3FYUB

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
318
structure length
317
Chain Sequence
b'MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
molecule tags Hydrolase
source organism Bacillus pumilus
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
total genus 119
structure length 317
sequence length 318
chains with identical sequence D, H
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuB00
3NGMA 4QDOA 1LPBB 1R88A 1ACJA 2JIDA 3C8DA 5AK5A 5CMLA 3MVEA 3H2KA 4C01A 4B85A 1GPKA 1VXOA 2OCGA 2YXPX 4FFWA 3A70A 4B9AA 3IDAA 5IVKA 5ALLA 5JYCA 2C0PA 4UHBA 2PSJA 1E8NA 1XZCA 2XMSA 2QM0A 2QZPA 2ZJFA 3R3WA 4A16A 4YPVA 1GQSA 3I1IA 4QA9A 3IB3A 4FFVA 4U2BA 4B0PA 5ALNA 3C6XA 3R3VA 3R41A 1N5MA 1DQZA 5DWDA 4RNCA 4J03A 5ALMA 4AX4A 4PNZA 3SX4A 3R3ZA 2RIPA 4INZA 2XMCA 3TJMA 1MU0A 4J0IA 2O2GA 4Q3LA 2E3JA 4BATA 5JADA 4W1PA 4QZVA 3IUNA 5LKAA 2PSFA 3BIXA 2WG0A 5ALKA 3T4UA 3LIIA 3BIWA 1T2NA 5HF9A 5HK9A 2W6CX 1E8DA 3D2AA 4TVKA 2BAGA 5ALWA 5YASA 1BCSA 4UUQA 1GKLA 5I7UA 1XZKA 2BUCA 4X3CA 1BN6A 1C4XA 1VXRA 4PW0A 3WKCA 3MUOA 3NUZA 1VE7A 1CUXA 3I6YA 3ED1A 1ZIYA 1BN7A 5DNVA 2PPLA 4BC1A 5HF6A 3QPDA 1XFDA 1ZIXA 1GPNA 3JW8A 5EFZA 1XQXA 2RHTA 4EA6A 4AO7A 3WL6A 5AI6A 2CB9A 4P93A 1XQVA 2Y2UA 4U2FA 4UHHA 1HQDA 4AQDA 1L7RA 5ALDA 5DLPA 2FJPA 2VAXA 1GPLA 2DHDA 5E4YA 3FYUC 2GYUA 2AXEA 5AI5A 3DOIA 2WHQA 4N5IX 1YA4A 4KE7A 3L1IA 2Q0XA 4OPMA 1QLWA 4GEGA 4XIIA 3U1TA 3WKAA 2H7YA 4X85A 1BEZA 4C88A 5BWCA 2XUGA 5CH8A 1VJ5A 3O9MA 5I8PA 5DJ5A 1C7IA 3BF7A 4I19A 2XLBA 2CBGA 4X6XA 4DMCA 4KE8A 2HA5A 3CN7A 4ARBA 1BEEA 4EY8A 1LPMA 2HL6A 2D5LA 4K2AA 5AM4A 1BCRA 4FNMA 1J1IA 4Y7DA 4NZZA 3HSSA 4G9GA 4QE3A 2DQZA 1XZMA 4B81A 4LYEA 1XZDA 1IMJA 3HEAA 1LPNA 5HF5A 1K5PA 1XZLA 3B5EA 3WI7A 1K8QA 4UPDA 3DOHA 1EVQA 1N5RA 1EXWA 1YB7A 5IVHA 2Z3ZA 4FBMA 2WIKA 5JASA 1SCIA 1QIHA 2JBWA 4UFOA 5C8VA 5JIBA 3I2KA 4W1SA 3C6YA 3O4HA 2HRQA 3BDVA 3FVTA 2QUBA 1AGYA 1ODTC 4U2EA 4DLNA 3OURA 4FKBA 2IX9A 3G0GA 2OCKA 1CQWA 3AIMA 4Y2RA 4FLEA 4C89A 4AZ0A 1QIDA 5AI0A 4BCBA 1XRNA 4BRZA 3H2JA 2Y6UA 3O95A 3EQ7A 3FAKA 1FFBA 5LYYA 1JJFA 5EHNA 1G66A 1QONA 1Y7HA 1WPRA 1ZI6A 1H2YA 4RPCA 1QGED 2FX5A 1JJIA 3B12A 4QWMA 3DYVA 1QIMA 2GZRA 3PUHA 4LHEA 3D5EA 5CXUA 2ZYHA 1AKNA 1R3DA 2VT6A 4NMWA 1VE6A 2PBLA 1UZAA 2RAUA 3O9VA 1DX6A 2X76A 3QMVA 2DHCA 4QDXA 4W1RA 5T4EA 1CUUA 3KWFA 4MWTA 5ESRA 4X7BA 3D4LA 3IURA 3S8YA 1CUAA 2WFMA 3M3DA 4QDZA 3QPCA 2WJ3A 4HXGA 4EBBA 3OPMA 1UOOA 1AQLA 2OLEA 2XUIA 1HL7A 1EK2A 2DR0A 3VXKA 1CV2A 3EF3A 2RI6A 2WFZA 4MYDA 2YYSA 4H7IA 2WUFA 1R4ZA 2GBCA 2XUQA 5FXMA 4OYYA 3ICVA 2OXEA 3K2IA 4MYSA 4BVLA 5KBYA 3QYJA 1P0QA 2QRUA 1D07A 3TRDA 1ZD2P 4WFJA 5LKRA 4UFPA 1CLEA 3I2FA 5D7BA 4GW3A 5C81A 2XB6A 1JU4A 4XX1A 3R40A 4BAZA 3QITA 4G4IA 4JUIA 4KAJA 5A7HA 1TIBA 4GECA 4WFIA 3WWEA 4BTLA 4WJLA 1UK9A 4UHFA 3RKSA 5ALHA 2WIDA 2ONCA 2I3ZA 3I6ZA 3STTA 1YS2X 2XMQA 5K3AA 5FLKA 4BP8A 5ALJA 2IITA 1JI3A 2BKLA 5CBKA 2CKMA 1K4YA 1L7QA 4K6KA 4BE4A 2WIJA 3JYHA 5EI5A 1EHYA 4P9NA 4W9RA 2BGNA 1QTRA 5HCUA 4AMZA 3EBLA 2WG2A 2QJWA 2QOEA 5JZBA 4G4GA 4G4JA 4N8SA 1A8QA 1W4LA 2Y2VA 2W22A 1R1DA 2HHAA 4OSEA 1ZD5A 2J4CA 5FKJA 5EIEA 3UUFA 1I6WA 3AUKA 3A6ZA 1H2XA 2XUPA 3RM3A 3BXPA 4QWWA 2WUEA 3C45A 2QXUA 4Q1VA 2LIPA 1WHTA 1ETHA 3ANTA 5HK8A 1MT3A 3FOBA 3Q0TA 1ZI8A 1VOTA 2J3QA 3MUNA 4DSAA 5AHXA 3IUJA 3PUIA 1MAAA 2XUFA 1IUOA 3H1AA 1ZICA 3LCRA 2Y6VA 1UKAA 4CIAA 1UT6A 2ZJ7A 1U4NA 4W63A 4H7FA 3WK6A 4FTWA 5E4TA 4X90A 5AKJA 3FLEA 3D2BA 3G0DA 5D6OA 4KE6A 3D7RA 5AKGA 1ZJ5A 1UOPA 4FWBA 4CG2A 3IUQA 4Z49A 1OILA 2B20A 4H35A 3OOSA 4Y9SA 2ORYA 5HQ3B 4GXNA 3GELA 4GWLA 4Q34A 1U8EA 3WK4A 2ZYIA 1MJ5A 1THGA 3VJKA 3H2GA 1MAHA 2WIFA 4HZGA 5ALFA 1P0PA 2PKYX 4HVTA 2EDAA 5AM1A 1ACLA 4B0OA 2J3DA 3L1JA 3D59A 3HJUA 5LZ9A 2XQJA 4ZWNA 5DTJA 3KXPA 3PFBA 2X5XA 1CUEA 1ZGBA 3RARA 2HA2A 1EINA 5FDFA 3WA6A 2BGRA 2XUHA 5ALZA 4UBNA 4DMKA 3VJMA 2PSHA 1N1MA 5FPQA 4W1QA 3HC7A 6YASA 5T4HA 3VJLA 5DNUA 3A2NA 5K5EA 3BF8A 3PE6A 3W06A 4MWSA 1CVLA 4OUKX 1WB4A 4KR0A 4P08A 2OG1A 4BVKA 1T4MA 1Q0ZA 4IH1A 3WKDA 5AOCA 2AJBA 4FMPA 4BE9A 1YCDA 1XZJA 3V9AA 3H2IA 4L0CA 4N5HX 4LYDA 5K3DA 1UKBA 1TK3A 2ECFA 2VSQA 2WILA 2XMGA 4C4ZA 4G1FA 3V1LA 2PX6A 3KDAA 2GBFA 2PM8A 5JAHA 3H1BA 4Y2PA 1LPPA 2I03A 4B83A 1H22A 4QNNA 2WM2A 1MX1A 3AINA 1AURA 4AO6A 1LPOA 4S0XA 1DINA 2VAVA 3G0BA 4U2CA 4C4YA 2OGZA 2QT9A 2B61A 2XQFA 3C87A 2G4LA 4UBLA 3O0DA 4HAIA 2BJHA 2GBIA 5AOBA 3STYA 5FRDA 3DL7A 2HA7A 4BYMA 5A62A 4RE6A 3G0CA 1KU0A 4J0DA 2QR5A 4F60A 5CT6A 2WHPB 1TCCA 3U0VA 3WK5A 4KYVA 1KEZA 2JF0A 2G5TA 3YASA 1GT6A 3SK0A 4DTCA 4PQEA 4J0KA 3C8HA 2QS9A 2WFLA 3DEAA 3OC0A 5ALOA 4M0MA 1PJAA 2C7BA 2ZJ6A 4XVCA 4DGQA 1WB6A 4WCVA 1LLFA 1XLVA 3WIOA 3G9XA 1F0PA 1EX9A 2H9YA 4ZREA 2OGSA 3QMMA 2XQKA 4FDMA 4QDUA 1BU8A 4MEBA 1AC5A 1XRLA 2PUHA 4E11A 1SOMA 5AO9A 2AJDA 5FV4A 5AM3A 4RE5A 3BWXA 4K6GA 2QVBA 5I9IA 1IVYA 1UK6A 3PFCA 1CUJA 3ZPXA 5ALPA 3WMRA 3H04A 2YH2A 2C0QA 3BE8A 5AKIA 4BTVA 3IVMA 5A7FA 2XQGA 2H7XA 3ILSA 5CURA 1JT2A 2ZYRA 5BV7A 2J4FA 1W75A 4FLMA 4H7HA 1BE0A 2HA4A 2AJCA 4H77A 5LZ7A 2DQYA 4A5SA 1IUNA 2Z8XA 2PSDA 5T4FA 1CUHA 5LZ5A 4EHBA 5JARA 1F6WA 5K3FA 2BCEA 4EY4A 3EIOA 2XUAA 3VDXA 4DMFA 4BRSA 3WL5A 1LBTA 1WHSA 1TRHA 1CRLA 2BFNA 2HU5A 4B6GA 4KJXA 1WPXA 3C6BA 4LXHA 4PSUA 1YB6A 1U2EA 3UUEA 3DYIA 4BDSA 5E2IA 4DMHA 2V97A 2B9VA 3CCBA 5HQ3A 1HBJA 2Z5GA 3WZLA 3H2HA 2HDWA 4WDQA 3VISA 1PFQA 4DM7A 2WTMA 1JMYA 1UKCA 2C5GA 2DFPA 4D9JA 4X71A 4J0JA 4EY5A 1YAHA 2HA3A 5LIPA 1XZIA 3HZOA 3VVMA 5AM5A 5DYYA 1CUYA 3I2IA 3F67A 1IZ7A 2ES4A 1CPYA 2OAGA 4YK7A 2VJBA 3FBWA 3DQZA 1EB9A 4NVRA 2WHRA 2PVSA 3E0XA 3EQ9A 3M81A 4JNCA 2HA6A 4OB6A 4Y2VA 3V1NA 5KREA 3R3XA 1VA5A 3SC2A 3WWCA 3PDCA 1FJ2A 5A6VA 4QLAA 5J3JA 1CR6A 3RK4A 4M0FA 2ZSIA 3V48A 4Q82A 4AN0A 5AI8A 3R3YA 4KAAA 3F96A 5H3HA 2XQIA 3B3QA 3H19A 5T4BA 5DTIA 4RGYA 1CUVA 2C4HA 1B6GA 3FSGD 2I78A 1QTIA 5AOAA 4BC0A 1QIGA 4EUSA 1EB8A 5SYMA 1JU3A 2G63A 4LIPD 4HS9A 2AJLI 2G5PA 5CW2A 2WJ4A 1EDDA 2HU8A 2XLCA 5ALSA 3WL7A 3VKFA 3W9BA 5CT4A 1GZ7A 3PF9A 5ALEA 1FFEA 1SFRA 1YR2A 5AI4A 4U2DA 2JGLA 1O6FA 1XZGA 1UK7A 4OYLA 3HACA 2VATA 3KWJA 1A7UA 3L1HA 1DWPA 4G8CA 5K3EA 1GGVA 3D2CA 3DNMA 5AKKA 1G4HA 1QIEA 2JGKA 1UK8A 1K6EA 2WQZA 4X00A 3HABA 1EDEA 2O2HA 4ZGBA 5K3BA 3CXUA 1ZJ4A 3FYTA 3G7NA 5ALQA 2CJPA 3NWOA 4Y2JA 1QFSA 4CI9A 5IKXA 2K2QB 3STWA 4UBOA 4F5ZA 5ALUA 1AMNA 3E3AA 3ZV7A 1FSSA 2VJCA 1UXOA 2JEZA 4BP9A 3QBJA 3KD2A 3QM1A 3C5VA 5ALVA 1E8MA 5IVDA 1XROA 1CFJA 3WK9A 2RGUA 1NX9A 3HYSA 3K6KA 4AMYA 3DLTA 2ZSHA 4V2IA 2JGMA 3QPAA 4Q3KA 4X94A 2ACEA 1TKRA 3A2LA 2JGIA 1WOMA 1QE3A 3D3NA 4UBJA 1UWCA 1GKKA 1LZLA 4ETWA 3R3UA 1KU6A 4Q05A 2UZ0A 3H17A 2WIGA 4LXGA 3FNBA 3HI4A 4FBLA 3KOOA 4GI1A 4ARAA 2XDWA 1E89A 2WUDA 3ESAA 3Q8WA 2PU5A 1N8SA 4TPKA 2ACKA 5AKYA 3E1GA 4HRXA 4DNPA 4GHWA 1THTA 3DKRA 1NU6A 3T52A 1Q0RA 3QMWA 5JAPA 1QIFA 2RHWA 4IHAA 2QTBA 1CUIA 4X6UA 3TGLA 5LP1A 3I2GA 1LBSA 1TQHA 4I4CA 1TCBA 4Y2UA 3BL8A 3M83A 1LPSA 3ZLTA 5JATA 4CG1A 3N0TA 1XLWA 4B84A 4OU4A 4F0JA 4OCZA 3STUA 5EIHA 3WKEA 3G9TA 2Z3WA 1SCKA 4UBKA 2JGJA 3DKKA 3I2HA 1LPAB 2VEOA 4YX9A 4G9EA 4ZI5A 3BJRA 1ORWA 2WKWA 2BUAA 4JEIA 4CCYA 4N8DA 2B4KA 3DJYA 4K5QA 2VJDA 2HFKA 3O4IA 1QJ4A 4J7AA 1G42A 5CTAA 1EH5A 4EB0A 5SYNA 4ITVA 5HKAA 4X97A 4MXDA 1DWOA 4J0HA 5LZ8A 1DTEA 1CUFA 4AO8A 5KWIA 4AB1A 1XQYA 4X92A 5JZSA 3AILA 3PF8A 4KEAA 3JWEA 4FHZA 1ZD4A 5JAUA 3AJAA 1EA5A 1WCYA 3AZPA 5AKEA 3GA7A 5CT8A 2YASA 5CT5A 5EIAA 1CIJA 1O6GA 4BCCA 5FOQA 1SCQA 1EVEA 1YSCA 3IBTA 1R50A 5JD6A 4L72A 3WK7A 3WYDA 1CUGA 3LLCA 3W05A 2Y1KA 5AH0A 2HRRA 4M0EA 1C7JA 4KRXA 1VLQA 3LS2A 2EDCA 3FLAA 1LGYA 4Q3OA 1G5FA 2WG1A 3BDIA 4UHCA 1J2EA 1B41A 1EDBA 2XUKA 1XRQA 4OU5A 4H7DA 3IUMA 4PSCA 1LZKA 5JD4A 5ALXA 1R9MA 1XRRA 2IIVA 1XZFA 4H7KA 4XJVA 4QLOA 3ANSA 1H2ZA 2WLSA 2QMQA 4CCYB 2P8SA 5IVIA 2XUDA 3STXA 5IH7A 4UBIA 2VA9A 5AIAA 2QJRA 1CEXA 4F21A 2PL5A 5AKHA 3K9BA 3FCXA 1W52X 2ZVDA 5F4ZA 5AKXA 1DQYA 5AK6A 1QIKA 3AIOA 3QZUA 4FOLA 4ZV9A 1XZEA 4KACA 4FLFA 5E4JA 1TAHA 3BJMA 4KRYA 2QXTA 3I6MA 4Y2SA 1P0IA 3N2ZB 5JZ9A 5K3CA 1XZHA 2XI4A 1H2WA 3H18A 2CEKA 2DSNA 3AZQA 5AICA 4P92A 1HLGA 2OCLA 1HKHA 4B82A 1CUWA 3C6ZA 2GYVA 4EY6A 3EQ8A 4IH4A 1MX9A 1YAJA 1WM1A 1RP1A 4E46A 5CT9A 2PU7A 4Y2QA 1CUZA 3ZLUA 1BROA 4BAGA 4C87A 1S8OA 3FYUB 5D3ZA 3WIBA 1XLUA 4BBZA 5AJHA 2GZSA 4OB7A 5K3FB 3C5WP 3LP5A 4A23A 5HZGA 4J0CA 4N8EA 5HFNA 4K6HA 1AX9A 4X91A 3WWDA 4X93A 4DNFA 1JJBA 4DYHA 3FLBA 1HDEA 1J06A 3F97A 1ZOIA 1OXMA 3ZLVA 2JGEA 4HRYA 5LZ4A 1HPLA 2OQVA 2O7VA 1XKTA 2HU7A 1A88A 1GQRA 1IZ8A 2I3DA 2CMFA 5CH3A 3ZI7A 3I1YA 1Y7IA 2VJAA 5EHQA 3AZOA 1QO9A 4J3JA 4MQMA 4XWGA 3QVMA 4J0GA 1UOQA 1DU4A 3F9CA 1VZ3A 4L9AA 1A8UA 4L3WA 4Y2YA 4G5XA 1DWQA 3CN9A 2V98A 1MN6A 2C5FA 2QKYA 2EEPA 3HXKA 1FFAA 4GDMA 2WUGA 3FYUA 4ZRDA 5DYWA 2WTNA 3F8SA 1P0MA 4IH9A 4JYMA 2HM7A 4MQLA 3VVLA 5LLSA 1VZ2A 2O7RA 3ICWA 2OCIA 4KE9A 1NU8A 1Z68A 3KSRA 3G02A 4DNOA 2CUTA 3G9UA 5CH5A 1Q83A 1SC9A 1X70A 4UFNA 4WFKA 4PV7A 4Y2TA 3ESBA 1DX4A 2FUKA 1XZAA 3WKBA 1JKMA 4O08A 4I3FA 2HA0A 3LIPA 2CZQA 1E66A 2XMBA 1TCAA 4ROTA 1MX5A 1FFCA 1BS9A 1MO2A 4MJ3A 4EZIA 3GZJA 1XQWA 3G0IA 2XE4A 4MEAA 3DL4A 3M82A 1X2EA 2VTVA 1GXSA 3W9UA 3GROA 1IUPA 4AZ3A 1DT5A 2HADA 1VA4A 1J07A 1CUDA 1YASA 2WU4A 3AFIA 4BCDA 4HXFB 2D0DA 3I28A 3GUUA 3V1KA 2O2IA 3IULA 3W2TA 4U2GA 1OCEA 3RLIA 3HRHA 4JH0A 4BDTA 4C6HA 5ISMA 4WY8A 3OG9A 4BZWA 4OD0A 3I2JA 1UFOA 1K63A 3NOXA 5A7GA 1CUBA 2XT0A 2PSEA 4CFSA 1F0NA 3A2MA 2GBGA 2HFJA 3WJ1A 2FJ0A 2DHEA 5AI9A 1W6RA 1CUSA 4LKOA 3V1MA 5AP9A 2BUBA 4Y2XA 2OAEA 1E5TA 4QDTA 4LXIA 5ALYA 1AUOA 1ZI9A 3X3HA 4B80A 5FPPA 5DNWA 3IIIA 4KAFA 3WJ2A 1L7AA 5HKBA 3G9ZA 2R8BA 5C8XA 3QH4A 3ESDA 1E3QA 1QO7A 4PSDA 4PF1A 2DCMA 3WZMA 2VQ6A 2WU3A 1QIJA 4BB0A 3WWPA 3ZWQA 5BOVA 1CQZA 3WYNA 3CCCA 2WSLA 5ALIA 3DD5A 5AIBA 5AKZA 1LNSA 4E14A 5A2GA 1ZGCA 4WDRA 1RYYA 4NS4A 4WY5A 3IA2A 5D3KA 3C70A 1USWA 1VKHA 2HIHA 1XZBA 1DT3A 2VT7A 4TGLA 3OTQA 1H23A 1W76A 2RONA 3HLKA 4UHDA 4CIBA 2R11A 1ISPA 1RWQA 5KWJA 1FFDA 4DNQA 2GYWA 4AXBA 3SWWA 3WA7A 5AK4A 1QFMA 5LZ2A 2Z8ZA 2X8BA 3O4JA 2V96A 1EK1A 4AN1A 4GLBA 1M33A 3WQHA 3S2ZA 5JALA 1EI9A 5EGNA 5FP0A 2OPHA 5FUMA 2H1IA 5ALRA 3W04A 1MTZA 4CG3A 2XMRA 1R9NA 1XKLA 3P2MA 4OB8A 1W1IA 5HFAA 3WL8A 5AM2A 3STVA 3FWHA 4H7EA 1F8UA 3E4DA 1PV1A 1ZD3A 4ZXFA 3OM8A 1ODSA 3C43A 3PI6A 2OGTA 1MNQA 3PICA 3G8YA 3GFFA 4C4XA 4H7JA 5AKLA 3FSGA 7YASA 1JMKC 3FVRA 3UMJA 3TEJA 2C58A 1QIIA 2PUJA 4DIUA 5AK3A 4BVJA 2WFLB 1XRMA 5CRIA 2XMZA 1ORVA 5JAOA 2ROQA 4IO0A 4B9EA 2H7CA 2XUJA 4GBGA 3F98A 4ZV7A 4X95A 5BWBA 3AIKA 1Y37A 2NW6A 2WHPA 4EY7A 3WWOA 4FNGA 4H0CA 1YS1X 4X6YA 3DDUA 3O4GA 5ALGA 4PO3X 5CXXA 1A8SA 3WK8A 3GBSA 1YA8A 4QEKA 2AJ8A 4YASA 4G8DA 1AZWA 4BAUA 2JEYA 4HTAA 2OQIA 1Q84A 5EHXA 4UBMA 3H0CA 2V9ZA 1QZ3A 3R0VA 1X2BA 1BRTA 4H18A 4HXEB 3ESCA 2QUAA 5JD5A 1JFRA 5C7YA 3DCNA 2XUOA 3WLAA 1WB5A 2XMDA 2ZYSA 4G8BA 5A71A 4E15A 1CUCA 1MNAA 4UHEA 2JGFA 5DYTA 1QOZA 5ALTA 4B7ZA 5C8ZA 3D0KA 1U65A 4DSZA 3MGAA 4CCWA 2WJ6A 5HF8A 4JYPA 1MPXA 1XRPA 3FCYA 3DS8A 5JANA 4IQ4A 1ODCA 5EHZA 5AM0A 2VF2A 4BZZA
chains in the Genus database with same CATH superfamily
3VZDA 1JXMA 4JBWA 4OHRA 3K8YA 4HDSB 2FZWA 3D7KA 2ECKA 1AY0A 2A94A 2JJ2D 1Y8RB 5EJ6A 4YDRA 1QLHA 4FNAA 1R88A 1KJWA 1OXUA 1B0ZA 3GGGA 3LQ2A 3SXPA 4AFNA 1IJKA 5BSRA 4MGYR 3UA3A 3C8DA 4DM3A 1EFRD 4E13A 1WB9A 3MVEA 2Q5FA 3H2KA 4MHOA 4C01A 1RYMA 2VTBB 3I5YA 1VXOA 1QUFA 1HYGA 4OQ4A 5BP7A 1R3UA 5GWXA 2YXPX 1CDZA 2I7DA 1X8KA 2UZIR 5LC1A 3DBLA 3EGVA 1NRIA 3PQ6A 4FSDA 1SZJG 3A70A 4FP9A 3VHRA 1U1IA 4B4WA 4ZOAA 5HIKA 3P2EA 3B1VA 5K0FA 2FVYA 1NJ1A 2OWEA 3CVJA 4ZO7A 5JXHA 4XWKA 2HMVA 4IJ5A 1U8TA 5ALLA 4BUJA 4V24A 1N2CE 4B79A 2H8GA 2X86A 4RM2A 4XIGS 2P1RA 3WMEA 4FHDA 2C0PA 2B4TO 1RZVA 4QGHA 2PSJA 2V3CC 1E8NA 1NVFA 2VYFA 5J4VA 3JRNA 5HGXA 4IKEA 5LMZA 3U7HB 3OETA 2X13A 3QKWA 3E23A 3R3WA 4IIXA 3STHA 5IULC 5IDWA 1Z5VA 3HKDB 2IDZA 4ZEVA 5PNTA 1JG7A 4UZFA 4E7OA 3IB3A 4OGGA 1A9TA 1GFZA 1VIYA 3HA3A 1VE9A 1NWHA 3Q88A 3QX7A 4FFVA 4IOMA 2XNCA 3IP8A 4A1OA 2Q0HA 1LU9A 3TW8A 1IHYA 1TADA 1MDBA 5FPHA 3JWPA 1DQPA 1JVBA 2PT9A 5ALNA 2OSVA 1WZUA 2X8JB 4MV3A 4P8RA 5KI6A 4B0PA 3IOYA 3R3VA 4MIYA 4ZO9A 3I12A 3VM6A 3K5WA 5J1SB 1T36B 4U7PB 4HDKA 3TZLA 1H2RS 1A9OA 3OD5A 1GZUA 2DAPA 1XNHA 1MIOA 2FSPA 2NSLA 1B15A 2FP3A 2WFAA 4U3JA 2B5OA 1RXWA 1D1SA 4ND6A 2B1QA 3JY6A 1N0WA 2F55A 1VB3A 2E55A 2JFOA 2XR1A 3JYPA 4ERNA 3GLUA 1FVFA 5IZ4A 4Q7EA 3BGDA 1VBNA 3OX1A 4W1PA 4X9XA 1FMFA 1L6RA 3DAOA 3RAEC 3PC4A 2ZRQA 3QX8A 2PSFA 1A9SA 4INOA 1SXHA 2GN8A 1NAHA 2PZLA 3V4VB 4BNJA 3RG8A 2ODAA 4D1YA 4GX1A 4RESA 1X13A 3ORSA 3VVCA 2O8EB 5ADWA 5HCNA 1P2DA 3BCHA 1T2NA 3BKXA 1OQAA 3RV3A 3RFXA 2ERCA 2VCEA 1E8DA 2YY5A 5LU8A 4DIOA 3D2AA 3DVQX 1T9ZA 1CY0A 2DULA 3H5OA 3QW4B 3W9SA 5LJIA 1ADBA 5L3QB 4C0XA 3MMSA 5LBIA 1IAQA 2E1RA 5YASA 3MW8A 2FXVA 2IGTA 4JJEA 1HMPA 1P3DA 4UUQA 4N5LA 3PUJA 4PFJA 4PTYA 4QBKA 4RO0A 2FFHA 3QPBA 4WVFA 1JKJB 1XZKA 2HMAA 2IEBA 2ZVJA 3AETB 3N58A 4IXNA 4RD1A 4D6XA 5FFNA 3D6HA 4IIVA 5JRJA 3D5TA 1ULBA 5G0VA 2HIAA 4ZI7F 1ZCJA 3IVRA 3UICA 2AUMA 5GM1A 2PUCA 4MGIR 2YVAA 4C4OA 1W5FA 1Y8QB 2ID4A 1KTVA 2JIQA 3B13B 3HQ4O 4IDHA 2CFRA 3D9QX 2RCNA 2JLVA 1URPA 1M3SA 3OBIA 4TTQA 5LUAA 3OSZA 4QM6A 4L27A 4EF6A 1RC8A 2MYNA 1C8KA 2ZDQA 1WDTA 1C9DB 3OPXA 2OZVA 1FFYA 1M2EA 2FPKA 3FBTA 4Z54A 3IHLA 5JDIC 3IOCA 3B7WA 2ZTUA 2VQFB 9ATCA 2HKIA 4B3GA 3H65A 5AT1A 1LLQA 2V5AA 4OL9A 4EA6A 4M0LA 4LJ9A 4DFDA 3NWJA 5EERA 4MWBA 1J00A 2H59A 3O83A 4G3XA 3AUTA 4LTNA 5EZ5A 3HVHA 2V7QA 2YS6A 1SKMA 5DGIA 4DMLA 4U2FA 1QU3A 3R7BA 1IM2A 1ICIA 3LDGA 5I9LA 1R6TA 3PR2B 4D9FA 3OLCX 5DBEX 4XZ3A 4XPZA 3EB9A 4G1VA 3ENQA 1P74A 2F3RA 1DMRA 4RIHA 1N2IA 2BJWA 4EDFA 2YWDA 5E4YA 4K05A 4DUGA 1BAPA 3UB4A 4F4JA 3RJ5A 4NZMA 1P2GA 4N03A 4FDAA 1FXWA 2GYUA 3JTMA 3ZHTA 3KQUA 4JBYA 1I7NA 1CLUA 2NAPA 1P0CA 1YA4A 3ZK7A 3R0QA 5F7OA 1B8VA 1EX1A 3NCTA 5LWQA 3M33A 4TMXA 2X7HA 1SXJC 2R5FA 2FUG6 2G8NA 3D6MA 2ZJ5A 3FNEA 4OPMA 3K31A 4TLDA 3BERA 2FN3A 2NSDA 3PJGA 4XIIA 3U1TA 3WKAA 4CFZA 4MQFB 1S2NA 1Z28A 4OTZA 1DAGA 2TMGA 1W94A 3D81A 3F6RA 3LWBA 4ALIA 5BWCA 2BFFB 1WIWA 3IBCA 2GBPA 4EKGA 3V1YA 4DDUA 2C2KA 3W7AA 4GR9A 3RYHB 4MRMA 2X3FA 2QW8A 3LD9A 3EAGA 5JSUA 1QHYA 1JHOA 1PJLA 2ZSUA 3SM9A 3WJAA 1UPBA 4HLNA 3DCYA 1VJ5A 2DH5A 3O9MA 4IS2A 2Q2VA 1F14A 3V55A 4DBVO 2X4IA 1L5WA 3FMOB 4TLAA 5FBHA 3SG0A 3TQHA 2DFTA 3R20A 1YDGA 2AI2A 3G82C 3BF7A 3PUVA 1WG8A 1CR2A 4I19A 2LGJA 4QATA 1OLOA 2ODPA 3OX4A 3H2YA 2GN6A 3HR4A 3BRCA 4FYMA 3AM1A 3VR3D 4AUMA 2VOEA 1V3TA 3WTBA 4M1KA 3D8BA 2PZGA 4ARBA 1BEEA 3RASA 8AT1A 3LY7A 2PUFA 1J25A 1USGA 1LPMA 2I1QA 3WYCA 2D5LA 2QR3A 5L7TA 1JFLA 3FR7A 3DLHA 4TS3A 3CKYA 3SDSA 3KKZA 3TK1A 3AU8A 1YVUA 2H4XA 4EAQA 5KNDD 2FVXA 1J1IA 4MJXA 1YU9A 1YB1A 4EX7A 4NZZA 3HSSA 1D0SA 3H4MA 4G9GA 5DFAA 2FEAA 2FPPB 4QE3A 4J0QA 4R3UC 1CDEA 1LF0A 4OLBA 4JI2B 5CPFA 4KW7A 2PRZA 1MJGM 1LDGA 2WINI 4LYEA 3MB8A 1IMJA 4H3SA 2CJFA 5EXPA 1WA5A 4I36A 3ZZNA 1GAEO 1XNRB 1XDUA 2WB2A 1DC8A 3DOHA 2XZDA 1RM3A 4O4JB 1YB7A 3EG9A 5CK5A 5DRYA 5K4GA 3EASA 3K1AB 4JMPA 1BG6A 4EAAA 1DJLA 1XDGA 2WKPA 5IVPA 1P2SA 1OT5A 1T8RA 2Z3ZA 1NTRA 3ME5A 4FBMA 4UASA 1YV9A 4WESB 4YA6A 3I83A 5THQA 4D8UA 4EG3A 4QXMA 5JASA 1P6QA 3M6AA 4NBSA 2C2BA 1Z34A 1FUYB 4LRTB 3I2KA 3EY9A 2QIOA 4W1SA 4OQXA 4B8YA 2OSBA 2R8XA 3FVWA 3C2QA 2PNJA 2FI1A 4ESOA 1HMYA 4Q3BA 1FBTA 3JQFA 3UT0A 1H3FA 2IYYA 1ONBA 1U63A 2CK3A 2PX0A 4HWGA 3R9XA 3OURA 5FJJA 1NUSA 1WQ4A 3HK2A 3T7IA 3E1SA 1RJFA 2OCKA 1N3LA 3G2KA 3AIMA 4FLEA 2CNLA 3AC0A 4ME6A 1UDWA 1JFSA 4RHYA 3AR9A 1Q44A 5L3RA 4AY4A 5I8WA 4NBLA 5AI0A 1PZGA 2IE0A 2WI8A 4RVGA 4GXTA 3H2JA 2Y6UA 2PUDA 3ZQ4A 4R9UC 3GVHA 5CFMA 4CI0B 4BU0A 2R9VA 5LB2A 1NIJA 3ZH9B 1PG5A 4QEDA 4EIWA 3AERB 4V1CA 1Z8NA 3GLKA 4EB8A 1DIRA 1DAOA 3DEZA 4OHYA 4I1VA 3RIYA 1GYPA 3L8HA 3V5NA 1FTWA 3JQ9C 4RPCA 5EKDA 4YCJA 1TF5A 4TT3D 1QGED 3GAFA 1BKDR 1U2PA 4GX5A 3GPLA 1JJIA 3GEHA 4PAMA 2ZXFA 5HFJA 3ZWWA 3VKWA 5DNYB 1WNTA 3DYVA 1N0UA 3QV2A 4ZVTA 1MPTA 2KWIA 2IYTA 1ZD1A 2OR3A 4MW0A 1Q95A 2G88A 3QEOA 4P3XA 4U00A 4ZP1A 3VA7A 2JJ8A 3EG5A 3D5EA 4AN4A 3AR2A 1V5GA 1YI1A 2ZYHA 1L7OA 1R3DA 5ENDA 5J5CA 2ZUEA 2PFKA 2IPXA 3BZUA 2IS1A 4EGCB 5KNBA 3NYRA 4FR2A 1HDRA 4MS1A 3A06A 3E2MA 5FWXB 2ZZKA 4YR7A 1DX6A 1W46A 3QMVA 1YR8A 2BWJA 2DHCA 1QFZA 2ZSJA 3QXJA 3NBMA 5T4EA 5J5AA 3S81A 1CUUA 2B7LA 1OXKB 1JIKA 2FLKA 3HCRA 5EZQA 4DEYA 5F21A 5I9SA 3LPDA 4BN0A 2C0CA 2KJQA 3PC7A 3V3KA 3JASB 1OPXA 1QC5A 1YXMA 1NBMD 2B0JA 3UV7A 4IZHA 3RG2A 1UBCA 4Q7MB 1CUAA 2XE7A 3I9NA 3OE7A 2AW3A 4JR2A 5NLLA 3UPTA 4L8LA 4JLMA 4PZLA 2AE2A 4EBBA 3NBYC 5P21A 2OFWA 4YHHB 4S2UA 4YRMA 1USUA 4OKSA 4MI9A 1Q0QA 3KQVA 2JFHA 1XMQB 3LYUA 1HL7A 1SUPA 4PE5B 4TXLA 1SBHA 2N0SA 4CUZA 1EK2A 2DR0A 3HMQA 3RFFA 3WB9A 1SXIA 4B6OA 2O50A 5JHGB 1CV2A 1OFUA 1D04A 2CYAA 2JPDA 4JDPA 3NI2A 4B43A 4AZ0B 1M72A 4D82A 1P91A 1JQKA 2YYSA 2XE8A 1P5HA 3P97A 4CKYA 4S1TA 5AESA 2XVMA 4MR9B 1Y0BA 1JNXX 3K2IA 4P3KA 2ZCJA 2EFEB 5M3BA 1PL0A 3ROXA 3TGWA 1UBRS 1KFBB 1UJNA 1R0BA 3ND8A 3DBHB 1NMYA 3VR0A 1UPFA 1ARZA 1FDOA 3A4TA 3WGIA 4D25A 2CVOA 4WA8A 3TRDA 2NZ2A 1KH1A 2EFGA 4YRPA 2IUTA 2FPIB 2ZAGA 3SZOA 2IKSA 3P4YA 4B2IA 3MTDA 4UFPA 4QTYA 3I2FA 1E7YA 3OICA 2BEWB 2DXIA 5IN4A 1JU4A 3JZDA 5IJ9A 1B26A 1IC6A 4QTTB 4IIJB 5EWLA 5DHTA 2ON6A 4RKQA 5C80A 1V8ZA 4TOIA 4EA7A 4ES6A 1WQ1R 1I4EB 2ZRAA 4KAJA 4IJMA 2V6MA 4PRYA 1UWKA 2VJNA 3BIJA 4MPPA 2QM3A 4ND1A 2ZBPA 4WFIA 2MINA 2YCLA 3WWEA 4R71A 4ZYTA 1T3ZA 4N41A 5JTTA 1UKZA 4BTLA 2K7FA 2WYUA 3C41J 1NONA 4OP2A 4BBPA 4TKLA 3AY6A 2I3ZA 3ER6A 1KSGA 4MMXB 2CL5A 3STTA 3PPXA 2OMKA 3PD7A 3R6TA 3Q2OA 4B6JA 4G5SA 2HT1A 3KUCA 5EJ4A 1YVPA 1OLSA 2GF9A 4DCCA 1D2EA 1PDVA 5BNIA 1TQ8A 5EXSA 3PC8A 4BNTA 3SZGA 1M0SA 4ILEA 1YZKA 2P2NA 3KVVA 2FG7C 3DQPA 3GX1A 2CKMA 4C03A 5CLFA 1GUBA 4PZUA 1ZHFA 1K4YA 5F7JA 2KSQA 4MR9A 1D1PA 3P94A 3PA8A 3SNKA 1F48A 1NXOA 4JQOA 5CHEA 2YXDA 1EGQA 2JCYA 4YTEA 1EHYA 3JSXA 3JQ9A 2G7MC 2VHTA 3VDQA 3ZXSA 4IIEA 3UJPA 4LOLA 1BX0A 2GFHA 4XWTA 2Z1DA 1I2CA 2YY6A 4WLFA 3IP3A 2FR0A 1L7BA 1P39A 3SP1A 4OHUA 1D2HA 2J0EA 4JCOA 3RC2A 2O54A 4TV9A 5L6LB 1WTAA 4G4GA 3IV6A 4I5FA 3O90A 3IDZA 4KRGA 2QNIA 1KI7A 2R7NA 3RC3A 5K0JA 4ER6A 1RPAA 3RIXA 1PZHA 4HLCA 2Y2VA 3W90A 1QBKC 3LJKA 2HHAA 1MQSA 2ZIZA 4LJ5A 2QLMA 2EW2A 2P0EA 3SN6A 2Z6QA 3PTZA 2BM1A 3EGXB 3OHPA 2BTQB 2I2DA 4ZRMA 1C41A 1QHIA 4H4DA 3TH5A 4KQJA 4KFCA 4B31A 3ZGNA 3WRYC 5B55A 3D0RA 4QWWA 4E5KA 3HPRA 3ADDA 1MZVA 2ADMA 4K8OA 4CKBB 3BD8A 3CT4A 4EG4A 4C2TA 4RADA 1N57A 4F5WA 1F1BA 3DLAA 1GN9A 2NPFA 2JAXA 5A4MS 4KQ2A 3EIFA 1ETHA 1X6VA 2NU7B 4HB3A 2YHIA 3EWAA 3BCSA 4PLYA 2JH3A 3MCAA 4Y6OA 3FOEC 1PJCA 1X9HA 3N86A 4B33A 3I05A 5J2UB 4BO3A 3LVQE 3GVCA 3LWNA 4AYWA 2GESA 2ODQA 4LHSA 3A4VA 1F7VA 3DB2A 1E2PA 1ZP6A 2GXSA 3B7PA 1M1YE 2HMUA 4FZJA 3MUNA 3AUYA 3C7TA 2GWRA 4ZDKA 2KX7A 2NACA 4JJ8A 5AHXA 3D54D 3IUJA 4BLRA 3K4QA 4N3BA 2I2XB 3RJZA 3DZDA 4YCSA 1MR3F 2JIMA 1SQGA 3LT2A 1UZMA 1WBBA 1MB2A 3MFQA 1G3UA 3OZDA 1ZCFA 1XDDA 1PT5A 5BRJA 1TC1A 3K4PA 5IDVA 3LCVB 3B38A 1R0SA 1AQ6A 1MRZA 2CJYA 3CIOA 1YR1A 4CIAA 1AS2A 2R87A 3P8ZA 1U9JA 3Q9LA 2UUBB 5HIIA 4MICA 1R0XA 5TF4A 3B89A 1EXDA 4YONB 4UTNA 1NUQA 1U4NA 4P3OA 2GM3A 1RFLA 2Q3BA 2PH7A 3NATA 3S2EA 2B6HA 1E7RA 1OR8A 3EMKA 4M1MA 3WL3A 1C9YA 4KU4A 1V7QA 5DW0A 3FB1A 4ZCRA 2H06A 5K2MA 1KE2A 3PGXA 4H3VA 2NTNA 3DV0B 3PPYA 4RPKA 1VL6A 5E1BA 4AF8A 1YA6A 1QVVA 4O29A 5K6RA 3DWFA 3ZVRA 4KR2A 2X4LA 1QRTA 4W5NA 2ZRPA 1J9EA 3DZ8A 1ZJ5A 1V0JA 2OCXA 3K92A 4MI6A 3FXAA 4CG2A 1Q7RA 1UBTS 2P3SA 4TV8B 3NYIA 1IQ0A 1E7SA 3B1JA 4K81B 1GNLA 4P53A 4IVRA 3DQQA 1IY8A 1GA1A 3MRSA 3OOSA 5KAMA 4M53A 3TLKA 2ORYA 4UUBA 2LNDA 4IYJA 4LV5B 1OLSB 2FW9A 3V80A 1TX4B 1U8EA 2ZYIA 3U37A 2V6JA 1MABA 3VPGA 2WAYA 2RB5A 5AW4A 5KB3A 2R25B 2PGXA 4AMBA 1IL0A 4TKUB 5TEVA 1GPWB 2HI0A 3C1UA 2BISA 4HZGA 5ALFA 3KOUA 3UMSA 1B8NA 1NC1A 3O38A 1WP9A 2XOKA 2AC7A 4QEZA 5BQXA 2Z2JA 3AR4A 3PC3A 1L7DA 4HEA1 3T34A 1BXGB 1ACLA 4PG4A 1QKJA 3KEFA 2J3DA 1KI4A 1Z7BA 1H6DA 2X9GA 5B1YA 2TMYA 3EPRA 4HDRB 4IIHA 1YQWA 1LY1A 1R12A 3KXPA 2J3IA 4ZWNA 3W4KA 3O47A 3WXMA 5LDHA 3TLAA 1GTSA 2X5XA 1GT91 1NVEA 1XXHA 4R2JA 3W5HA 2QUIA 4LN1A 1GGNA 1I4TD 4II7A 1NF2A 2QRLA 2V5UA 4DA7A 3AXSA 2Z98A 1EJ0A 1FBNA 2DY1A 5TPZD 4MTCA 5LPNA 3MOGA 5GGYA 4IRUB 2P6UA 1F5SA 1MF7A 1US8B 3B3FA 1KMHA 1VBKA 3D4NA 5LQSA 3T1NA 4BJ5A 4HNSA 3EDCA 2V7WA 3PEEA 1T8TA 1KJ9A 1ENZA 1YJBA 3I01A 1FC0A 2RGEA 1KJ8A 1EP1B 3WRWA 2FWJA 3TQIA 3DFMA 1BS1A 3EEIA 4UBNA 1YZTA 2W4QA 2MHCA 3L0OA 3QOWA 3SLRA 2IVFA 2W5UA 3AR7A 3ZZ1A 3GLFB 3UH1A 4WBNA 2Y77A 3G1WA 4KCGA 4J94A 3THYB 4W1QA 1O5TA 2KM1A 1M8KA 4OHOA 4D4HA 1MB4A 2VH1A 1D6NA 1G5QA 3GH3A 5IAEA 4KDEA 3TUIC 3C6MA 3OZCA 2J8ZA 1TM7E 3WV5A 1O2DA 4EL5A 2EVWX 2RG1A 3D1JA 1LI4A 3O3MB 1JR2A 4KQCA 2CLLB 3DZGA 4NZ9A 4ZEMA 1ONPA 5IFLA 5K8LA 2WE8A 3TOVA 2GN4A 1YMVA 4XFJA 4MV6A 1NULA 1Q3KA 2WNSA 2IY8A 3PE6A 4MWSA 2VJKA 1ENPA 1VGQA 4GT1A 1CVLA 2GAIA 3TBFA 4FMDB 4EITA 2X8JA 1CF4A 1FDTA 4R98A 2BMJA 4LPKA 2W00A 2QTVA 2AFIB 2G06A 5AVWA 4PYMA 1RTKA 4RZQA 2GKGA 2OG1A 3EVAA 1XTUA 3QNMA 2JIOA 1FNDA 4DBZA 5AVVA 1C0PA 2G25A 1Z2EA 3EXHB 2BHTA 1WXFA 3IIMA 3NAZA 4FZRA 1SO8A 1NNLA 2CJWB 4JBIA 4S2EA 1O95A 2MSEB 4DJFC 5KKCA 4WAUA 3ZJTA 3FNGA 4G8JA 4AP5A 2ZYDA 3TLMA 3DOFA 2PGNA 2Q3MA 4XQ9A 2VSXA 5L95A 1ZVQA 4XA8A 4O2LA 4L0QA 2R60A 5TMBA 1CRQA 1KVQA 3BTOA 3PEYA 1O9BA 3V9AA 3LRPA 4L0CA 1UBKS 2OFOA 4N5HX 3ZCXA 1UBUS 2N47A 3AEQA 3C5HA 2Q8QA 4NJMA 1BJTA 1MTOA 5K3DA 1H2AS 1H1TA 2FUEA 3CURA 1E1KA 1FL9A 2JLWA 3SS9X 4P3NA 2F43B 3SEAA 3F6YA 4BWVA 4RZ2A 2VSQA 2W6IA 4X5OA 1ND6A 2WILA 1KOGA 3OHMA 3THSA 3DZBA 4F1JA 2MT9A 1WCV1 3ESXA 3JATB 2YRFA 3CPJB 3Q11A 3FIJA 3N0WA 5KQMA 2PX6A 3K9QO 1XTBA 1JMVA 1SU6A 3RSSA 3AUXA 1C30B 2PM8A 3L7IA 4YO8A 3MJDA 2UXBB 1JJAA 1Z2CA 2P9CA 3E53A 2J5RA 5BNFA 5C51B 1SKYB 4KLRA 2VZ9A 1PVDA 1KWGA 1STOA 4FZ3A 4W5QA 1SCDA 4LFAB 1MABB 5HHTA 1NMQA 1C1HA 1W8IA 2I03A 4JX9A 4NI5A 4PR3A 4X1OA 4B83A 1YZNA 5EA2A 3RPEA 2AC4A 3QVXA 1XVAA 4OLJA 2XX3A 4ZU6X 1V5IA 2QHXA 3L1UA 1LPOA 4D7AA 1VHJA 2HWYA 4ZJPA 4AQYB 3LI2A 4HXYA 1E4YA 1F38A 1ZN8A 3RWOA 2XCIA 5IAJA 1UMBB 3U3ZA 1G8YA 3H5WA 4G81A 4YUWA 2WMDA 2CCKA 2F3TA 4JYAB 4IEEA 2D62A 1DIAA 3VH3A 3CEJA 3ZBUA 1IEQA 1KERA 2H54A 2PA3A 2QT9A 2XWQA 2Z9DA 3A6FA 4BEWA 2B61A 4RULA 3L6UA 1U8YA 2DJIA 1KIAA 3GLIB 1SVOA 1MO3A 1XXLA 2O06A 3I9V1 3FMIA 1HLPA 1TT5A 2Y4OA 3FWNA 2G4LA 4FKZA 4R2IA 4UBLA 3O0DA 5BYJA 5BR8B 3CMCO 1FUUA 2HBYA 4ZODA 1V37A 3K0FB 4RSRA 5A0TA 3DFKA 4XJSA 5AW2A 2OAP1 2NTJA 4KMMA 2HSJA 3E9ZA 1VBFA 4E88A 5K9ZA 2HA7A 3NGXA 4ACAA 4WUVA 1HE2A 5A62A 2F4VB 2Z6UA 3G0CA 1DI0A 4J0DA 3ZHVA 3BAFA 1ESEA 2FQWA 3U7GA 1QPGA 5GZ6A 1S02A 3HM2A 3EOBI 1ES9A 1Z0JA 4M46A 3FUTA 4PZZA 2OGUA 1AUQA 2Y0BA 1E4VA 2EJWA 3BH6A 1W96A 2QX8A 3OIFA 5BQ5A 4ZZ0A 5A4JA 2EJUA 2H1RA 3P0FA 1ZIDA 4XM1A 1GQ2A 1MJHA 4TL9A 3RW9A 3SQMA 2AD5A 3HWRA 3SYNA 1W1WA 4DTCA 4CDGA 5C37A 1DRVA 1LS1A 4M0CA 5DVZA 4BFXA 1POWA 3HCNA 1YMQA 3WYAA 1V7ZA 2A1TS 2O14A 3OCUA 4K9QA 3GVXA 2QS9A 3A26A 3BA1A 3LT4A 3OE7D 5ALOA 4QU9A 4M0MA 3ZEAA 1PJAA 4B09A 1SBIA 3GD5A 3Q6IA 1TZMA 2IP1A 4TZKA 2QLNA 2IS6A 1FQOA 3JQGA 1U1DA 1E6MA 4DWVA 1UP6A 3ORYA 4LUCA 3CLRD 3FNHA 1CC1S 1XAGA 2MR5A 3IOMA 3KEGA 3L0CA 1WB6A 5GINE 1L0BA 4RUKA 2XBUA 4JR0A 1ZVMA 4WCVA 1NY5A 4FYJA 1EX9A 1P7CA 2H9YA 5KQSA 4WNCA 4DC9A 5DGDA 1U2DA 5HZHA 3A6GA 4FHFA 2Z2KA 3WGOA 3CZRA 1OWPA 1BU8A 4PINA 4H6VA 1AC5A 1IUKA 3AUJB 1XTIA 3Q2KA 4NAVA 5B57C 2P35A 2O8DA 1DEHA 3AKDA 4E4YA 2ONKA 4OAOA 3P0IA 5DWQA 1V48A 4Z7NB 1IIRA 1WXGA 4CIVA 1KC3A 1Q91A 3RSQA 3KWLA 1OREA 3ONFA 2FFJA 4L5BA 3LUCA 2H2AA 4MV9A 1GDHA 1UT5A 2ID9A 1KHHA 4I1IA 3ZOZA 5DZSA 4ZC1A 3KTDA 1L8LA 3ZPXA 5JT1A 3A58B 3AERA 4V1CB 1FJXA 3OP1A 5AQEA 2P79A 4QBHA 4NJEB 2IYRA 2OXTA 2JLUA 1W4CA 3BMQA 4HN2A 4KV7A 3H04A 5TGTA 4PQGA 1NN1A 2IW3A 1U1CA 2B4YA 1G7RA 2YH2A 1O08A 1QMGA 3BE8A 3MBOA 3OD1A 4Y6RA 3ZHUA 4BEJA 5TJ9A 4HYYA 4JXKA 1NXVA 5A7FA 2H7XA 3FMVA 2VUUA 5BORA 1L5SA 1TQDA 3U6BA 3UZUA 1I4DD 1U0SY 1QBGA 2EEZA 2Q4OA 4UDOA 2N9UA 5CURA 3W8RA 3WIVA 5FWNA 1YJCA 1NFQA 2QN9A 2F1KA 3COPA 2CLIB 3G17A 5JWOA 2VCYA 4S1PA 1BE0A 1P7PA 2WSIA 4B73A 4A5SA 1W93A 5JPDA 3N8KA 4TV8F 1PWEA 2VHEA 3MBKA 4XQEA 4DA8A 1EK5A 2GBLA 3W2HA 3ER9A 3KTOA 2GAJA 1EFVA 1G19A 4K6OA 5LZ5A 3H7IA 5EJ8A 1AS0A 1NKVA 3RWBA 1J33A 1R0RE 1T13A 4LF5B 1F2UA 4HNTA 5JISA 5JJCA 2EQAA 4Y2GA 4EY4A 3PX3A 5D00A 1FUKA 3VVBA 2B94A 4C08A 4B35A 4DC0A 2JFFA 2Q9CA 3IUYA 1U3WA 2ANBA 4HGYA 1WHSA 5BSVA 2V54A 3RBVA 2HU5A 3SX2A 3VNVA 1IBKB 3BG5A 1JHQA 2GCOB 3OJOA 3ROTA 1JZTA 1PYOA 1YBFA 2GN0A 5CDGA 3KEQA 3R2JA 3C6BA 1NJ2A 3OFNA 4P34A 3W6UA 1PJRA 1U2EA 3UUEA 3DYIA 5B3LA 2EXXA 2O2SA 3KAQA 4D9BA 2V97A 3SVZA 1N2EA 2DMRA 4ZGGA 4KTVE 4IHJB 4BWFB 4NOLA 4WACA 3BEDA 3BMCA 2CHQA 1RW4A 3WHIA 1NMXA 3TW0A 4UTPA 1DBPA 5D1NA 1UR5A 1T8UA 2Z2YA 5EZYA 3B78A 3NRJA 5FQOA 4TM7A 2QQEA 1GUZA 1I0ZA 2FW1A 3TL2A 4YEDA 1JEDA 2FMFA 2VRNA 4PANA 4BN4A 2BMAA 4EOGA 5EIFA 1ZH2A 1XKXA 2B83A 1X1BA 1QP8A 1CZNA 4PNEA 1R0CA 2MJLA 1I6LA 1FMJA 2MYPA 2PH1A 3RSLA 4S04A 5BV2P 3VMMA 2G80A 4TVOA 1YAHA 1EFKA 5HSGA 5LIPA 1K97A 1PVVA 1N2HA 1XYVA 3HP4A 3T7TA 4MYHA 4P36A 1E5QA 1QS0B 1XWIA 5DYYA 1CUYA 1DFHA 3F67A 1T2VA 2BZ0A 3RUAA 2QN6A 1KAQA 1GRRA 4HH0A 4HX9A 4RY2A 4TLLB 2UV8A 3IR6A 4LV8B 5AJXA 4A23A 2AJTA 1CPYA 4XUEA 4IKOA 1KAGA 3QYPA 4JLJA 5LOVF 3J7AC 1OXBB 4LRYA 1L7PA 1EFTA 2VJBA 4PWZA 5BSUA 4GUDA 4MW5A 4OK5A 3P5BA 2WHRA 1EBFA 2XYRA 4C5CA 3I58A 3L7AA 2P77A 2CUZA 1KPIA 3C8UA 3EQ9A 2RGWA 5LP6C 1IEWA 4PGGA 4HZUB 1UCFA 2UYOA 4FYVA 4Y2VA 2GNAA 1LFAA 1O5IA 1U94A 3EYAA 5IAAA 3UK1A 2MOKA 3ZX5A 3RGGA 4DHWA 1VCNA 2QVZX 5F33A 3WWCA 3UAYA 1ISRA 1GARA 1P31A 2R84A 4ZYXA 5A6VA 2HDOA 4K2HA 2JEOA 3ZWVA 2OV8A 1NRWA 5IAGA 2GLTA 2RIRA 4L5AA 2QSZA 4KKVA 1QH1A 4KWHA 5FUYA 3V7NA 4MRRA 1EGVB 1ZKMA 1COWD 2VKTA 5AJYA 2OMEA 3ND7A 2I34A 4OGWA 3QJ5A 4RK7A 4QVGA 4Q82A 3O8OB 2HNKA 1GPMA 2YDXA 1VC2A 4IJUA 4JJZA 4ZVRA 5DBFA 2V0CA 4O4HB 2ZWAA 2ONJA 4OREX 3R3YA 1TCVA 3A6EA 4RYDA 4OXKA 3T9EA 4BKPA 1JWLA 4KAAA 1XX6A 1DKRA 3F96A 4D0LB 1IB0A 3SU8A 3DT6A 5JSFA 4YY3B 1D1TA 4JU8A 1JG3A 3E03A 5L6MB 1FX1A 2GWHA 2PJRA 1CQJA 4MB0A 1KI3A 4WADA 2ZE7A 1Y3FE 2XQIA 4XM2A 2PUGA 1CVIA 3BBLA 5DTIA 5T4BA 2C96A 4M1TA 2QT0A 1ZAKA 4RGYA 2NV0A 2Q50A 2ZUVA 3G5LA 1I5EA 4Q4JB 4A8PA 2W2XA 5C52B 5AD1A 1FYXA 4P7GA 2Q7XA 4TV9B 2V7TA 2I78A 1IHOA 4FDTA 3V7WA 4GLLA 1QTIA 3ML1A 3PFKA 2AQHA 1FXWF 4NDAA 2RGDA 4FMBB 4IQFA 3QU9A 3THXA 2VAPA 5IX8A 2ZB2A 1GFIA 3D6VA 4QUDA 1Y80A 4LIPD 5TQ2B 2Q4RA 2RSLA 2AJLI 2W9XA 1I4LD 1I9CA 1NP7A 3R77A 5HKKD 1C14A 1S89A 4F12A 4RQBA 4EPVA 3L0PA 2CYBA 2DPHA 1IAVA 4JQCA 3FVVA 3IAM1 5GJBA 1NW8A 1C9KA 1NYRA 2XLCA 4UXIA 2BHNA 1ML3A 3RS4A 2HGSA 4REQB 1U0TA 4CMBA 1Q5PA 4XGRA 4ZD6A 3TDNA 3PF9A 4EJSC 3X1DA 1PIWA 4F4HA 1B3BA 4UUOA 2IU6A 2GZ1A 3FHLA 1R4MB 3G85A 3VH4A 3WLIA 5B7NA 5BMVF 4EEZA 1IULA 3MCTA 1G3MA 1NT2A 4S1NA 4UM7A 2J7KA 3A9UA 3MLBA 1M1UA 5GONA 5FUXA 3A6KA 1EXNA 3JQQA 2ZI9A 3ZN2A 1EZZA 5A9SA 1OPRA 2X3YA 2Q62A 2F1JA 3MIZA 1L4YA 2O3TA 1XZGA 1FDVA 2FSVC 2R6AA 3C48A 1UIRA 3CRQA 4LV6A 2BOVA 4M87A 4C0HA 4I1OA 3DBIA 3QE9Y 2WTBA 1WSAA 3FOAA 5LBUA 4RY0A 1NN0A 1GPAA 2C9CA 5E7MA 3UJAA 5GM2A 4C3ZA 4KH1A 4D26A 3HVJA 1J49A 1HURA 3GI1A 1YJ5A 1ILEA 1YZLA 4Z7QB 3DW3X 3TG8A 1YRHA 3MWYW 4E2XA 3AETA 1GEEA 3EGWA 2ZWVA 1U2GC 2A1IA 3NDRA 3SD7A 2W6MA 3BRQA 5K3EA 4L57A 5K0EA 3D2CA 3DNMA 1E5XA 1WSDA 5IPFA 1FDSA 1MRSA 3IQXA 5C8YF 1T6ZA 2PLWA 4KL8S 3OQNA 2IWRA 2CMGA 3ISTA 3X2EA 4MCJA 2WQZA 4JVOA 4OEHA 2AR9A 3HABA 1GSAA 3K9NA 3KSDO 4OHFA 4X00A 3RVLA 1TTHA 2P2CA 1G7CA 1EDEA 1CHNA 3AQ4A 4OHCA 2ZJ3A 3DP7A 4XAQA 3NPAA 5CVCA 3NLLA 4LDJA 4UNIA 3WYBA 5JFTA 2YZGA 2G28A 1GAJA 2JW5A 3LQYA 3NWOA 4CI9A 5IKXA 1J7JA 4NENB 4M2LA 1NHGA 2HN9A 1FJHA 3M6XA 2W2PA 1W73A 4IBOA 4M8KA 5E6RA 3LF1A 4HOYA 4FNOA 1AS3A 1AMNA 2PUWA 3E3AA 2WWTA 4UUPA 2VJMB 3DZHA 3AGQA 5BW8A 2B1GA 2DX7A 2FW8A 2QN8A 2YINC 3HXLA 1JB1A 3MG9A 4Q4HB 4JS0A 3ZW7A 3AY3A 1ZN9A 2IIQA 4Q01A 4MVJH 5KJCA 3EWNA 3GA0A 3QBJA 4K1LA 4KO1S 2FQXA 3VJRA 3KQSA 1JIQA 1VKRA 2HO5A 2X41A 3SJ7A 3A0RB 3PCXA 2IYWA 5J2UA 3HGMA 1Q3TA 3L9XA 3SZ3A 3LX4A 5ICCA 1A7AA 1OH6A 2VUHB 3AKYA 1SBCA 1OV4A 3BD6A 3T1VA 3RHZA 4NFSA 4U02A 3DOCA 4ZQCB 5J40A 3I23A 4KNYA 3G2PA 2Q2WA 1UEIA 4LYYA 4MUXA 2RHMA 3CNHA 3K6KA 4LYAA 5B1DA 1V8FA 3PGA1 1A9XA 1WF3A 2ACEA 1TKRA 2Q1SA 5E6UB 5TIIA 4MQFA 4OYHA 4J4HA 1VHWA 1UAGA 3A2LA 4N12A 1AKTA 2AIRA 4K6MA 3W4JA 2VHVA 3C3XA 3SI7A 1PGPA 1M83A 1G5IA 3NHZA 3WMWA 1UBJS 2JJ2A 4JXXA 3Q5GA 1L5VA 1Y34E 3BE6A 2EU8A 2OQRA 4JHLA 1J8MF 4Y6SA 2GK3A 2RH5A 3I0MA 4J7UA 2C5BA 3RUFA 2AN5A 2FR8A 1EG7A 4UPEA 4JLAA 1NQUA 2JA1A 4XPIA 5C3MA 1U2QA 2UZ0A 3P7MA 4TTTS 3TKAA 4X84A 4G41A 1M8GA 1DUIA 2WIGA 4ZGWA 3BGVA 3HI4A 4FBLA 1CRWG 3D4PA 3KOOA 1O87A 1YUMA 1SQ0A 4Z2AA 2WUDA 4XKJA 1KNQA 2VPQA 1V4BA 1Y4AE 2PU5A 3JZIA 1ABFA 1XZQA 3V7UA 3HDVA 4M9RA 3BZWA 4MVYA 5DHPA 5AKYA 5FOUA 4Q4HA 1HEUA 2POCA 3WSVA 4EX6A 2Y1FA 4HRXA 2CV1A 1A2QA 2LVBA 3KOMA 4BMDA 1Z2AA 4OSOA 4OH1A 3IR5A 2GKOA 2IEYA 2PY6A 4LVNA 1L5GB 3GF4A 5BVHA 5M7EA 3ECAA 5H68A 4MUBA 4ZRNA 1T34A 3A28A 3VGPA 5E9WA 1GCUA 4HNGA 1HTTA 4PGHA 5JAZA 1Q0RA 3QMWA 2GEUA 4PCAA 3I76A 5JAPA 2PKWA 2DPYA 2EFCB 3QXHA 1LI7A 1D7OA 1OMOA 1JQJC 2A59A 2ATIA 2QLJA 1YOVB 3ZIDA 4ZKDA 2AFIA 2JAQA 3GLFA 1DKUA 1FDWA 1FUEA 1Z45A 5CVVA 1VJCA 5F78A 3TTYA 1DB3A 3AQIA 3WQSB 3I2GA 4CTJA 5KHOC 5I6DA 4ZOLA 4G5YA 4JNKA 4NE9A 2DPGA 5JATA 1GG5A 1APBA 1Y82A 3ZNPA 3MNFA 2LTAA 1M2KA 3NBZC 3OCJA 4FOPA 4CG1A 4EZBA 3VZSA 5ULLA 4EPWA 3UCEA 5GY7A 1XLWA 3FI9A 3QWFA 1BCSB 2YYZA 3IXMA 3LMKA 2WVHA 2D5AA 4OU4A 1GU7A 2PTGA 2Z0MA 3FCAA 3KPWA 3U3RA 4B3BA 1N2JA 3OPYA 1RRGA 4KGDA 2WWIA 3N1UA 1QRRA 2YZ2A 3GGJA 3ORHA 2QL7A 1G41A 3IGFA 4ILKA 3WKEA 3G9TA 5JCXA 1SCKA 4ER7A 5CFRA 2JGJA 3ZV4A 3DKKA 4Q66C 3CIFA 3E4CA 4LC0A 2ZI6A 4XQGA 4EB6B 1OIWA 4W5TA 2AHOA 1SIOA 4G9EA 2AMJA 4ZI5A 3IEVA 1A95A 3GP5A 2GXQA 1SOWA 1F17A 3USES 2R00C 2QTNA 3GEPA 3A31A 1OKKA 4N8DA 3ETHA 2ILTA 4V0NA 2B6NA 3G2QA 2X40A 3HZZA 4OHKA 3FOCA 3DHWC 2B4KA 4JP3A 5IC4A 5IRCD 4MVJI 1XVLA 4KO2S 3M9LA 3AHJA 4RJTA 3O4IA 3SZMA 2NVUB 2DHRA 1FVOA 2QD4A 4LBYA 3NVMB 2BCJQ 1E99A 2FDRA 2GD6A 3GDFA 1SHJA 2I8LA 4J7AA 2F8SA 4Y9TA 4QYIA 3DE3X 2CK3D 2PMBA 3OOEA 4EB0A 4ENRA 3DLPX 1G3QA 3RUEA 3T41A 4ITVA 4E07A 5I9TA 3H86A 3G0HA 3T12A 3HA5A 3I6IA 3JSAA 3QVLA 2FEPA 1REQB 1QF6A 5KINB 2CB0A 4U7WA 4BLOA 2ZXEA 2X23A 1UQRA 4DJEC 4YV7A 4TMKA 3HKDA 3F7TA 1RLJA 4M0PA 3E15A 1ZNYA 2QX9A 2APJA 2D8MA 1J70A 2ZANA 2RCYA 3I5MA 4MW9A 4NOMA 4ZMSA 3AILA 3DJFA 3PF8A 4KEAA 4G56A 1O8CA 2CUKA 2JIRA 4QBIA 3PB3A 3PXCX 3LVRE 1ZD4A 3LHIA 1NUTA 3AJAA 3KZCA 3QA9A 5JAUA 1T2UA 1OFVA 4HMOA 1II8B 3W5VA 4XTRA 1RPNA 2IPLA 4OUDB 2Q6OA 1CJVC 1GUDA 5CT5A 1U7HA 4R9NA 1KO5A 1TW2A 3AF4A 2NM0A 4ZDIA 1H2BA 4BO4A 1DCFA 3BJEA 4IJ6A 4BV2A 2I2FA 2W43A 4I4NA 4QVIA 4FQ5A 2BFBA 2ZBVA 3IAHA 1SG0A 1ZL2A 2CJWA 1RJDA 2VP3A 3M1AA 5FA6A 1K27A 5FOQA 3HA7A 4NP6A 3ZKAA 4IXWA 5DO9A 1T1GA 1HC7A 4KN6A 4L72A 4HAXA 3WYDA 2D7CA 4CHTA 3W8NA 4LK3A 3CVWA 2XWBF 3QHAA 4X0EA 2HRRA 4TN1A 4M0EA 1TJ4A 4QPCA 2GN1A 4AKGA 4ETMA 1C7JA 3R4CA 4GH5A 4R01A 4R6WA 4KRXA 4YAEA 2VRCD 3GVPA 2GHRA 4C0LA 1ZMBA 1ZUD1 5DMHA 3EA4A 1UIMA 4MYTA 5CFQA 4JUDX 1NFRA 3SMVA 4MV7A 2BCGY 3AI3A 5F1PA 4Z4CA 2H85A 4R1NA 4HNQA 3ZDZB 1EFUA 1HDYA 2JKVA 2O2ZA 4B3DA 1O0BA 3SAJA 2X0DA 2GJ9A 2SKCA 2WG1A 1RS0A 2PLRA 2R44A 3ZR4B 1J2EA 4GMKA 2OZKA 1B41A 3DGFC 4MVJE 4PRZA 4D9HA 2DT8A 3ZGYA 5AW0A 1XRQA 3IPYA 4IMPA 4OU5A 3Q85A 4NPAA 3DNPA 5K3OA 3G13A 3TQQA 1D03A 1WMDA 3OIWA 2IYAA 4H7DA 3AFGA 5FPKA 3H8WA 3CNEA 4DR3B 1AF4A 1S9HA 3DEKA 2VF4X 4ITRC 4ZV4A 1N3IA 2OVFA 2GDZA 1ATIA 1DADA 2ACVA 3HJBA 3MD9A 4Q3AA 4XQCA 4YS6A 2FOLA 5EQTA 2CHFA 4QQKA 3KAJA 4PBRA 4UPVA 2Z08A 2ZBFA 1QYWA 4D9MA 4EJ2A 5JD4A 5KOYA 1QRSA 1FFSA 2OD9A 1R9JA 1XIVA 1P8AA 3B70A 3QJYA 2C5AA 1ECLA 2GERA 4RMJA 1XZFA 4H7KA 3BXOA 4QLOA 1D0IA 1I3NA 3T3OA 1YNOA 3HJHA 1D2AA 1NLFA 3ANSA 6CHYA 1XNJA 3IIKA 3KL4A 4QC2A 3FWZA 4F56A 2I4IA 3OZTA 1VL5A 1KQNA 3OF5A 5JH7A 2KQUA 3N5CA 3TVYA 1KR5A 3AR8A 1J56A 3SHWA 3O03A 1H85A 1G7TA 1JEJA 3GNLA 4R1TA 4AZ3B 3IPRA 2VDOB 3OEWA 4JYCA 3QXCA 4WLNA 2PT7A 4LKRA 1W0JA 1CEXA 4LZNA 3SKXA 1VJRA 4F21A 1F8GA 1SVSA 2PL5A 3CH7A 4HATA 2XA2A 3IIEA 3FDIA 4EMTA 4HQRA 1MP0A 3AHCA 4X7RA 2VNAA 3K9BA 4OHPA 3VU1A 1HTWA 3OU7A 4R81A 3ZDYB 4ZO8A 1GTVA 5CLHA 4EARA 1C1XB 3UN1A 5G40A 5DTQA 3MTGA 5HKKA 1U0GA 1E6UA 1DAKA 4PAGA 3UXHA 4DCVA 3NUQA 1QDUA 2A57A 3C3JA 4Z0NA 3RSZA 1XL1A 4KX3A 3L6BA 1QIKA 4BYGA 5LB4A 5IS2A 1IXYA 3WGJA 3IFSA 2EJBA 1NVVQ 2VLIA 2XD9A 4XYEA 5CM9C 1ORHA 2YWRA 4HQ0A 4D6PA 2W2NA 3FPBA 1N75A 2HMYB 4EW1A 2HCTA 4IF6A 1UC8A 3BJMA 1QYDA 3WB2A 3ADCA 1P1IA 5DHRA 5DSXA 2FN7A 1IN4A 1M54A 3QMPA 4ALMA 3VC3A 2AUNA 3N2ZB 3DBHA 4HWTA 2O0MA 1M2JA 5K3CA 2FZLA 2PD4A 4QGAA 3FRJA 2PAFA 3SQLA 3A32A 1NR1A 2R4QA 4P6VF 5H9VA 1D4AA 1TD1A 1Y33E 2ZUFA 1ISGA 2FPOA 2QN7A 5JD3A 5FWAA 3JQGB 3CZMA 4DLZA 5HW0A 4QOFA 2OC4A 1ZJYA 3EODA 3PHGA 3V97A 1Y6GA 2D59A 4LDZA 5E3IA 3KBBA 3L40A 3NM6B 3VYSB 4BO1A 5H83A 3SQNA 3CRMA 3M4XA 1NBWB 1OX6A 4LY9A 2EX0A 1FSPA 3F5SA 5EE0A 4AUKA 2PLFA 4YPOA 4L5IA 1OB5A 4HJRA 3EQ8A 4RM3A 5H81A 4AIRA 2PX4A 1Z47A 4XR9A 4UKDA 1GCGA 5K09A 3NM4A 3VH2A 1S3GA 1RP1A 4HHEA 4TVSA 1KKUA 3GJZA 3AEKB 1TU4A 2VBGA 1CUZA 2WD9A 1KI2A 4L4YA 3C74A 3PITA 3QF4B 3VR4D 4C5BA 4DVGA 1Q1ZA 2Y8EA 2JG3A 5HZKA 1JIVA 4IHQA 3S40A 4LTDA 2GZHA 4K8RB 3EPHA 1OTYA 2VDKB 3ILXA 1N1EA 1RXVA 4R3NA 5D1HA 2AEMA 1RQ7A 1HSOA 4QJBA 1OAAA 4NJEA 1P18A 2ZR7A 4XD7D 4NWIA 4RS4A 1WW3A 4P98A 1F2UB 1W5SA 3PUZA 5G0WA 1ODKA 4WZAE 4XUCA 4PFKA 2IU0A 4CV2A 3KKMA 2HK7A 1V11A 3OIYA 3C97A 4W7IA 4FE7A 4HS4A 5HJ7A 4J49A 4BKOA 4MDFA 2JFZA 1AX9A 4MUAA 4X91A 2RAPA 2XYQA 3ZDRA 4X93A 1W36B 3DTNA 5G3YA 2Y66A 1PS8A 1SIUA 4LEIA 3LYHA 2CXQA 3MWDA 4RHUA 5HM8A 1ZVJA 4EATA 4DYHA 3BWCA 1LLDA 2VBIA 6AT1A 2DQSA 3T9BA 4ENVA 4IHJA 1YT5A 5CD1A 2AKAB 1G5HA 3Q0IA 3U1VA 4D6YA 4I2NA 1L1RA 4B74A 1R0ZA 4RV9A 4ALKA 4B5KA 4XRGA 3IKVA 2NU6B 3ZDBA 4G5QA 2OENG 2WBLC 3UAXA 2PUAA 1K92A 1EUCA 1Z4JA 4HB2A 1RBQA 3W9YA 1O89A 1TJ5A 5G4LA 4AZTA 2REQB 2WWFA 4ZDWA 2YYYA 2JD0A 3EVTA 2YC2C 3HFGA 4LBVA 4YT8A 2IZ6A 4B2YA 1ZR4A 5THKA 5DBIA 5GZ3A 4Z3KA 4CKBA 4GXRA 2CMFA 2QZSA 1UC5B 2P9ZA 4BGVA 2NXWA 5KS2A 4XYLA 1EQUA 1I01A 4GWKA 5CH3A 4F96A 5HM6A 2ZREA 3O8QA 1UJCA 3I1YA 3ZI7A 2FEXA 1OF1A 3MT7A 1ETUA 1QO9A 3DHEA 4J8PA 2P2DA 2YMMA 2DBZA 4IO1A 2O48X 4JVMA 4RTOA 4FMDF 4PBTA 3ZBQA 3AHGA 3EC1A 5COQA 1HQYE 1M10A 2CWDA 2F1IA 5IMBA 3ZY2A 3WLSA 1UOQA 3NO4A 4MV0A 1OBOA 1KY2A 5K0LA 3F9CA 3DVAA 4KUGA 1G55A 3CNQS 1KFCB 2ZT7A 1E1CB 3V4RA 1I3CA 1VKZA 2XAUA 2WQ6A 4DLXA 1NQVA 1L4GA 1ADCA 3QE0A 3TIGA 2X3UA 3V8BA 4BVAA 4F97A 1Z5WA 5F64A 2VUIB 2B1JA 2ORIA 1MC5A 2GGSA 3CN9A 5F3WB 4JASB 3CEHA 2EOAA 2V45A 1MV8A 1KWKA 4LNUB 1TEHA 3S99A 2OZPA 3LXXA 3WGLA 3FYUA 4GKBA 2E6KA 4MR7B 4ZRDA 3MGBA 1ZA1A 1DJNA 3UXYA 1V3VA 3MCVA 1NW5A 1OI4A 1Y8AA 4Y8VA 1FUIA 2PX8A 3EUAA 4WXMA 1PO7A 1XVIA 3SKYA 3RYCA 1P0MA 4IH9A 1MW8X 1NBEA 3DVSX 3ILVA 3QU4A 4RSHA 5U1PA 3PXGA 2HT6A 1BZYA 3CV3A 5LLSA 4QJ4A 3MD0A 1TRKA 2Q3DA 2OCIA 4KO4S 2JJYA 3E1KA 3WR5A 3IS3A 1EGHA 1N9GA 3SR0A 3WLMA 4KE9A 4DRXA 1KI6B 4JDUA 1WAMA 2BM8A 3EFHA 1AQJA 4I99A 4IIUA 4XRRA 5LNK1 1I1OA 2KYRA 1ESMA 3IP1A 4GQAA 2N75A 3UMRA 4DNOA 3G2JA 2Z2ZA 3VYWA 1HYQA 1Q83A 3BDAA 4GNKA 1XF1A 1OLUA 4PV7A 1DPGA 1QF9A 4UUNA 5ILQA 1TVMA 1DX4A 4KQ9A 4A26A 4BASA 4S3MA 1CRZA 3WKBA 4IDGA 2G8LA 2PS1A 2C8JA 2M6LA 1S2OA 2P2GA 1HG0A 4II3A 4ZVQA 3RJ9A 5MGBA 1KO8A 3S2YA 4XFKA 3W5IA 5K05A 3RVPA 1KO4A 1TCAA 2QTVB 4ROTA 4IZOA 2DWQA 1QX3A 2JFGA 4HGQA 3WADA 5FI1B 1KARA 4V0QA 1ZMXA 5E6SA 4EHFA 4ZT2A 1RWXA 2EG5A 1ZOOA 2DFVA 3GZJA 4ESHA 4YP5A 4LOJA 1MAVA 1XQWA 3C3CA 3G0IA 1WL8A 3N6RA 4DA4A 3L4KA 4J9VA 3M82A 2VJMA 1QHGA 1AE1A 1C0KA 1DCKA 4X8MA 2GZ3A 4Q39A 1JYEA 1Q7GA 5JS1A 2BW0A 4PN3A 1E64A 2X2OA 4AVYA 4EA9A 1LTKA 2JI9A 2VNIA 1HOTA 1QCCA 1PYGA 3BXHA 3RTCA 1JF8A 3IEMA 1U0FA 4RHTA 1EFLA 2EF0A 1K88A 3VO1A 1DKMA 3INNA 5IBCA 3EGDB 4G36A 5HTOA 2PO5A 3OTWA 3FIUA 4N65A 2IYLD 1CUDA 3NEAA 4IS3A 4M8NE 4DV6B 1J2JA 1KYZA 3LF2A 4DBLE 1XL0A 2ZIFA 2Y9PB 3UXEA 1Q21A 4FJ2A 3PQ2A 1J2TA 2J1LA 4ERXA 3JATA 2FPMA 3V4LA 3PHBE 1HZJA 5BURA 1FFXB 1F0KA 2O2IA 3EIQA 3R3SA 5EUCA 2NIPA 2NUPA 4P38A 1ITZA 2EKDA 3E05A 3RLFA 3GFRA 3L6CA 1DL5A 1DTWA 1FP4B 4D97A 2RFLA 3KTAA 4YFVA 3X1ZA 5JXJA 4JB3A 3HS3A 3KQKA 4R6XA 2Q0QA 3B20A 3LK7A 3CX3A 2VPZA 1J9GA 3HHEA 4JH0A 4PWYA 1RWOA 2ZQZA 1JB9A 4F7DA 2VFAA 2WKRA 2I5PO 4AURA 1J0BA 2FSSA 2V58A 5I9NA 5ISMA 2CLDX 4WY8A 3A3YA 3F2IA 1PGNA 3JAWB 3AFOA 4KVZA 3RYTC 1RBYA 3PFFA 2CF6A 3U9SA 4OD0A 4C07A 2QTAA 2AG0A 2IY9A 2IBMA 5ITSA 2XF2A 5F7XA 3AF3A 4NZPA 5DEIA 1VLMA 3W6PA 4EMSA 2DWUA 1QG2A 1K63A 5KYUB 5IK2A 2GRAA 1OA1A 2I7TA 1XCMA 1GP2A 4G1MB 3LQ4A 4UE2A 1UPUA 2YMLA 3K94A 3SHOA 3ADKA 1OVMA 3TZQA 4M9CA 2XT0A 4DN6A 4RZUA 4DQKA 1G6OA 3X0DA 3D8RA 2NO0A 3EZGA 1XTRA 3CZ4A 4B4OA 1XZ8A 1XAIA 3EYWA 3U7JA 4JOSA 5H82A 3ZJUA 5M29A 1GTZA 4NYMQ 4D0RA 1O9HA 3WJ1A 4CNQA 3U81A 1VPWA 1SAYA 3HKBB 2YIMA 2R1UA 3L6EA 5A3QA 2H63A 4YMIA 4P4SA 3TB4A 3TR0A 1W6RA 3HBMA 4FI3F 4LKOA 2PZFA 1WUTA 3V1MA 5AP9A 2BUBA 1QHHB 2OM6A 1KAHA 3V4ZA 1ORTA 2OAEA 4UVHA 1YDFA 3K9CA 5EJ9A 4BB5A 2HTEA 1GYRA 1KFKB 3OEHD 4X8OA 4ZVUA 4BQOA 1R00A 3IA7A 4JJKA 4W5WA 2V1UA 1V16B 3LOPA 2H9IA 3VAYA 4BHTA 4B80A 2G1UA 5FPPA 2JFUA 2O5VA 1IWOA 3C4VA 3CTPA 3IIIA 3K72B 4X20B 4ZA2A 4EJSB 3AP3A 1NUPA 3IP9A 1S8AA 5EEGA 5J2TF 3UK2A 2YNMD 4NATA 1Z83A 2FGJA 4IP0A 5EYPB 4GPZA 3LW8A 3T7CA 3VO2A 5HKBA 3LH5A 4L28A 2H11A 3UHJA 3PHJA 2OCAA 4FR0A 5I3CA 4DSOA 1YOVA 2QRJA 2MSWA 4MS4A 5DBOA 4Y0NA 3IQEA 1E3QA 3L93A 4JROA 4YAIA 3TQSA 5LM3A 3H0KA 2PRJA 5E7QA 5EIBC 6NULA 1SNYA 1SHUX 4WKNA 4LE0A 4JGGA 1AKRA 5EMLA 3MSXA 1QCZA 5IFKA 3WLPA 2VBCA 1A27A 2EP7A 4FGUA 3WZMA 1Q0SA 3IJ5A 3JQFC 5BWLA 1GD1O 2FSFA 2VQ6A 2B2CA 2CV2A 3B5IA 1OIXA 4DY6A 1LF5A 1HFKA 3D3JA 5DOVA 2HWUA 5JJKA 3RAPR 3CCCA 3QFTA 4J1QA 2NWQA 4PNPA 3GFOA 4DEXA 4KK4A 4P2BA 2P5YA 4RF5A 5T57A 3RTGA 4AF6A 3ADOA 5E2AA 3K6SA 4BMXA 2OESA 5HPYB 1H9BA 1QVAA 2GEKA 2NO4A 3HO6A 1L1QA 3KQQA 1VLJA 4E14A 1SB9A 1AB6A 2H31A 3OF2A 4HWOA 3D4BA 3M89A 4NS4A 1RCFA 2QENA 3DDHA 5KYXA 3GUZA 3E8MA 1E0JA 3FR8A 3N0VA 5D3KA 1YL5A 2J9YB 3HJTA 4ECAA 1USWA 2JAPA 2ZG6A 3L2OB 2R6GA 4DLUA 4EVRA 1GAQA 4QPDA 4A8TA 2TS1A 5JW6A 3VNAA 3HFJA 2BEUB 3PQFA 4TGLA 4P0QB 2FRDA 1RXCA 4QQFA 1Z82A 3THRA 2R6CA 5T8KC 3KUUA 1YI8A 5AJVB 3T9DA 1LUAA 2Z6VA 4QPPA 4R2LA 4Q12A 3GWZA 2HWXA 3TLJA 1NASA 5BYBA 4F6RA 5KWJA 3H5LA 3USZA 4PBSA 4D9KA 1ONOA 2P3LA 2VPIA 4MS4B 3L8DA 4Q19A 4XDHA 3TD6A 2PKQP 1KDOA 3LWDA 4HF7A 2HQBA 3IV9A 4WBSA 2JLYA 1NE7A 1KFJB 5EZYF 3R7FA 4NK5A 1WABA 1GGKA 4B34A 2KW5A 2YV4A 4DV4B 1GUFA 1L6IA 5JNSA 1W5AA 3LT5A 4I14A 5J2TB 4QO8A 4LSWA 2JFWA 1CF9A 3BMOB 4GLBA 1XU4A 1VTKA 1V2GA 2BY4A 2NXEA 2YMQA 4MB6A 5CFLA 4IDAA 4FSHA 4TLMB 4OX9B 2EV9A 3LSYA 2GOYA 1V1JA 5IYZA 1ZJJA 5EIWA 2AUTA 3QEKA 1BVHA 3DE0X 4KXVA 4DGSA 4BO5A 1XD8A 1C0EA 4IHJF 3GRCA 2ZJAA 4IJVA 4Q1DA 2AV6A 2AKEA 4RHEA 3WBJA 2Q1UA 3PC8C 2PGOA 1U0EA 2AFHA 2PGDA 3W5DA 3B2QA 3ZE0B 1T5TA 3U7QB 2NG1A 1GQOA 2FG5A 2C57A 2NQ2C 4KQMA 4U0KA 3ANNA 5ANRB 5FTJA 3WB0A 3WL8A 5KQGA 4F1WA 3K2BA 2HJSA 3RROA 4G84A 2XNJA 4RMHA 4TV8A 5DHFA 1ZD3A 2P5TB 4RD3A 2X19A 3KZOA 2ODWA 4ZXFA 5TQ0A 3OM8A 3UAZA 1ODSA 4CKCB 4MKZA 3ETGA 2ARKA 1I51A 1MNQA 2GTPA 4X20A 1EMDA 3BOSA 4YJ3F 1VLLA 3RUCA 1E6LA 3HB5X 4O2BB 6LDHA 2QAGC 5F3RA 3GK3A 4OM8A 2Q6VA 1GPJA 4C4XA 4JAVC 1U6KA 2L42A 3KZNA 3L4BA 3U4QA 3TZCA 2D06A 1JMKC 2X2PA 1WDLA 3UMJA 3ZE6A 3LV8A 4MOWA 2O57A 4K0KB 3D7SA 4HFMA 4DIUA 1KIFA 3BFKA 1X1TA 4H31A 4RABA 1C1YA 3EC2A 1XRMA 1DXYA 3U4CA 2H57A 2W8ZA 1OU0A 1T6YA 3ORQA 5B4UA 2AL7A 3LDUA 2O7QA 1NHWA 2ZIEA 1XLTA 3E0QA 2C2YA 2OG2A 4WI1A 2UKDA 4GBGA 4IL5A 4AJ1A 1NWCA 1NJSA 4MQ5A 4IX1A 4QOEA 4LE1A 4X95A 3KU4A 1EZ1A 3GDOA 4DABA 1PBNA 4DR2B 1V25A 1Y37A 4HWSA 2R8YA 4US2R 4KN8A 5AW3A 1TCUA 3T5CA 1CXZA 2WHPA 3KDSE 3OT1B 1ECBA 2DR3A 5A0FA 1V1MA 2WABA 3FHJA 4H0CA 4ZYVA 4BN5A 1L3BA 1C29B 1IPFA 1QH9A 4KWIA 3H13A 4I9GA 2ZBQA 2BLLA 2H51A 4I9FA 1XRSB 3RS8A 1Q0UA 4PQYA 1GJRA 4R54A 3OCYA 3GRPA 3UBMA 4DSTA 1R0KA 3ZIAA 4P2GA 3ZGLA 1WXDA 2YDYA 4Y9UA 3DPUA 3K5HA 5CXXA 1KOJA 3S70A 4C76A 1YCGA 4F3NA 3GBSA 4M0DA 5DNCA 1B76A 2P4EA 5FLYA 2Q5LA 1JEYA 4D3XA 3FTEA 4QEKA 2X6RA 5IDXA 2YIJA 2FSGA 3IAS6 4KXWA 3VOTA 2CLMB 4L8WB 4MUIA 3M3PA 3RFTA 2I4OA 5FF9A 1VP3A 3L7NA 3GLFE 1AZWA 1DFIA 2HLDA 2VH5R 3GWGA 1TUBB 1GUAA 4KYTA 2GF0A 1GO2A 1KY4A 3K53A 1CY2A 1GRVA 1USIA 2C4KA 2V0NA 3L7BA 1R8XA 1G2QA 2CD9A 5E4FA 2C61A 4C0WA 2OQIA 1ZINA 4KQGA 4AG5A 3D3WB 4JYBA 1N0VC 3H0CA 2NUAB 3FUUA 1KBQA 3W34A 3FM9A 2QZ9A 4ER5A 3TKYA 2Y0DA 2EFDB 5F4BA 3TPFA 1FYDA 2C3PA 4L74A 1OYOA 1SM4A 5BT8A 3KYDB 1X2BA 4ZQHA 1DO2A 2DM6A 1EEXB 2DUMA 4HXEB 4YR9A 1A4XA 4OLHA 5EMHA 2W6PA 4MKXA 2BDEA 2IZ5A 4B3CA 1RPJA 3WAGA 5HP4A 4E2WA 3SR3A 1V4NA 3DAPA 4CR7A 1J22A 5KIAA 5B30A 1VJGA 1T9DA 3DCNA 1ZMRA 3DDOA 1GA4A 2PEZA 3L06A 1TAGA 1U0JA 3I64A 3JVVA 4JT4A 3L6RA 2ZYSA 4IDFA 2B5WA 3DL2A 3IPAA 6ADHA