA 1FJGB 2FH5B 3E1SA 2JI9A 1WPGA 2ZM5A 5IKOA 4I0WB 1Y98A 2VHTA 1MOPA 3NAZA 2GHTA 1NQOA 1DRUA 3JQAB 1R5NA 1MENA 2PCJA 5DM2A 5EZYF 4FN5A 2VRCA 4KHPB 2P4HX 5CVUA 2Y1DA 1RQPA 2XB8A 1A4UA 2ODQA 4Q12A 1GT91 3WGVA 3LS2A 4NHEA 1AGNA 2JJ1A 1NJSA 3RC9A 5HXAA 1WSAA 3TNDA 4IINA 3P1JA 5B1HA 2VF5X 3W5HA 1SCUB 4FFBA 3TVDA 4ZU6X 4YAJA 5EE9A 4DILA 4RK1A 4ZODA 4N7MA 3FLBA 1N1GA 3HKDA 4BEWA 4EF5A 3U4MA 1US8B 5AHOA 1FK8A 3A6PC 2R7LA 3VR5H 1XAJA 1TQ6A 1Z4PX 1DTSA 1FRNA 1LK0A 2WJ4A 3GPDG 3OOHA 3QQ5A 4LOHA 3AUFA 4ZCPA 2E7ZA 2Q49A 1IVSA 2VYQA 1T6YA 4TKUA 1YCFA 3IVGA 2YXNA 1A9ZA 1NVDA 1VZ2A 2ATCA 3MOSA 3D9QX 4TVKA 1CKEA 1XRQA 3FYUC 3KT8A 1NR5A 4J49A 4PBSA 1TM2A 1ID8A 4DIDA 2RBKA 2VH2A 4CKEB 4RQTA 4EHIA 3V3TA 4G4SP 2VDUE 2QD2A 4FI3C 5AKGA 4ZEXA 3HKEA 4CDNA 4AYWA 1S02A 4F72A 2IZ7A 4ARIA 1SZDA 4K3VA 1U3UA 4K6GA 5B4TA 3E9YA 4OI0A 3EGVA 5F64A 3P2YA 1XWIA 2FZKA 1EBBA 4TYPA 3LT5A 3TN7A 4EGQA 4FOSA 4M3NA 4FDAA 1ZN9A 1HG1A 2RB5A 3O8LA 3JTEA 2G9UA 1D2RA 2V6MA 4OHCA 4CCWA 3I61A 3SE7A 4BNDB 4L5YA 1O0CA 4X1OA 2Q46A 2D0IA 2GHIA 4HN9A 2CKMA 4UTRA 1UUFA 3H18A 4YGXB 1Y4UA 3A36A 1XZNA 3OJEA 1SXJB 5H68A 1EA7A 3GLVA 3JQEA 1MIOA 1EE9A 2CK3A 4LRWA 2X0FA 1XQXA 3TDNA 4E1AA 4EG5A 3LNTA 4XEHA 3EX7C 2NVBA 1Y63A 1U63A 2FQWA 5DI3B 1ZOIA 3DZJA 3HU5A 3KKQA 3EUWA 2OGZA 2L18A 3KKEA 3TQIA 4JT4A 3ZBUA 6AT1A 2BGJA 2C83A 4DJJA 1VJRA 2ORYA 3NVDA 3AKCA 2EEPA 2G63A 3QPAA 4LNUA 2HBQA 5I7FA 2O19A 1UPXA 1V41E 4JUDX 1LU9A 4YK7A 4B9EA 1VXRA 4MGYR 1E7RA 1RLJA 2AXQA 2YH2A 3THOA 2Q1XA 1J49A 1WV0A 2AXPA 3M1AA 3KE8A 2ZUTA 2VJNA 3FHCB 1H05A 2Y1LA 1K6XA 5JYDA 5CVVA 4QM7A 1PBNA 5GJVC 2JI6A 1FJ2A 4MLZA 1TTPB 1PGJA 4NOLA 3TOSA 2OB2A 3GD5A 3WDMA 4UOEA 1I3MA 4PFKA 4EKGA 3CT6A 4D41A 3PGLA 1RJ9B 5AKLA 3ADOA 3NETA 3V8VA 2QLJA 3LVBA 1G3MA 3L01A 4YRKA 1CB0A 1JJVA 2FHSA 3L5OA 2QX4A 1SUFA 1GARA 4RKWA 3HB9A 5GIOE 4RTQA 1S1MA 1F8YA 4PAGA 2OGWA 3KPYA 3OY2A 2AW5A 2Q4EA 3DZHA 2SCUB 2PSEA 2PTGA 3T61A 1T5BA 2H4HA 1WLSA 4KE6A 2Y4OA 4YN3A 5EJEA 1G19A 4BNLA 3DBOB 4NMWA 3Q7EA 4OGWA 4E46A 2YFQA 4M1ZA 5JSFA 1JDBC 3LP5A 3GLSA 1MZPA 4ZI2A 3AI7A 4DF3A 2X9VA 1JEYB 4LRXA 1BROA 1AK9A 3KUKA 3R5HA 4LXXA 4CGZA 5KHAA 1PL8A 1P17A 1JU4A 4DG5A 3UT6A 5JJLA 2OV3A 3MS2A 1SOMA 4P98A 3RVQA 4LHSA 1KTIA 3HVKA 5TB5A 4BVHA 4UOQA 2G9ZA 4HLUA 3BN3A 3DYBA 3IBTA 4L73A 4CMKA 3VAYA 2G40A 4YP7A 4JVNA 4NS1A 5JHGB 5KKAA 2WKPA 3SY8A 3GHYA 1XRRA 2O0KA 5JS7A 1LQUA 4ERNA 2PS3A 5LP6C 2JFNA 4HS4A 4PCAA 4FK8A 1DZ3A 4UREA 3T5BA 1KEWA 4ZKDA 1S2GA 2OBBA 2ADMA 2A7XA 5IK2D 5JNSA 2NVOA 2VTVA 1L1RA 4YRNA 3GGPA 1Q91A 1QH8A 3IV7A 1MV8A 1FS5A 1I30A 2P4EA 2YQZA 3P9YA 4MYUA 1AXRA 3ZJ4A 2DQKA 1SC6A 2BP7B 2JJ8A 4WCDA 3B1VA 2J9XB 4KIFA 1ECGA 2P0EA 3FBWA 4U7JA 3H2BA 5CM2Z 3T1HB 4YJGB 4FILA 3K71B 1JHDA 1F3OA 1RQRA 1FTQA 2J9ZB 1Q6YA 3JWGA 4Q19A 4U2GA 2DKFA 4AVYA 4BB9A 1NF2A 3F78A 2ZT5A 1B0UA 3CUUA 1U4OA 3HGQA 5DI9A 5CDGA 3C70A 1Y4SA 3H2YA 1CS4C 3V46A 2R65A 4BE4A 2FZ4A 2Q3HA 1KH1A 2H92A 2WD7A 4HGQA 4LOAA 4MGHA 3ZY4A 3EW9A 1T3ZA 1OTXA 4R1SA 2OD2A 3RW9A 2ABWA 3AVQA 5FFMA 2VSOA 3FPJA 1EUDA 5KKCA 3KTOA 4RMIA 2WUFA 3Q1LA 3ZHCA 2B69A 2PJRA 5CCBA 2NUTB 1WZUA 2H85A 3KQQA 3MD9A 1VKHA 3NKVA 4JLKA 5IBPA 3IO5A 3E8SA 5B30A 1UF9A 1J5XA 3VYWA 2Q9UA 1RAIA 3ESXA 4AMZA 2QQEA 2OO7A 3IP9A 4NBTA 3ZHOA 3KR1A 1UFOA 3V9AA 4IDBA 5DM60 1HE2A 1A9YA 3B2NA 2OCDA 3QU4A 2OPHA 1IWBB 1J6UA 2ZIUB 3JZIA 4IDDA 3VNQA 1LW7A 3DA8A 5A5DA 2MSDB 3P0EA 1WKCA 3MUFA 4AMYA 1QRSA 1U99A 3W8EA 4P5EA 4NY1A 2GFHA 1P62B 1FBTA 3ZBPA 4RZHA 3ZGNA 3ZLVA 2QYHA 4Q4DA 3PL1A 1EPUA 4J9VA 3RHZA 4NR0A 4Y6SA 1XZIA 1UXGA 3BTSA 1Q0LA 3OEWA 1NYRA 3TL3A 4NCBA 1BA2A 2CD9A 2RHWA 2ORWA 3A37A 1KZYC 4K1XA 5F7XA 1RKQA 5IJZA 4KFCA 4Y2JA 4TV9F 1BCSB 2YN4A 3WQHA 2IDJA 4X63A 2ZSJA 4FONA 4YUWA 3HO1A 4RPGA 2IOFA 4W9NA 3GLFB 3OI7A 3C4QA 1P4JA 1YAHA 3BK7A 4PXYA 1CY2A 1I4WA 1EGMB 2J9RA 4NTZA 4ZD6A 3RV4A 1JTVA 4QGGA 5ALLA 4DLBA 3MWFA 2O5VA 4XJVA 3TLKA 3PWKA 1XLVA 4FMDF 3G82C 1TM4E 2BGNA 3RS5A 1IY2A 4BRSA 2FR0A 4J4TA 5IVHA 3LLVA 4IEEA 4LDZA 4D97A 5EESA 1N33B 1MXFA 2MINA 3ZWXA 4M8KA 1PBTA 1LDGA 1R0SA 3GLTA 3LCVB 3ND7A 2QZJA 3CWZA 3L3BA 2VSFA 3QU9A 1AD2A 5HTKA 4Z4FA 5CK5A 2GN2A 1WNTA 2XMRA 4PO3X 4I1YA 2ZBGA 2UYHA 5IT4A 2EDCA 2Z4TA 1M6NA 1DTWB 1IN7A 2AFIA 4P8RA 5EN4A 1F4VA 4UBIA 2FWJA 3V32A 4PSAA 4ZANA 3HN7A 1BHJA 1SO8A 3RARA 4BFUA 2ZFUA 3JCZA 3QP9A 2IYEA 2B36A 2YNMC 1QWSA 2ZAMA 2A59A 3C3XA 3EGIA 3Q1KA 1NIJA 1OBHA 3T38A 3R3JA 1ZO8A 4I1UA 4TSKA 1GR1A 2XB9A 5TC4A 3EDYA 4EPXA 3CW2A 4RMNA 4D74A 1REQB 5KWSA 1NUQA 3SZOA 4KODA 2PCLA 5B3KA 3K72B 1THMA 3BG5A 1ATZA 3IKVA 2RGXA 5GINE 1F8UA 1D5CA 1SURA 2J6HA 3F97A 1NC3A 3LBAA 2H57A 3BDIA 3LPCA 4OMDA 4YHBA 4H3VA 5AJXA 1Z5PA 4ER5A 2DQYA 1J39A 1WDTA 4XYMA 5ER6A 1BHSA 4AC9A 2RHBA 4ALNA 4XVUA 2P67A 2H3EA 2Y0EA 4AWXA 1FBNA 2HF9A 2P8SA 5FTWA 4BVKA 4EUNA 2BT4A 3S81A 1VBNA 4FFNA 2E9SA 4DQUA 2IITA 4N5NA 5EHZA 1T8TA 3BGOS 3VO1A 3I73A 2YWJA 2XNSA 5FPTA 1PLLA 3UPTA 3IHTA 4QUKA 1NYQA 2BBOA 4M49A 3U7FB 3VNUA 4J16A 3W4IA 3BIJA 2HK6A 5BXQC 3HUDA 3BCUA 1ZIYA 1N2SA 2IX9A 2O8NA 2FDXA 2XODA 4MUKA 3A1SA 2QNRA 5ALSA 3RYIA 5P21A 2AVNA 3U19A 1BO6A 2XEDA 2J8ZA 4CR6A 1E5TA 1SHZA 2I2WA 4X6LA 3WLEA 3X43A 1O97C 2F8MA 5EPEA 4Y98A 2PBZA 4KPGA 4DXHA 5C52B 1YOBA 1ZJ5A 2AMJA 4B4WA 4HDSB 5HM6A 1AKUA 5HZKA 3IKLA 1SHLA 3L0BA 4H6VA 4GZ6A 3GGCA 2FFHA 4K2HA 4ENWA 2XSZA 2Q0XA 3PB3A 1WNFA 3QKRA 3HPQA 5LMNB 2J5BA 1JQAA 1PF7E 4HQFA 1EZZA 2YL2A 3L0ZA 1XVIA 3H9BA 2Q5EA 1N8NA 5AVRA 1PUJA 2R00C 5ALOA 4J0IA 4PSDA 5TQ0B 3RUCA 3T15A 1NVXQ 3GRYA 4RETA 1XTBA 1N3BA 5DBIA 5ENZA 4P3PA 4IDHA 4FBLA 1JMVA 1WCYA 5JZSA 1D0VA 2WU0A 2DHCA 5HJ5A 2B30A 3DB2A 3F8WA 1DAPA 5IH7A 3LJKA 2WWGA 5EQFA 5CA1A 3E70C 2WHPB 4P82A 1Z36A 4BWGA 4KDCA 4URZR 1WXQA 1WU7A 2R1VB 1KARA 2W2LA 4EW1A 5LLSA 3DKIA 4G4SO 1DV2A 3LT1A 4N47A 1KSFX 1R0CA 2BFCB 2G71A 4JUCA 3LKZA 2JPDA 5CYFA 3CLKA 4ZK6A 3GLGA 4RXTA 4X8MA 3ZNQA 5KYKA 3PRJA 4G0OA 1NBIA 4BWFB 3WWPA 1U7PA 3H8VA 1YA4A 5ADUS 4K03A 4HQOA 4P4SA 3ORFA 2YUTA 4IUYA 2F00A 2Y1EA 3GW8A 9ATCA 4BGUA 5SYMA 4CMCA 1U5CA 3KSBC 3GX1A 1KBZA 3W2EA 1GU7A 5FBHA 3D02A 2W7TA 3ZE9A 1XDDA 1EWRA 5F3RA 1KYYA 3DFZA 1NNSA 1P19A 2IXBA 5I45A 4KMOA 5K0CA 2NUAB 3F3SA 1T4MA 2DJ5A 5A5EA 3QJ5A 4UQLA 1CZLA 3X3HA 1TOAA 3P9IA 2E49A 4Y2GA 1NTRA 1NUSA 4M21A 4LQ4A 1U4NA 3T5CA 3V8RA 3TLJA 1Z8DA 5DEIA 3FYUB 5CB4B 2G5GX 3T4UA 3DMFA 3TLBA 3VMFA 1J8VA 4EFNA 4R4JA 1IOVA 2XGMA 4F5ZA 4PF1A 5E6SB 4MQBA 3NWBA 1Y48E 3Q7QA 3IEUA 2C04A 2GCEA 4DZRA 3E82A 3LDHA 3H83A 4H1HA 4BFCA 3O31A 3L07A 1P5HA 4HUQB 4Q4JB 5ARCA 4D4MA 2Q1YA 3V1KA 3KWFA 3WGKA 1NY6A 4QUDA 2ZJZA 1S6YA 3VNRA 2XYVA 1AKNA 2BGKA 2OBLA 2UVPA 3Q7IA 4B09A 3IRVA 5JFGA 5BSVA 4DV1B 3JD2A 4X1IA 1JSZA 2QUZA 3TIGA 5C1DA 4NOJA 4KH1A 1QE0A 2RAVA 2XCRB 1XOIA 2UKDA 2K2WA 4XGRA 2JCGA 1NULA 4Q4CA 3LX6A 1T6BY 3MSCA 2WB2A 2H5IA 3ONWA 4KNVA 2E82A 1DAEA 1R74A 4YV0A 1LZLA 1NNI1 2NXNA 5B7QA 2WJ3A 5EGSA 2I4MA 3EUFA 1GPWB 1ST2A 2GLTA 1RWPA 3L0SA 5DNYB 4IJMA 1XD2A 2X42A 3HJHA 4N0MA 1X1EA 2ZJ3A 1P45A 1G4UR 2ZTVA 3MTQA 4OAQA 4X71A 2MSKA 3OAAD 5DCLA 1LCIA 3SKVA 1ECBA 3NBKA 2Q21A 4X97A 1BE0A 1Z4NA 1T1EA 2BTOA 5LQSA 1JH9A 2QGFA 3ZCVA 3O3CA 2YWCA 4JMLA 5ALIA 4AJNA 1O2DA 2I2DA 1JQDA 4E09A 2GPNA 2LKCA 4QUAA 3KSDO 1DGQA 2GRJA 1GL7A 4XVHA 5A6SA 4AI6A 1ORHA 3I76A 3AUTA 3BMXA 2OLEA 3IUJA 3KSZO 3PWTA 1M8FA 4J6FA 2J0QA 1L4YA 1QIIA 1R6AA 3N9IA 4TM7A 4DWVA 4QXRA 1HV8A 4H4EA 5JCOC 4IVPA 1Y8AA 1M54A 3COZA 2IZ5A 4HVTA 5LUAA 2Z6UA 3STYA 3ZUGA 1IJKA 1MGOA 4ZTBA 3H11B 2R4UA 5EXDA 3RLFA 3RSFA 3S8MA 3UK1A 4QG3A 2L19A 1U0GA 3AEQA 1F5SA 1MW9X 2OZLA 3B1ZA 1NL3A 3PF8A 3FCEA 5B4UA 4HY3A 2XCLA 4IILA 1RQGA 1J22A 2IEYA 2QPLA 4JEHA 1RQ7A 4HQNA 5IC4A 5A9TA 3AONB 4MROA 3NHUA 1DIHA 2I2XB 3RC3A 4D98A 4W1SA 2PMDA 3WQRA 4L8GA 4YMIA 2H18A 5H02A 4BIIA 2ZANA 5B4VA 3DL0A 7MDHA 3EPKA 1XTZA 1RKVA 3LDGA 4C2TA 2A2ZA 2UVDA 3RIHA 4FLFA 2Q0HA 3GGJA 4M9UA 2BFFA 4AXXA 2NOAA 2IA5A 3M3PA 3Q0EA 1Z34A 3DLBA 2EKQA 2PZMA 5KOHA 1OVMA 1NP7A 2WWWA 3E05A 1O9HA 3N8IA 4WXEA 1ZICA 2AFIE 2JAUA 4GLJA 1U65A 3DTNA 4NBRA 2FDRA 5K0FA 5DW3A 1EJBA 3QOYA 3ADKA 2B2NA 3MWEA 3M4ZA 5FORA 3VR4H 1YZUA 4WOJA 3SNKA 3DV9A 4KIGA 3ULKA 1DPFA 2WWRA 1VSVA 2BGTA 4N3GA 2YOFA 5GGYA 3V4OA 4D0NA 4NYIQ 1AX9A 4RHXA 4RJKA 4CKBA 1ZRMA 3W5JA 4GLOA 4C4ZA 4C7OB 3ER6A 1RLUA 4D4JA 2WWTA 1Q7RA 5H81A 3QF4B 1MOSA 4ZYZA 2VJPA 1PYGA 4R2LA 1YF3A 5E4FA 2P40A 2BY4A 2PXHA 2D06A 5AXBA 5A7HA 2C2HA 2EJTA 3KB1A 4H35A 1M8GA 1PGPA 1U8UA 2FWRA 3LYUA 4ZQBA 4KP7A 3PUWA 1Z4QA 1FQJA 2H48A 4YCCA 3H13A 3O2JA 4KI0A 2J6IA 1V1MA 2F9MA 4F2DA 4TV8B 4X3OA 3ZHQA 5BYJA 3FJ1A 2QU8A 1NG1A 2IBSA 2V7VA 5DYWA 3HA2A 1H1TA 3K0AA 3TLMA 1TC2A 2IQIA 2YOHA 4QBFA 1EP1B 3VPDA 3VU9A 4B9AA 3RU9A 1QGUA 2ZJ7A 4FWBA 2HSDA 2IZ1A 4BAZA 3J80A 2CL7X 1JHQA 4AZ0A 4K5QA 1ONBA 3C85A 2FWBA 2R8XA 3IDZA 4P7KA 4PYQA 3SN6A 5A1TA 2CD7A 5BVGA 2NN3C 1N0UA 1AGYA 1Q19A 1DL5A 4NU8X 4G5SA 1GTL1 3K09A 2XCOA 4OKIA 4KITB 3D3JA 1R27A 1G18A 1G7CA 3KYCA 1JE0A 4JK3A 3KLBA 2HXGA 1NQTA 4NVRA 3T52A 4WKBA 3FF1A 3RV3A 3T7SA 4LC0A 3FVRA 1QZXA 3HRKA 4P6VF 4EK9A 4JASB 4DLZA 4EPVA 3HLYA 1VJDA 1Q3TA 2NTNA 2XCQA 4XLZA 1LI5A 3PITA 4C4SA 1NV8A 2HA7A 4GDFA 2DFLA 3ZXSA 1NOKA 5ELLA 4CM6A 3IVCA 1JLLB 2YS7A 2A9PA 3CHYA 2IOQA 1E18A 2OHIA 2GJSA 2AVDA 4KFRA 5LKAA 5A4JA 4TTRA 3S40A 1B8PA 4MVJD 1KEKA 4Y6PA 1Y82A 3HCBA 3QMVA 4HCJA 3ZH9B 3D8BA 1BMFD 1WZCA 3I0ZA 3K2QA 3OFJA 1OILA 4ZICA 4TZTA 3HU1A 2YIDA 4ALKA 4IIJB 3VSEA 2BLNA 1DDIA 1W2WB 1J2YA 5DDIP 3SEZA 5DTQA 4HFNA 4YRMA 4HV4A 4F46A 3KQSA 2XUQA 1J2RA 2B3TA 3ZWOA 2VK8A 1QK3A 5CXUA 1MJFA 3JARA 4XWGA 2HWKA 1S96A 1NWCA 1P7VA 2W48A 3K0EA 4IEIA 1VECA 3VR4A 4EABA 1KWKA 4XLLA 4IMIB 3SQXA 1OFUA 3Q5GA 2F7SA 1J56A 1RRVA 4ND6A 3LZ6A 4TKVA 2PLFA 2PK3A 3OTGA 4N5DA 5LYJA 4P08A 2HHAA 4P3OA 3MJTA 5HKBA 2WNIA 5LA6B 2FRDA 2YMPA 2CE7A 3K15A 1P72A 1X7DA 5NLLA 5JARA 1YACA 2P2ZA 1YFJA 5IKPA 3QWBA 1PE0A 3Q7PA 3KAQA 4I4IA 3SVZA 3UIEA 2HWXA 5K6RA 3G88A 1DQSA 1BOOA 4J2OA 2IXTA 4LC9A 3MPUA 2QPAA 4OXNA 1B0AA 2RIRA 4CRWB 4YDQA 2QI9F 2XCTB 1O96A 3CCBA 4BKQA 4RWZA 1K5HA 1ORIA 4P1ZA 4LK2A 4Z8XA 1TIKA 3T3GA 3K2IA 3EGDA 5HKAA 1ES9A 3LXRA 3L8CA 4AL4A 1HLGA 1WQ4A 4CLEA 4M4SA 1RC8A 4CLDA 3GZJA 4MTLA 1YB2A 1EINA 5C37A 4P0QB 4FKMA 4HB4A 1VJTA 2JFOA 5DM70 3L7OA 2XF8A 4C6TB 4LNHA 5K3FB 4FPXA 4KO1S 3AKYA 1U2EA 1IHOA 2PPLA 4TWIA 3V8MA 4DSAA 2C7QA 3LTNC 4N8EA 1QMGA 1DAIA 5IDYA 2C57A 1E4OA 2A4KA 4TVBA 1TO6A 4KDFA 1W46A 2NVUB 1SG0A 2Q8QA 3BKWA 1LWOA 1P2FA 1YT5A 3FCOA 4M1QA 2WTAA 2FUG1 3BXEA 2PX3A 3MZ0A 5ILOA 1TEHA 2PBRA 1XTRA 2OCGA 3KJGA 4DV3B 3KDPA 3BZUA 1M5UA 1Q2XA 5FEUA 2DCMA 3LDAA 1LGYA 4YP6A 4JI1B 3UOWA 2FVXA 1G8SA 1NMZA 3UWMA 3T3MB 4CTNA 5JY6A 4ARSA 3ZVNA 1WP4A 4YAIA 1W1WA 2GQ0A 3CUSA 4X7PA 1DKOA 4PLCA 5D86A 4F85A 2DUWA 3WJ1A 4ATNA 1B23P 3C3DA 5DTJA 2CUNA 2YWDA 3ZU6A 4I9GA 3U81A 2IEGA 1GPAA 3IMCA 4BXOA 1CERA 1M2VB 1PP4A 1YKGA 3M6LA 1YS7A 2XGOA 2VDKB 1JNXX 3MT7A 4MARA 1IEWA 1E1YA 3COVA 4FHZA 5DEOA 4I8DA 1E9AA 2CNOA 3KLOA 4EVIA 2VJAA 3W4JA 1ETHA 4ZO7A 3OVMA 1Z7BA 2GCNA 3K05A 5JD3A 3X1YA 2X8AA 5I4BA 1A2QA 5KVAA 2HI0A 3GDOA 4NJMA 3RF7A 3SBDA 5LQCA 3B89A 4QEZA 3AFGA 5ED4A 4DB2A 1DAOA 3AV0B 3PFGA 6REQA 1AQIA 2LCFA 3ORHA 3MRSA 1WZIA 2CJWA 4MRNA 4PHHA 4TTPA 4J1TA 2B5WA 1F2TA 3K6JA 2ZRLA 1NC1A 1OXMA 5ADHA 4YBRA 4NP6A 4B3IA 5J4YA 3IDAA 1FIUA 2G82A 2BSXA 2J33A 1OZ0A 1FFAA 3DJYA 3QUAA 1IBRA 1K2VN 3KPUA 5KJFA 3OZWA 3I52A 3K4HA 4P34A 1XMXA 4ZZ1A 3E7PA 3OPVA 4OSOA 4DMUB 1VFPA 4PM4A 4XD2A 2XPCA 1Y6ZA 4F56A 1ZCBA 2Y1FA 1PNOA 3AR6A 3BXZA 1Z2DA 2WF8A 2RJOA 1XROA 3BK1A 3Q4GA 4UCFA 4JQZA 1D8TA 3ASZA 4J1NA 3H9EO 2HREA 3A05A 1V3QE 1JLHA 4LVCA 4CGYA 3UTCA 2ZJ1A 1FFDA 1KZ4A 2NO5A 2X77A 4QPCA 1OMOA 1G4HA 1H3NA 4ND8B 1YC5A 1WD7A 4CMIA 3CG0A 3GFTA 1E89A 5TQJA 1GIAA 1CVRA 3LLMA 1CZOA 4F5WA 5AVSA 1J1ZA 2H5LA 3GRRA 4LZOA 2C92A 3U4DA 4BX3A 3AF5A 1JJIA 2ZE5A 3A3NA 2OK8A 1PCXA 4GECA 3AY7A 4AN0A 4B3XA 1NUTA 4PAQA 2CXHA 3BFPA 1NVUQ 3U4QA 3JD1A 4C7XA 1YRBA 3AH8A 4EB3A 2W00A 4LOLA 4BVAA 4NJOA 4QWMA 2J3KA 5CLFA 3DUWA 1LV8A 1NJGA 2AWNA 2H2FA 4I4NA 4UBNA 1FYFA 3HI6A 2V7XA 3FYHA 1OV6A 3MQFA 5DW0A 3TSOA 3IAS1 3HWSA 1GG5A 5KSOA 3CVOA 3NORA 3T9CA 1GSOA 4MWOA 4XOUA 4TLBA 3ZHBA 5DM1A 2EQBA 3OH8A 5ILGA 2PG3A 1VKNA 1AHNA 3T9DA 3PA6A 4UAJA 2R62A 1P5JA 2GJAA 2PUTA 4YUYA 2OV6A 4TLCA 3LT0A 1JILA 1WSWA 1Y6RA 4Q3CA 3ZWMA 1PW5A 4DXAA 3E23A 3FLMA 4PCUA 8ABPA 1YR6A 4A0SA 2ZYWX 1UEXC 3O8CA 3FNRA 2PLRA 1EG7A 1S2NA 2YICA 2C3PA 1PT7A 3DOHA 2W70A 4JBNA 4A0FA 1OH8A 4GYJA 3VXKA 1Y7LA 3QVVA 1KYTA 4R0MA 4PWYA 3PJRA 5JQGA 5B57C 3GJZA 4RHEA 3KD2A 3ZC3A 4FR2A 4COOA 3UCXA 4MQ5A 1QTNA 3HP1A 1AHPA 4WEOA 4BWYA 1CQWA 1PJCA 2Y68A 4DBLE 1JQBA 2I87A 4OQZA 4BNWA 4AIIA 5AHRA 3AESA 1W36B 1D0SA 4RADA 1L5GB 3F8TA 4OMUA 3ROKA 2EBWA 2JA1A 3AMVA 4JI8B 4RLFA 3FSRA 1HY3A 4K9PA 4FW8A 5F2KA 3MA0A 2JLUA 1KKUA 2J09A 1R5BA 1FFSA 1XA4A 2WZBA 2P77A 1N1MA 4HGYA 1BDMA 5J23A 1DFHA 2XAAA 3EVTA 1G5PA 2H16A 3KWJA 3N8KA 3TQRA 5BT8A 4OGLA 2BOVA 3QRWA 3JTMA 2IS2A 2DERA 4DMFA 2PR7A 4OBBA 2FYTA 1EE2A 4ANFA 5L3SA 1ZGJA 4WN9B 1I0LA 3GFVA 1QE5A 5KDLA 1EGQA 5LQJA 1MAAA 1EM8A 1J1UA 2DHDA 3GUUA 3WYFA 1DHRA 2E4UA 3VOSA 1C7EA 1MN6A 1C0IA 3SVLA 4D43A 4WZBA 3WKEA 1Y8RA 1KAMA 1LJUA 2R3SA 4FCCA 5HF6A 3WHPA 9GPBA 1JL3A 3C6ZA 5ICEA 1YA6A 4HWPA 4DQDA 1U7DA 4U2KA 1ZUWA 2A0UA 3SS8A 3VAAA 1T5OA 2EVWX 1SZCA 1UC9A 2WFLA 4WOKA 3WRXC 1LJLA 4K8OA 1FLVA 3BMQB 3DOFA 5B3JC 5K8IA 4HRAA 3PE3A 3D6NB 3TMAA 3DAOA 3P9CA 4A0GA 1K5PA 5KYUA 1B93A 1XA3A 3SBOA 5C53B 4M8NE 2DC1A 4JLSA 1NYLA 3H2GA 3HFJA 4ZQEA 4JJIA 4BFTA 3M5WA 3N5KA 2H4XA 4XVCA 2HOQA 4XKJA 3ZBTA 4KPUA 3KEFA 2J0VA 1MEJA 4M9RA 2Q7XA 1OGYA 1VKOA 3R5KA 4DDUA 5KNCD 1OVGA 4D4KA 1C1XA 5K3DA 3DR3A 3LUGA 4MRMA 5JMTA 1JA1A 5DIFA 3PDIB 3TPFA 5C8XA 2RHDA 1K7SN 5KOHB 2FRXA 3K6RA 1CJTC 2WPDA 4ZOQI 2QMQA 3GT4A 2D5CA 2BJWA 1P91A 3TEJA 5CB4F 4XGIA 4OD0A 1P7WA 3ZGYA 5ITWA 2JDID 3IUSA 1AA6A 2WTMA 4DV2B 1B42A 4DC9A 2C7BA 2X1VA 1G6HA 3CRZA 4B33A 2LIPA 1Q20A 1JH8A 3Q3IA 1NM5C 2FZ5A 2FR8A 2JIQA 4AJ9A 1EVZA 2CHQA 3NHRA 1QIDA 2O2EA 3ZX5A 1KDVA 4KL8S 2XTNA 4GSLA 4L0DA 4M1YA 1V8PA 1AE1A 2PD3A 1H85A 1YCHA 4Y7DA 2EJUA 4E0BA 2J59A 3ABSB 4UZEA 5ETJA 2PPVA 1ZVQA 3DDCA 2H7CA 2VP3A 4UM9D 2NP6A 1PEAA 4F8YA 2D00A 1L3IA 2ZB8A 1MRZA 1YFZA 1Z35A 3OOSA 2JB9A 4HWOA 4OHFA 1KI6B 3BQMB 4NCJA 3S1SA 1AO0A 2GSWA 1RRKA 1PX2A 1HM5A 2EBHX 3GJQA 3NHKA 1NN0A 4HGNA 1LRJA 3TVYA 1U1IA 1Z15A 3AR2A 3CURA 1ZJWA 4ZAFA 2I2AA 2HW8A 3M7IA 1JR3A 5ICGA 3E22A 2ZETA 2IHNA 1UWKA 2PX0A 1TRHA 4XFKA 1JVSA 2YYYA 3IP7A 5I47A 2AN4A 2XR1A 3ZWCA 1XAGA 2RH5A 1MDBA 1RHUA 3OX2A 2GNAA 3PTZA 5DHSA 5KSYA 2X7HA 4QJ5A 3THWB 1Y3DE 5B12A 3PPYA 2D5LA 4IO0A 3PR1A 2WSMA 3D6HA 2WSSD 3DLHA 4GD3Q 1Z4IA 3LM8A 3VR6D 3FCYA 5BPHA 2IPAB 5LIRA 2P69A 2IHZA 3PYXA 2IIBA 4CIAA 3HH8A 3E9QA 3EDCA 1C9JA 1NI4A 4P36A 2XAUA 1BXZA 1E7MA 5JYBA 3GCXA 3K9WA 5D6OA 4AQYB 4BOYA 1HQYE 1NW5A 1F0PA 1SK8A 2I54A 2ZRJA 2AN3A 4WDQA 5THXA 2FJ0A 1UJ2A 1PIWA 4KLAA 2REBA 4XX1A 5EP2A 4C4OA 3TXYA 2R8YA 4Q66C 5EJ5A 2OBXA 2B99A 5F2OA 1CCWA 1GLNA 2W2KB 2ZZMA 2JH3A 1ECFA 3K1YA 1Z07A 1XU4A 2Y6VA 2ZG6A 3K4PA 1XTJA 4UUNA 3B6MA 2JHFA 2BI7A 2W98A 5TLSA 3B60A 3Q0IA 1PYDA 5JT1A 3HKCA 5JZBA 3D7RA 1OIVA 1NW7A 4FFSA 4V0LA 4JU8A 3D4BA 3WNZA 3D64A 2QMHA 4FEEA 2E87A 1DKRA 4JYBA 1NXTA 1QAOA 4FN4A 4YDRA 1M1NA 2F3TA 2P1ZA 4KN9S 5KCZA 2VZLA 3E3LA 2A9FA 3DMGA 1VG9B 2AB0A 1QCCA 1PHRA 4ZVKA 5BURA 2WWFA 4LG1A 4EIWA 1JHAA 1ZOPA 3CH5A 3WADA 3X0DA 4RK4A 3FWZA 3ZY6A 2WICA 1VMDA 4O1MA 4DBVO 2CL5A 1NDQA 4HAIA 4LHYA 4AFNA 3JAMA 5IDWA 4LJ7A 3A1VA 3CISA 1RKXA 3VKFA 4Q5IA 4B3SB 2QRJA 1F0KA 4QNRA 4RY8A 4J0JA 5JJ5A 2R85A 3B6KA 1J0BA 2ETVA 2MYNA 3CGWA 3OE5A 4RNCA 1N4DA 3P9RA 2GAOA 3QUQA 4FDUA 3WGJA 5KTNA 1TUIA 2GZ3A 1XZBA 1BJTA 2YV4A 3DMYA 4JB2A 3KYBA 1WBBA 2CYCA 3LYHA 3OLQA 1UZMA 1E1RD 2P6UA 4WZ6A 1KI3A 1DUSA 3OM9A 4OL9A 3NRBA 1JFLA 4PGHA 4AJEA 3PDUA 1ST3A 3CUYA 1E1MA 2ID4A 1KI7A 3MCUA 4OYRA 4CE6A 5H5JA 3UAOA 4G1VA 4LF6B 5CXXA 3GLRA 2YWHA 3OZ7A 1EUCA 2V8OA 1QTIA 1LSJA 2ZAIA 3ROZA 3RODA 5TPZA 4TV8F 2JLZA 4OX9Y 1F06A 1XDSA 1SUAA 2KLHA 4ZKEA 1HETA 3D3KA 3IO3A 4LISA 2OFFA 3ZV6A 5JPDA 3B85A 5JY1A 2JLYA 3DTYA 3S1AB 2PH3A 4ENSA 5HQTA 2XNDA 1IZYA 4TMVA 3DE0X 1KEUA 2PWPA 3HBJA 3LWNA 3SFZA 3ZJVA 2RAPA 2ONCA 5G0UA 4Q4AA 3CPHA 3G0DA 2I03A 4BX2A 4HEA1 4DLNA 4MKGA 1YJQA 4X3CA 5I9TA 3NR2A 3CTMA 5H9VA 5IK2A 4RBNA 3TPZA 2F55A 2CVOA 1H42A 1FUIA 2UZ3A 4REMA 4YUZA 1L8XA 4ZVUA 2W6OA 4F4JA 4P58A 1I2BA 5ICSA 2EFCB 2VHYA 1TAGA 2QP4A 3MYRA 3JAWB 2BUAA 2OGUA 4GT1A 1TQ4A 4TMWA 1I9CA 4KUHA 4DAOA 4Z5XA 1U7ZA 4CM4B 1M5RA 3KV1A 2ODWA 4UU1A 3SE0A 1Z6ZA 2OVFA 3IIIA 5ENVA 3DTVA 1O6CA 1WXXA 1PWEA 1X14A 4OQYA 2RKWA 5CTAA 5K3SA 1YIAA 3O8BA 1OX4B 1NN5A 3AY0A 3LCCA 5F73A 1IM2A 1E3SA 1MZVA 2HK9A 3A9UA 3EEYA 3LHKA 3N0RA 3O6VA 5F9HA 2CCJA 4YMVA 1FX0B 1Z82A 5A4FS 2PQ2A 2OBYA 1BHQ1 3EWAA 4Y9RA 1JHRA 3WFIA 1NONA 2IY7A 2TS1A 3JVUA 1L4HA 2ONZA 3N3AC 4IIJF 1T8UA 4N01A 1M8KA 2WTNA 4ZYWA 3K9HA 3DAFA 4CLRA 1T91A 2IE0A 3I9FA 4C0WA 2VP5A 1GZ4A 3KEOA 4MUHA 5KC9A 2A35A 1C3XA 1MC5A 5KTKA 1M2OB 2M6SA 1IJFA 3DGFC 1TQDA 3R5SA 1LK5A 3DKVA 2WJWA 1GJRA 3MPOA 4GWKA 2W37A 5FV7A 4D44A 1FDIA 3R9XB 4TTVA 3A11A 3MAGA 1VYTA 1Y8QB 1Z06A 3B9PA 2FV8A 1SBIA 3I6BA 4NK5A 1RQLA 2I4OA 3WDSA 3CMCO 1YDFA 3TTYA 4X20A 3LZDA 5CEFA 1MX9A 3BH0A 2JJMA 1ZUNB 1NQ5A 3OZVA 3ZWYA 3A70A 2PIDA 5A4KA 3VTZA 3ZNNA 4KXWA 3M0EA 3G7UA 3G49A 2BR5A 2Q8PA 1HNNA 4QPDA 5KDOA 2IGBA 1UOQA 5HTOA 2Y2VA 1ULAA 5F5LA 2PUBA 1TT5A 4RD2A 1BX3A 2R6HA 1SG6A 3P0RA 5HUJA 3LPDA 3VH3A 4AKIA 3VHLB 5AHWA 4WCFA 1QAMA 2I3BA 1J8FA 2R1TB 3HO6A 3B20A 3LUJA 3U4CA 5C2JB 4WVFA 2CVPA 1CUJA 1LKZA 2ZIWB 3GCGA 3E03A 2A6PA 2FEAA 4A27A 5BW4A 4KQXA 1XL1A 1SVKA 3B53X 4FCTA 1DO8A 1XDZA 2MSWA 3INTA 4LGCA 4QBGB 4ZGBA 4CF5A 4JXZA 4KOAA 1VPWA 1JGTA 2EAUA 2EKPA 1XD8A 1XKTA 3WGNA 4I2NA 1GFSA 2Q6VA 3GWZA 1JDVA 4Q24A 3OC6A 3HBAA 5L3QA 1BKDR 1SH7A 1R0BA 5K2MA 1HTTA 3LVRE 4ETMA 3FI9A 5HKKA 1ENPA 1GPDG 1BXRB 1I0ZA 1HTWA 3HN2A 4XASA 1E3JA 3FJOA 3U3OA 3UMRA 3WY9A 2PZLA 4FIDA 1K27A 4X5OA 1E66A 5AFSA 1PNTA 2QN1A 4MGZR 4YCMA 1MF7A 4FS8A 4JJ8A 2WV7A 1E98A 2FK8A 3A9CA 1ZK3A 4F3CA 4JC8A 4GL2A 1ICEA 5DM4A 3W3ZB 3DNFA 5K3CA 1XNHA 2R44A 3I64A 1VLJA 2C2KA 5E1BA 1ND6A 1G66A 3L7YA 1NW8A 2GO7A 2G67A 2NPIA 4D9EA 2W2NA 4DT1B 3VJMA 4XRRA 3B3GA 4QNMA 2E5WA 4IY1A 9ABPA 4YRPA 3EDRA 2XMDA 3BXGA 3OQIA 1JBQA 5JJIA 5E6RB 3MW8A 4D99A 3IEKA 4PGGA 2BF4A 3PKIA 1U1DA 3U0VA 4DJEC 1K1EA 3MLAA 5KZMB 1ZL0A 1YONA 1ZGCA 2OORA 2FPIA 2VA8A 3H0KA 1JAXA 2F4VB 4PYOA 3CO0S 4FMCF 1PSDA 1ACLA 2EZ4A 5U4XA 3RRJA 2FPKA 1IUNA 1M0SA 2GN8A 2HZBA 3L06A 5JXGA 3ELWA 1UAYA 3K92A 1R4MB 3WHIA 3J81A 4I9HA 2XNCA 1YE8A 3I12A 2HPHA 3NW9A 5CJPA 3IDSA 4N03A 4BV9A 1UMDB 4HLQB 4ZAYA 1FTSA 1CS0A 1QK4A 3PUJA 3DOCA 4QLBA 1V16A 3I5MA 4GMFA 1T4CB 5MFPA 1YR9A 4R1MA 6Q21A 4IQ4A 1MJNA 1ODTC 1U8CB 3NRCA 4LQDA 5LXTB 1M2HA 4N65A 1FTYA 4BQOA 4ZYXA 3I1IA 4J7XA 3PWSA 3DFFA 4KRYA 1Z8HA 5AI4A 2WJVA 1SA0A 5FPQA 1EXNA 2YWXA 1N2CA 3RIEA 3NRJA 2XQFA 5ALHA 5HCNA 4OFWA 3V1LA 3WBFA 1XZ8A 5FB3A 1PKEA 3K8ZA 4FUQA 2BFMA 2FLVA 2ZWOA 4LJAA 3P0HA 2IIVA 2GILA 2NUPB 1SVMA 4JBIA 3O3OB 4EHAA 3PC6A 2E55A 3IPXA 4R40A 1GPLA 1OWPA 5ES3A 4LJ5A 2ZRMA 2HM7A 2VXYA 3DBIA 3FAKA 1NN3A 2AN1A 2OPBA 3EEOA 2V7EA 1I3KA 1TZMA 4WK0B 1XXLA 4HNAA 2O1SA 3CKKA 2FFAA 2HJGA 1WCWA 5C34B 3IB6A 4EA9A 4FGUA 1KOGA 2IOHA 4PLVA 1EXMA 2V55B 2B1GA 3T3NA 4ZO8A 4C7BA 3A14A 1NJ2A 3EHEA 4LRYA 5J3JA 5T4HA 4FCWA 4RELA 4IX9A 2ROQA 1GVHA 4K86A 4TYMA 3SJUA 2QMZA 4ZQCB 1S89A 5KAPA 1NI3A 3ZDZB 5JW6A 1FXWA 1IBLB 1Z2EA 1P2BA 1RI3A 1AURA 1LFDB 2PA0A 4A5SA 5IVKA 2Q6OA 1OXBB 2ENWA 1MC8A 4V0KA 4IJUA 2JBWA 2W6CX 2YX1A 4DR5B 2QSZA 5HM8A 3WGYA 1KO1A 3RTAA 3STWA 3VDQA 3PNLA 1V6CA 1E63A 3AVYA 1I7LA 2CSUA 3B70A 3AB7A 1LBSA 3DD1A 3ETGA 3LOUA 4OK3A 4OB8A 3PHCA 3CNLA 3GU3A 3GK3A 3AVVA 2EWWA 1USKA 3MS4A 3HU3A 2A8YA 2AOTA 2FNAA 2GHRA 2JJQA 1LBIA 2D7JA 3RIGA 2DBRA 4LZZA 1XMVA 2HIMA 3W1WA 3S29A 2VS1A 2H1WA 3UW1A 1IXYA 1IUPA 2D5BA 5AI8A 1K92A 4E5VA 1PZGA 4YJ3B 2G7MC 3K1AB 4YJ2A 2JLCA 2V0NA 4AJKA 5D84A 3SFVA 4RNDB 5LQNA 3EPLA 5HUQA 1WL8A 5KYTA 2OQIA 1KO4A 5AI5A 2OHOA 3RAGA 5ELXA 2B4RO 3BSWA 4KRFA 5AKZA 4A7PA 3HYSA 2N47A 3PI7A 4KXNA 1PS8A 3IIKA 1B3BA 4WLOA 3W8RA 4DMRA 1UK9A 3E5HA 4MVXA 5BT9A 3HM9A 7REQB 1J7KA 3MJSA 3KU1A 1RBQA 2BZ0A 2MOKA 2VK4A 1GCIA 3I92A 3KZVA 5IW8A 1M8JA 4NS4A 2GXUA 3L0OA 1QPZA 3AERA 1KFCB 2I33A 3O94A 2GKSA 4CF3A 5PNTA 4W8HA 3AR5A 3KQPA 3M2TA 4GGMX 3ZQ4A 3GRCA 4M87A 2RCNA 4FJ1A 4M38A 3HG7A 3R6GA 4Z1MA 1ONPA 5EJ9A 2Q6TA 4HFJA 4PPNA 1CUYA 4FLEA 1J9ZA 1VLLA 2A84A 4O4JA 2X9LA 2WJPA 3DB1A 3STUA 4B3JA 1Z0JA 4MA4A 1E79D 1IBKB 5HIMA 1ILWA 3H6KA 5JTTA 1R8SA 1C3OB 1T3GA 4ZMRA 2W58A 3BE5A 3QBVA 5ECGC 4OLAA 4HLUC 4TQUS 4J91A 3R75A 4OCZA 3AZPA 1WQ1R 5FT9A 2BEUB 3Q9NA 2V54A 3QE0A 4UCXA 3NNDA 4YQEA 4ZDIA 5REQA 3OJFA 4CQLA 3KQNA 3VZSA 4H17A 1TJ5A 4CMHA 1J07A 4G8JA 4E15A 1IN1A 3G0HA 1RMQA 2OFPA 4DLWA 1MU0A 5EJ8A 4V0MA 4YO8A 1DPGA 3AUKA 4RHYA 2CEKA 5IJ9B 2BKUA 3GV0A 1K9VF 1P9WA 3HDTA 4QULA 1KJQA 2WUDA 3HLTA 1A2OA 1ZM9A 4LE2A 4JBWA 4U5XA 2BZ1A 1DKMA 2VCHA 1RYZA 2Y05A 4GPBA 4JJGA 5AJVB 5F78A 1MXHA 3DUFA 4RPLA 5JASA 1X7ZB 3EIOA 2ACWA 4IGAA 2OXRA 1F5NA 2XT6A 1BEEA 4GXQA 3Q72A 1QG4A 3KEQA 3JALA 2PZKA 1H65A 3DYVA 4LY6A 1NW3A 1T0UA 3GDFA 3PBKA 4INAA 4ISBA 1QG6A 3ZNPA 1ZZGA 4EY3A 1Y33E 5JROA 1FUYB 1DP4A 1LLDA 4KGZA 4Q9NA 1OHHD 5AJUA 5DGDA 4ZALA 1UMCA 5KYGA 1F3LA 1E9SA 2P78A 5DCYA 1QH0A 1ZP6A 4JHXA 1GCGA 1B0PA 1BN7A 4O4LF 2R8OA 4GX0A 2JASA 4N6OA 1ZEJA 3MQ2A 2Q3LA 3O91A 5K3EA 3RTGA 1A5SB 3WK9A 4LJ4A 1HRDA 2Z3WA 5J40A 4R31A 4CEHB 3OMLA 4PRYA 3ELDA 4RFSA 1ZR4A 1U0RA 1Q57A 1DZIA 1QQTA 2BFEB 1BH2A 1UKCA 2D62A 3HB4X 4J3FA 4W7HA 5KYVA 2O07A 3NYIA 3WKCA 4CMGA 4EMSA 3AR9A 2ZT6A 4QU8A 4D9JA 4WBNB 2F67A 5JZMA 2ST1A 4WNAB 3NWJA 5AYVA 4R69A 4ZDJA 1XXHA 4FW9A 2B7CA 2Q0SA 5I7EA 3UQYS 1JT9A 3GT7A 4LYYA 1FYVA 2Y99A 4Y6RA 4OH1A 3K6KA 2RHTA 1E8MA 1ZD8A 2ZQ5A 4Z8YA 2ECKA 4DIUA 2XKJE 1E5QA 1V8DA 1LBQA 3KAJA 5AIBA 1JFFB 3GYBA 3ZWPA 1RM4A 1Z0ZA 5J59A 3SEFA 3T9EA 3TDMA 5BWOA 1BX1A 3IE2A 5CGQB 3DE2X 3C3BA 4U02A 1NTOA 5DHPA 3BA6A 3JQ7A 1TF5A 4MULA 4W9NC 1BWPA 1TZJA 4LW8A 4CL8A 4D5EA 4BPBA 1EESA 3FYDA 2CNBA 2XXJA 3DMNA 3N86A 5EIBD 3L8DA 1E1LA 2Q5QA 1RSZA 2G0AA 4JT9A 3T9BA 5C3MA 2GA9A 2WP8J 3ZGOA 1JTEA 2FEXA 2BE7A 3ZKWB 3VZBA 4LCEA 2MMCA 1VPLA 1KGDA 2LIVA 4UDOA 1JDUA 5C7LO 4G0UA 4L5BA 2D1TA 4L15A 1LTKA 5DX0A 3R0JA 2BSQA 1J2UA 1CJCA 1OCEA 3WLQA 3L6DA 2ZK7A 3TLZA 3W5UA 4CQMA 3ZW8A 2OWEA 3SR3A 4BQSA 5KINB 1B16A 2YXDA 4XUEA 3GIWA 3EH1A 4EQ6B 3OQHA 2P2DA 4POOA 2ZSIA 1EB8A 1OF1A 3K5WA 5BOSB 2JAWA 3F2IA 2I76A 1JQEA 3GQBB 5IFKA 3O8NA 4JCCA 5AVOA 3U7JA 1ZM2A 1X70A 4ESEA 4TQ9A 2IYVA 5E4JA 3VO2A 4DZZA 4WADA 2DWPA 4FFMA 5LPNA 4AY6A 4D96A 1Q12A 3CS3A 4KO2S 3SHTA 4IJKA 4BLSA 2Z8YM 2RH4A 4UEWA 5E38A 5FUXA 4UU7A 1JYSA 1ISGA 3OU2A 3TFOA 1QLWA 4WA8A 4R2HA 1PR2A 3SS7X 1GQ2A 1KA9H 1WW8A 1XTPA 1QDLB 2O8FB 4YI3A 2IF2A 2OXFA 4NG4A 4HB2A 1ACJA 1DIRA 4RF2A 1D2NA 2X14A 3DBRB 5FPYA 3O2NA 3VH4A 1FP2A 2B83A 3BTUA 3R44A 4I6JA 3WO1A 1H2EA 3SJBA 1MRSA 3AO0B 3D54D 4J76A 3KZXA 1PK7A 1J99A 1UQUA 2QIOA 3GPBA 4GOXA 1YBAA 5J5AA