3FYUB

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
318
structure length
317
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
total genus 119
structure length 317
sequence length 318
chains with identical sequence D, H
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuB00
2FUKA 3IIIA 3QMVA 2XQGA 2JGJA 5ALJA 2HA3A 4W9RA 4EY8A 2WIDA 2V96A 1BCSA 4E14A 4Q1VA 2QXTA 2HRQA 4KE8A 4MJ3A 1ZICA 1XRPA 3FOBA 4L72A 1ISPA 1UK9A 1WB6A 1P0MA 2Z8ZA 3STTA 2QS9A 3WL8A 4DMHA 2DCMA 1BN6A 2B4KA 5CURA 4KRYA 1CUSA 1VOTA 5JASA 4DNOA 1CUDA 4BCCA 1IZ8A 3AZQA 2DHCA 3H2HA 4MEBA 3MUNA 1HKHA 3ANSA 3K6KA 1QTIA 1EB9A 1WPRA 1KU6A 1JMYA 3W9UA 1MX9A 1N1MA 1ZD2P 5ALYA 4FHZA 1A8QA 5JAOA 4CIBA 1XLVA 2DR0A 4X92A 1GT6A 4DMKA 1JJBA 3WL5A 5EHZA 1XZGA 4QDTA 1UOPA 4ITVA 1AMNA 1QIMA 2ZJFA 2PSHA 2XMZA 2Z8XA 4H7EA 4FMPA 4UBJA 4G4IA 1CUBA 5ALVA 4PF1A 4AO8A 4WFJA 1QLWA 2PU7A 1ZD5A 2WIJA 3NOXA 2WSLA 2Z3ZA 4P93A 2HL6A 5FPQA 4U2EA 1P0QA 3R40A 3I2KA 4G4JA 4OSEA 1DX4A 3LIPA 1XZBA 3FSGA 3PICA 5F4ZA 4WY8A 3IB3A 2XUGA 4J0JA 4QA9A 4AZ0A 5FOQA 3H2JA 4B83A 2AJBA 5IVIA 3M83A 5IVKA 4NZZA 3ESDA 1EB8A 4DYHA 1HL7A 1UKBA 5BV7A 1ORVA 1YA8A 4QWMA 1YB6A 4K6GA 1MX1A 1LLFA 5C8ZA 1BE0A 1GPNA 3I28A 3WKAA 5HQ3A 5AKYA 2FX5A 1F6WA 3N0TA 4C89A 1YAHA 4OD0A 4FLEA 2B61A 3JW8A 3OG9A 3T52A 3WQHA 5LKRA 3G7NA 4DNFA 4N8SA 1ACLA 2PKYX 1UK6A 4LYDA 3W05A 2WFLA 4B85A 5ALXA 2WFLB 3WZLA 1XQWA 3O9VA 4W1SA 3U1TA 3D4LA 3Q0TA 4X71A 2LIPA 4X00A 5H3HA 5AIAA 4M0EA 1SCKA 4P9NA 2OCIA 1ODCA 4CCYB 4EA6A 3DQZA 1CUWA 4HRYA 1BEEA 2JGLA 3RK4A 4BDSA 3EQ9A 5JIBA 1UOOA 4OB8A 3B3QA 1U8EA 1WM1A 4MQMA 4Q82A 3RM3A 5KWIA 2XUFA 2JF0A 2I03A 1BS9A 5FV4A 5AOCA 4O08A 1XZEA 1ZD4A 1CUCA 1JT2A 3H2IA 3YASA 3TEJA 3QITA 4LXHA 5YASA 4H77A 4FOLA 5HK9A 4F0JA 4L3WA 3VKFA 1VXRA 2Y2VA 4H7JA 2WUFA 2HDWA 1H2WA 4JUIA 2VT7A 3EQ8A 3UUEA 1F0PA 1GXSA 1VZ3A 4LYEA 2ROQA 4UUQA 2OPHA 1B41A 5D3KA 2C4HA 1E8MA 1L7QA 3AIMA 5AKHA 1W1IA 4H7IA 4LXIA 5AI0A 2JGFA 1BEZA 3BF7A 4BATA 5HKAA 3WK4A 3IULA 5LZ7A 1UKAA 4P92A 1L7RA 3MVEA 3BDVA 1N5RA 4KYVA 3DCNA 1CV2A 3WKCA 4Y2YA 4PSUA 4PSDA 3WIOA 2OAGA 2QJWA 3D2AA 1MAAA 4J7AA 3WK9A 3H17A 1W6RA 1LPAB 4HTAA 3DL4A 3A2MA 4BRZA 2VJAA 2HRRA 1LBTA 4GDMA 4H18A 4EZIA 2WU4A 3F97A 4WFKA 5T4FA 5AI8A 5DYTA 4I3FA 5DYYA 4Y9SA 5IH7A 2X8BA 5AICA 5HKBA 4NMWA 2XMSA 3EBLA 2CJPA 2J4FA 5DYWA 4BAUA 2OGZA 1R9NA 1GZ7A 1QFSA 1TQHA 4KE6A 2RI6A 5LYYA 2BFNA 4KAAA 1YS1X 4UHBA 2VT6A 4J3JA 4I19A 5CMLA 2XUOA 1MX5A 5EGNA 4QDOA 3I2GA 1JFRA 5FRDA 4MWTA 5HFAA 2R8BA 1CUZA 2HA7A 1QIDA 3C5WP 2XMCA 2BUAA 5CXXA 1EK2A 4Z49A 5ALHA 4B7ZA 3IUJA 3E1GA 1UWCA 4BBZA 3DKKA 3G9UA 4HAIA 2GYWA 2V98A 2GZRA 1XQYA 4AMZA 2VAVA 3N2ZB 2CKMA 2DHDA 2WHPB 1Y7HA 2GZSA 4B0OA 4UBKA 3KDAA 4MYSA 4K6KA 3IA2A 4J0KA 3WYDA 3R3ZA 2VJDA 1HDEA 1MU0A 3WI7A 2JEYA 5I7UA 1XRLA 1EDBA 1HPLA 2HFKA 3QPAA 4FKBA 3WKEA 4EY7A 4X6XA 2WHQA 4OU5A 4ZGBA 1A88A 4G8BA 2C7BA 2WJ6A 3A2NA 1GPLA 3PUIA 4DSAA 3G0CA 4FNMA 4DNQA 4C88A 4CG2A 3C6BA 4S0XA 5AKGA 1WB4A 4BDTA 3M81A 2PSEA 3I6YA 3D7RA 2GBIA 3BJMA 5AM5A 3DYIA 4UBLA 3IUQA 4DLNA 5E4TA 3BWXA 2YYSA 3QZUA 3OPMA 5JD4A 3ZWQA 2OCGA 1ODTC 4XWGA 4OB7A 3UUFA 3C8DA 1XZAA 5EIEA 1DTEA 4K5QA 3PFCA 2OGTA 3HXKA 4X6UA 1QIJA 1CRLA 5DJ5A 3HLKA 2XB6A 2OGSA 4Y2VA 1EVQA 3PE6A 4WDQA 1FFCA 2K2QB 1QIGA 2ZVDA 2XUJA 3IVMA 5DLPA 5JARA 2BGRA 5K3CA 1VZ2A 4BVKA 1TCCA 4HRXA 2I3DA 1Q0RA 4WCVA 2XQFA 5AJHA 6YASA 5LKAA 5EHNA 4F60A 5ALWA 2XUDA 5AI9A 5ALLA 5EHXA 1UKCA 2CUTA 3AIOA 1FJ2A 4IO0A 1OCEA 3TJMA 3VISA 1THGA 5JAUA 5HCUA 4J0DA 1WHTA 4FFVA 4C4ZA 1JI3A 3C43A 5ALOA 3EQ7A 1CUFA 5AP9A 1MNAA 3H1AA 2BKLA 3D5EA 3VDXA 4AZ3A 3D59A 4BTLA 1XZCA 2JBWA 3L1HA 2R11A 3SX4A 4X95A 3KD2A 2ZYHA 5EIHA 1EVEA 2I3ZA 2WTNA 3X3HA 1EDDA 3AZOA 1MT3A 3I6MA 1IZ7A 4CFSA 5E4JA 4DGQA 3GBSA 1ZIXA 1K6EA 4N8EA 2XUAA 3STWA 4KEAA 2YH2A 3F8SA 3R0VA 4P08A 4ARAA 4QWWA 1QFMA 4RE5A 4FFWA 1QGED 1XRRA 2D5LA 3WLAA 3QVMA 1E8NA 1CUYA 1LPOA 2JIDA 4AMYA 3OC0A 4PV7A 4TPKA 1S8OA 1EHYA 1AC5A 2WIKA 2VJCA 3STXA 2O7VA 2HA5A 1ETHA 1XKTA 1USWA 1OILA 3TGLA 5A2GA 5ALEA 3FYUA 1XKLA 4C4YA 3QH4A 1CUIA 4QDZA 4X7BA 4OYLA 5ALUA 4OPMA 1IVYA 1IUPA 2JGKA 4LIPD 4JYMA 2Y6UA 2FJ0A 3HABA 2HADA 4K2AA 2OCKA 3O9MA 3FLEA 4J03A 1TIBA 1UK7A 4B9EA 1ZJ5A 4Q3KA 5DTJA 4B80A 4ZWNA 2WFMA 2WG2A 4YX9A 1EI9A 3Q8WA 5JD5A 4YK7A 3WYNA 1UZAA 3JWEA 4H7DA 4X6YA 5CH8A 1YASA 1QIIA 2VAXA 5FLKA 3BDIA 2WILA 1YS2X 4H7FA 2OAEA 4Y2UA 1EH5A 4ETWA 1BU8A 3QYJA 5IVDA 3PFBA 1HQDA 3D0KA 3I1IA 3GA7A 3HSSA 4U2CA 3BIXA 5LZ4A 2PPLA 2EDAA 3NUZA 3ESBA 5AM4A 5LZ5A 1E3QA 3STUA 1ZGCA 1QE3A 1F0NA 3ESCA 5HF8A 4H7KA 2B9VA 4KACA 4Y2PA 4DMCA 2QJRA 4U2BA 1I6WA 3AUKA 2PSJA 3BJRA 2H1IA 1YA4A 2DQYA 4D9JA 1ZI8A 2VEOA 1JJFA 1ZGBA 1MJ5A 5LZ9A 5ALSA 1BROA 2WIFA 1XRQA 2AXEA 5CBKA 4GLBA 2XMQA 4HVTA 4BZWA 1CEXA 5AKJA 2ZSHA 2Y2UA 4PNZA 4XVCA 4YPVA 3FLBA 1VKHA 1X2EA 4OYYA 1XQXA 4AO6A 3OOSA 1PFQA 3M3DA 4H35A 1VA5A 3F96A 1G42A 1QTRA 1UK8A 4CG3A 4QEKA 1CUJA 4AN0A 5LZ8A 1CLEA 2J3QA 2XQKA 4NS4A 5KWJA 3QPDA 2G4LA 3FLAA 3HACA 4QLAA 4WFIA 4H0CA 3QM1A 3HJUA 3ICVA 5AM1A 3I2JA 3KWFA 3DYVA 1QZ3A 1H2ZA 3O0DA 1ZD3A 2V97A 4Q34A 2QUBA 3VJKA 2BAGA 4FBMA 1XZFA 5AOAA 3H2GA 1G5FA 1LPMA 1MO2A 4IH4A 1PJAA 1JMKC 5ISMA 3WK7A 1H23A 3H18A 1JU4A 3CCCA 1TKRA 2IX9A 2VA9A 5FXMA 2VJBA 1RYYA 4BYMA 1EX9A 2HA2A 4N8DA 4MQLA 2XDWA 3R3WA 5C7YA 3DLTA 4JYPA 2BUBA 5AM0A 5DWDA 2DFPA 3BL8A 3R41A 5AIBA 1RP1A 1UFOA 5JD6A 1BN7A 2W6CX 4Y2JA 4KE7A 1Z68A 4MXDA 3ZV7A 4JEIA 3W06A 1EA5A 3WA6A 3KOOA 1D07A 4EY5A 2VSQA 1E89A 4N5HX 4BP9A 2ECFA 4BP8A 1C7IA 3HEAA 1YB7A 3H19A 1K63A 3DD5A 1WB5A 3IUNA 1DT3A 4G5XA 4CI9A 5AOBA 3DOIA 2O7RA 3H1BA 2H7YA 4ARBA 3WL6A 2BUCA 5LZ2A 1GKLA 3WWPA 1L7AA 1SCQA 2ONCA 2X5XA 4QE3A 3S8YA 4GI1A 3DOHA 4UBMA 1YSCA 3VVLA 4ROTA 3V1NA 2RGUA 2DSNA 3VJLA 5JALA 1GGVA 3BXPA 2XUIA 3WWEA 3ESAA 4QDUA 1JKMA 2OQIA 2PBLA 2QOEA 4B81A 4PW0A 1CFJA 1R3DA 5K3FB 2BCEA 4HXGA 3WL7A 1QO7A 3HRHA 1LBSA 3WWCA 2AJ8A 3LP5A 3JYHA 1XZLA 1C4XA 2OLEA 4G4GA 5A7FA 4UFPA 5FP0A 2QZPA 5IKXA 4JNCA 5HF6A 1H22A 5JZBA 1AURA 1QIKA 4IH1A 1QO9A 4UBIA 2HM7A 2XMGA 4AN1A 1CUGA 4U2GA 4BE9A 1J06A 2WHPA 5J3JA 2HA4A 1VLQA 3G0IA 3I1YA 2ACKA 1CUAA 5A6VA 1J1IA 1SC9A 1MAHA 3ICWA 1TCBA 1XZDA 5DNVA 3SC2A 1CUVA 1T2NA 1P0IA 2OCLA 4UHCA 5K3AA 5ALPA 1KU0A 2P8SA 2QUAA 2HHAA 1UOQA 2IIVA 1WHSA 4LXGA 2PSFA 3G8YA 5KBYA 3WJ1A 1WCYA 2ACEA 4H7HA 4C01A 5DTIA 2ZJ6A 1OXMA 2ZYIA 5FKJA 2PU5A 2HU7A 1LPSA 3H2KA 3C6YA 2CBGA 3AINA 3EF3A 1DWPA 5AH0A 4DIUA 3WJ2A 2WUDA 4L0CA 1XZIA 3M82A 4K6HA 5T4HA 3E4DA 3AZPA 2WUEA 3G9XA 4J0HA 5K3FA 2J4CA 1N8SA 1DQYA 3G02A 2ZJ7A 2RAUA 4GHWA 2AJLI 4BAGA 2RIPA 4OUKX 4G1FA 4QDXA 3DNMA 1XROA 4BB0A 3O4JA 5AKXA 1R50A 2C5FA 3NGMA 1TCAA 2HU8A 4KE9A 3STYA 2RHTA 2E3JA 3QBJA 4X90A 1FFBA 2QTBA 3HI4A 5AI4A 3FWHA 4N5IX 3W2TA 2CEKA 1AZWA 4UFOA 2VATA 2V9ZA 2XUHA 3VJMA 4FLMA 1W76A 5CT4A 3AIKA 3BE8A 4B9AA 3C45A 1C7JA 2D0DA 5ALQA 3IBTA 1Y37A 3IURA 1CR6A 3DJYA 4GXNA 2CZQA 5ALTA 2VF2A 2C0PA 5JAHA 4UHFA 4ZV7A 3DDUA 4PQEA 3RARA 5JYCA 3FVTA 3WA7A 1HLGA 5HF9A 2ZSIA 2O2GA 3C5VA 3WK8A 2GBFA 4ZI5A 4CCWA 4NVRA 1ZIYA 4EUSA 7YASA 5CT9A 4EY6A 5IVHA 2AJCA 3C6XA 2J3DA 1VXOA 3PI6A 2ZYSA 3V1LA 2I78A 4YASA 1AUOA 2XMBA 3G0BA 3ZLVA 2WKWA 1QIHA 4XIIA 4FWBA 4UHHA 4RPCA 1LGYA 5FPPA 5AM3A 4QZVA 3R3UA 4HZGA 3AFIA 1EINA 5CT6A 2HA6A 1CQZA 3ZLUA 2DHEA 3I2FA 4X85A 2WG1A 3FYUC 4UHDA 3F67A 4E15A 4DM7A 1XRMA 2CB9A 5EI5A 3K9BA 4PO3X 4V2IA 3QPCA 5E4YA 4X3CA 3B12A 1GQSA 3F9CA 4LKOA 2YXPX 4W1PA 2PX6A 3G0GA 3D2BA 4J0IA 4IH9A 2C58A 1CQWA 2WU3A 2ZYRA 2QRUA 3FNBA 3O4IA 5D3ZA 3B5EA 3SK0A 3FAKA 5ALRA 1O6GA 3GFFA 4DMFA 4GW3A 3WK5A 1LPBB 1JJIA 2Y6VA 1IUOA 4I4CA 3I6ZA 1UT6A 2NW6A 3FBWA 3LLCA 5EIAA 4M0FA 4Q3LA 2DQZA 1MNQA 3WWOA 5C8XA 4GWLA 2OQVA 1M33A 5BWBA 1E66A 1FSSA 1UXOA 5JANA 5JAPA 2XQIA 3G9TA 1IMJA 3ANTA 3D2CA 4AXBA 3RKSA 2RHWA 3A70A 4MYDA 4J0GA 2ORYA 5AK5A 2H7XA 1MPXA 3O4GA 2XMDA 5ALGA 2H7CA 1VA4A 1Q84A 5K5EA 1T4MA 3MUOA 5CH5A 4XX1A 5HQ3B 5BOVA 2BJHA 3STVA 5FUMA 2XT0A 1AX9A 5ALMA 3ZI7A 2XUPA 2VQ6A 1J07A 1GPKA 3R3VA 5CT8A 2QXUA 5CXUA 5AKKA 5DNUA 1K4YA 2G5PA 4IQ4A 1H2XA 3DL7A 1QJ4A 4FTWA 2EDCA 4W63A 1QOZA 5AKLA 2XI4A 3KSRA 4X91A 1K8QA 4QNNA 4BC1A 3NWOA 1R88A 4L9AA 2XUKA 4BCBA 5D7BA 3DS8A 2WG0A 3E3AA 4CCYA 1GQRA 4IHAA 2GYUA 2XMRA 3A2LA 4KJXA 5LP1A 5AK6A 1SOMA 3I2IA 1P0PA 2PVSA 5T4EA 5ALDA 5ALKA 1ACJA 4OCZA 1R9MA 5A71A 1J2EA 1W4LA 3L1IA 4FLFA 1RWQA 3FCXA 4RNCA 1HBJA 5JATA 1F8UA 4C6HA 5AI6A 5AK4A 3BIWA 3GUUA 5JZSA 3ILSA 4CIAA 4UBNA 3GROA 5ALFA 1YCDA 5JZ9A 1CIJA 2XE4A 2XUQA 2GBGA 5HK8A 1G4HA 5I8PA 4B82A 2B20A 5AKEA 5JADA 4G8DA 4EY4A 4DNPA 4KRXA 1XRNA 1ZI9A 3WKBA 1LNSA 3QMMA 2BGNA 4ZRDA 1SCIA 5K3EA 4DTCA 1Q0ZA 2WTMA 2C5GA 3C8HA 2XQJA 3RLIA 4QLOA 1VE7A 4E11A 5K3DA 3TRDA 4BZZA 1CPYA 4FDMA 4RGYA 2EEPA 1XZKA 4W1QA 4BTVA 4AX4A 4KAJA 5EFZA 1NX9A 1QONA 3P2MA 3WMRA 4KR0A 3L1JA 1W52X 3WK6A 4J0CA 1CUHA 1ZI6A 4U2FA 3OURA 4W1RA 1JU3A 3K2IA 5D6OA 1K5PA 2IITA 3PF9A 5AHXA 5I9IA 1TRHA 2JGIA 2QMQA 1U4NA 3HYSA 4M0MA 5EHQA 4UPDA 4HS9A 1N5MA 5FDFA 3E0XA 4GBGA 5C81A 4X94A 1TK3A 1AQLA 2QVBA 4AQDA 2O2IA 1WPXA 4G8CA 4C87A 4GECA 3AILA 5DNWA 2PUJA 3WIBA 1FFDA 3V1KA 1YR2A 1DX6A 3EIOA 4WY5A 1XQVA 1ZOIA 1ODSA 1BRTA 3GZJA 4ZREA 3ZPXA 5LIPA 1Q83A 4XJVA 5CH3A 3CN7A 1X70A 4A23A 1B6GA 5A7GA 4B6GA 1NU6A 2PM8A 3KWJA 2OG1A 2Z3WA 4WDRA 4KAFA 2C0QA 3VVMA 4EB0A 4F5ZA 2WM2A 1XLUA 3F98A 2HFJA 4DSZA 1THTA 1A7UA 2JGEA 4JH0A 1AGYA 4X93A 1FFEA 2WIGA 2AJDA 1O6FA 4Y2TA 2Q0XA 4FBLA 5AM2A 2G5TA 1KEZA 4TGLA 4Y2RA 1XFDA 4UFNA 4Y7DA 5ESRA 3IUMA 2Z5GA 1ORWA 2RONA 4OU4A 3FYTA 5SYMA 3WWDA 4RE6A 1IUNA 3W04A 4E46A 3O4HA 3IDAA 3GELA 4FNGA 2WJ3A 4AO7A 4Y2XA 2QKYA 5CTAA 3A6ZA 1MTZA 3C70A 1Y7IA 2X76A 3G9ZA 3OM8A 4MWSA 4BRSA 2HU5A 4INZA 1XZJA 2WUGA 3I2HA 4UHEA 4X97A 3C6ZA 4Y2SA 4LHEA 4BC0A 3FCYA 2PSDA 1DT5A 2W22A 2WJ4A 4B0PA 3PDCA 1DQZA 3QMWA 2VTVA 4BE4A 2HIHA 4Y2QA 1XZHA 2WLSA 1A8SA 3C87A 4OB6A 3LCRA 1SFRA 5C8VA 1MN6A 4EBBA 4HXFB 3V1MA 3ED1A 4C4XA 5AI5A 5BWCA 1FFAA 5KREA 4GEGA 3VXKA 2PL5A 4BCDA 1DWOA 1U65A 4MEAA 3HZOA 3WKDA 2GYVA 2QT9A 3V48A 2OXEA 5A7HA 4G9GA 1NU8A 2Y1KA 3FSGD 4BVJA 1PV1A 1VE6A 3S2ZA 5ALNA 1R1DA 4AB1A 2QM0A 1QIEA 2YASA 4EHBA 5E2IA 3OTQA 5HF5A 4UBOA 3BF8A 2HA0A 2WQZA 2G63A 1G66A 5AKIA 1VJ5A 5K3BA 1X2BA 3H04A 3W9BA 3G0DA 2XLCA 4G9EA 1W75A 3AJAA 5T4BA 3KXPA 3CXUA 2CMFA 1QIFA 2JGMA 3HC7A 1EDEA 1CVLA 2O2HA 3PUHA 1LZLA 1CUEA 3CCBA 4A5SA 3UMJA 3DKRA 1YAJA 4HXEB 4Q3OA 1LPNA 5CW2A 3DEAA 4A16A 5AKZA 3FYUB 1R4ZA 3PF8A 1TAHA 5SYNA 3U0VA 3R3XA 1XZMA 1EK1A 3FVRA 3LS2A 2WHRA 5ALZA 1AKNA 1A8UA 2JEZA 1CUUA 3V9AA 5LLSA 3LIIA 2GBCA 3T4UA 2PUHA 2H9YA 4BAZA 4U2DA 4B84A 2XLBA 5HFNA 4CG1A 1CUXA 4F21A 5CRIA 3R3YA 1BCRA 2ES4A 1GKKA 4BVLA 1DWQA 1WOMA 5AO9A 5CT5A 1LPPA 4ZXFA 4TVKA 3CN9A 2WFZA 3ZLTA 5HZGA 4Q05A 3MGAA 1XLWA 1E8DA 2QR5A 4WJLA 1DU4A 1EXWA 1E5TA 1H2YA 4ZV9A 1LZKA 1U2EA 3WZMA 2FJPA 2UZ0A 3SWWA 3H0CA 4PSCA 5AK3A 5A62A 3O95A 3D3NA 5ALIA 1DINA 1ZJ4A
chains in the Genus database with same CATH superfamily
2B4RO 3QKIA 2ZUSA 1A04A 2ILTA 3GJQA 1O97D 3IVRA 4U8HA 3RHTA 5ITVA 4RKQA 1UAYA 3L0YA 5KSOA 2XQGA 3ZWOA 3JWGA 3PXBA 4U0KA 4PWYA 4R3UC 5H59A 4ZKEA 2KM1A 5F35A 2P1RA 2X22A 5ALJA 4Q1BA 1Q7BA 4ZDJA 1A96A 4LG1A 1V8BA 2C84A 1ZRSA 2HRCA 4EY8A 3AFNA 3K35A 2V96A 4OJQA 4Y8VA 3COJA 1BCSA 4QBFA 4NCJA 3H5NA 4IIFA 2DCUA 1ILWA 1GUFA 4Q1VA 1QVWA 1CG6A 2AG6A 4OHZA 2NQ2C 4CGYA 1NLZA 3KQUA 5LQJA 2H65A 1KEEB 2EWMA 1I3CA 1QVVA 1N57A 2ZAOA 4PZDA 1QE5A 4XSGA 2QU8A 1ZRNA 1IY9A 4YMWA 3A1DA 3FOBA 4YRRA 2NT3A 1WUKS 2EG9A 1WB6A 1P0MA 3RRJA 1SVWA 4W6ZA 3U4QA 3MNFA 5LLTA 2DHRA 5HDBB 4GSKA 5F23A 3KB2A 4HDCA 4ZPJA 1C9YA 1MDBA 3AJ9A 4DUGD 1GIAA 4XR9A 4EJSA 1T5HX 3ABRB 3A3KA 1MLDA 2O3JA 1QU3A 4HYYA 2ZK7A 1N2JA 1R4NA 2ZS7A 4O4LA 5CURA 5K4AA 4KRYA 1VOTA 3WGQA 5DZSA 3WYAA 5FBZA 3K0KA 3IUPA 1T9HA 2GNPA 4QUHA 1CUDA 2AHRA 4BCCA 1L5QA 3AZQA 2XYRA 4KQ1A 4HVCA 1RXCA 1VE1A 2NO9A 4NY1A 1HKHA 4NRDA 2VCYA 2FWJA 4UQPA 5JBNA 1KO4A 3GOQA 3H7IA 2WZDA 4P82A 1LRJA 3KYCB 1NYLA 3WGOA 2H8GA 2WV7A 3RJTA 1YACA 1MX9A 4F6CA 4MUJA 1VCNA 3QEMB 1OLUB 4ZT6A 3SNHA 1Y9ZA 1IXSB 2GCGA 2PD4A 5FQOA 3ZDCA 4B76A 3NTVA 5CNMA 3MIIA 1XLVA 2F9LA 1W581 3R6GA 2PQMA 2OYCA 4AY3A 2PIDA 2DR0A 1JP7A 1GT6A 3FYDA 3U0BA 4DMKA 1JJBA 3OJXA 5JYDA 5IN5A 2OSBA 1YRHA 1AZTA 2A9FA 4FFRA 5EHZA 3SNKA 2PX2A 3ETLA 1EU1A 1L4FA 1NQ5A 3NNSA 4PVDA 2FLVA 2VP0A 2OZLA 3DZDA 4ALIA 2K4MA 4U5QA 3VO1A 4BLWA 3N6XA 4EA8A 3DBVO 1HXHA 1M73E 2TMDA 3W5JA 3ZW7A 2KWIA 2Z8XA 2XJ9A 2WDPA 2AOUA 2J9YB 3KYDB 1TMOA 3RK0A 1OREA 1CUBA 1KKLA 3BX1A 3VX3A 1BDBA 3BMNB 3LT2A 3AIIA 2EHJA 4C6SA 1MIHA 2QP9X 3JR3A 2PU7A 5KVQA 3RUCA 3KSAC 5TARA 1GCIA 5FPQA 2ZROA 2BFPA 3GA0A 4G4JA 2ZZKA 1VL6A 2ZYDA 1HQKA 3OZIA 4OSEA 4J76A 3R3JA 3WGNA 1I3KA 4BO5A 2AQKA 1PEKE 3NT2A 1C0PA 3LIPA 2O5VA 5JS1A 2LRHA 1FW8A 1D5CA 2ODAA 2WAYA 3REQA 3TZCA 3SFZA 2Q9UA 3PNQA 2G04A 4JHLA 2JI4A 3LQ2A 5KVVA 2OV4A 1LEHA 4PYMA 1IZ9A 3MCUA 1TYEB 5F4ZA 5K0LA 4EO4A 1JG6A 2R6FA 3PC2A 1V3TA 1P80A 3OM9A 4TS4A 3WQBA 1RXYA 4DC9A 3OIWA 3PKZA 5DI3A 4QA9A 1OIVA 4AZ0A 1UPUA 1GPWB 3OEHA 4GO1A 2XA9A 2ZAYA 3IAAA 3T4PA 4XFDA 4NZZA 4O2RA 3A9CA 2QQ0A 4JQOA 5H70A 4BGVA 1GN8A 2J3HA 4TYQA 3P0HA 1HLPA 4AUMA 1JEYA 1Z6PA 3P2YA 5K99A 1FVFA 3WGVA 1BVYF 1HDOA 1ORVA 2FR8A 1U8AA 4HSEA 4OI4A 4DA4A 2ZSBA 1CB7A 1F2TA 3GX1A 4N1AA 1XU4A 1YZLA 1KDPA 5LQKA 2FG7C 2C8LA 3OIVA 2UZIR 2KSQA 3BICA 3GEIA 5CK4A 5LLDA 2CNLA 4WL0A 1Z4JA 1BYIA 1NYTA 1FRZA 4V3CA 1XJQA 2YWHA 3FGZA 3ENVA 4EJSB 1TJNA 4BWFB 5L40A 1IK4A 1TF5A 4N0PA 1RBQA 2WE8A 1PEAA 1X7XB 4OQDA 3DULA 2YJ4A 5FBQB 4EGFA 5CEFA 2YV4A 4G36A 3MZ0A 3QWAA 1H6AA 5H9VA 4HYEA 3SBXA 3VAAA 4RY8A 1E2HA 1B6SA 3JWIA 5FOUA 2FPIA 3VKGA 1Z2CA 4LN1A 4G63A 1LWOA 4OJTA 5DYIA 1WUJS 5F5NA 4GG1A 1JPVA 1T6XA 4H6VA 1JQ5A 3IILA 1QG6A 4NL4H 5DMXA 3WQHA 1U6JA 4BRUA 5KTYA 3SHVA 4N82A 5LKRA 3G7NA 2P2DA 1I6LA 3VSAA 5JEDA 1PQUA 5FPSA 5E6RA 3ZWCA 4FCVA 2PKYX 1RVDA 2R8EA 3AYXB 5FWXB 1B1CA 1EXNA 4KGZA 3WQSB 2D7JA 4UBJA 2WFLA 5CYFA 5TT0A 3UWPA 4KIGA 3WOVA 3FFBA 3DUFA 1G55A 4FYVA 4YAGA 1X0XA 1MG5A 4IFTA 1SMKA 5JH7A 3KZMA 3WZLA 5IKOA 4XIYA 3F5DA 4TV9F 3WNDA 1BKSB 2ESRA 4JQYA 5ULLA 2QAGA 4L16A 3KKPA 1JFFA 3TUJC 2AOWA 3U7HB 5G4KA 4MRRA 1DKOA 2J32A 4GI2A 3DZFA 4WESB 2FFAA 2IHZA 5AHOA 4GDFA 3Q0TA 1P9NA 2LIPA 3VZCA 4BO2A 1VGRA 1OKKA 4O1HA 4IGAA 4X00A 4XQ9A 3L8GA 1IVSA 2I2WA 2P69A 2ZVJA 3MK31 1ZXLA 5H3HA 1Q1EA 2WJJA 4V2UA 5EP2A 4OUDA 4TM7A 1NBMD 5A9RA 5HJ7A 1WVMA 2OXFA 2BMAA 3FW1A 3W5IA 3VUEA 4YGYA 4RDIA 3GR6A 1Q7CA 1E4VA 1DS6A 1FC0A 2FOXA 2VPQA 4MQFA 4UXJA 5JPDA 5JVDA 2JDIA 5J5VA 5A1TA 1U0GA 3FTFA 4RCZA 4EA6A 3OTHA 1JKIA 3FA2A 1BSVA 1ECBA 1W25A 4HRYA 4XI9A 1M2FA 1PUJA 4NULA 3KOZA 1JVNA 3CZQA 1N6IA 2D1FA 2R62A 2NTYC 3NP7A 2FEOA 2Y1XA 3CZMA 5DNAA 2O57A 3ZE0B 3LGXA 5B2ZA 5JIBA 1EVKA 1JQLB 4CCAA 4P5PA 4CF6A 4OB8A 3GFGA 3KJFA 3B70A 1JEAA 4JB2A 4LRWA 4MJ7A 1GOTA 4KUHA 2A0YA 4YUVA 3UMRA 5KWIA 2JGDA 2JF0A 4OXRA 4TYWA 4I5FA 2Y1LA 2RDMA 1CNMA 2I03A 2HQOA 3EXIA 4AJPA 5FV4A 3KR9A 4INPA 5KTSA 1T5TA 1JG2A 1QVRA 2EW1A 1KDYA 1AXGA 3CMCO 4O08A 4CDRA 3GRUA 3K92A 4E70A 4B3DA 3KOXA 2GZ1A 4OHWA 1JT2A 1EHIA 1VGVA 3YASA 4JGGA 5I9TA 2BJVA 2HJWA 3TEJA 4OSPA 2R1VA 3QITA 1J20A 5REQA 4B34A 4EYEA 1RPJA 1DHTA 2ZBDA 3OQHA 1NRXA 3KJGA 4AWXA 1OLSA 2ZIUB 1ZVQA 2R751 2PBZA 4BS9A 1ULBA 4IXNA 5GZ1A 5KNDA 2W11A 4K3VA 3ET5A 4HQOA 4LQLA 2O5RA 3VKFA 3EQ2A 1RQLA 4YS6A 4JI2B 3ZK9A 1PEYA 1T0UA 2Y2VA 2AI3A 3OH8A 1EZ4A 4H7JA 2Q6LA 4AX8A 3B1JA 1K0FA 1X0VA 3Q40A 2EZ9A 4OV6B 4PCAA 3EVDA 5ELXA 1LQUA 2FMIA 3UUEA 3TQIA 1F0PA 3C97A 4LJ6A 4LJAA 1PZNA 4I4LA 4XGKA 5KU1A 1GXSA 1XDSA 3HP7A 2NZ8A 2ODEA 4JU9A 1VZ3A 3PPVA 2PUVA 1EWTA 1TF2A 1B41A 1E2GA 5D3KA 2B1RA 3ZY3A 4MQEB 3W5HA 3LC0A 3SXJA 4FMDF 5MFZA 5K3SA 3MOGA 1HSZA 3I6IA 1QM5A 4IGKA 4LWPA 3U7RA 3VAZA 4M7PA 3OEWA 1CVIA 1Q50A 2CZCA 2D8AA 2JGFA 2Q5HA 4NECA 2OEPA 5EPOA 2IV2X 5A02A 5IZCC 1GZUA 1X77A 3ID6C 1E9EA 2IYWA 1RE0A 3WK4A 1Q5PA 2NX2A 4PYIA 3EIXA 4JGBA 4O4IA 1KETA 3USCS 2FZWA 3KNZA 1UKAA 4P92A 5LZ7A 2XZOA 1L7RA 3JX9A 5GGYA 1P77A 2QGZA 3UICA 1N5RA 3GJ6A 4H0FA 2ZBRA 3GLQA 3O5AA 5DXJA 2VTBA 3HJBA 3TN7A 1POXA 4GP9A 3L04A 4D6XA 3T1YB 1SUDA 3GJ8A 2QK4A 3KLOA 4QYWA 3E8XA 1PX2A 4KDFA 5BUQA 2VJQA 5K0SA 1TYZA 2CY0A 2QJWA 1PJ8A 5HRUA 3G2OA 3EEFA 4U9HS 2NXNA 4IM7A 1YR9A 1Y8AA 3QFHA 4L3OA 4MEJA 2HJVA 1HE3A 1O9GA 4BO1A 4RANA 4F4UA 2ZS8A 1T13A 4JVMA 5GVSA 4B75A 3AI1A 4HTAA 4LW8A 4AMUA 1JPJA 3GEBA 4BRZA 1M0WA 2VJAA 2ZWOA 1MGOA 1LSJA 1RQGA 2ZSUA 2WEKA 4DKJA 1YF3A 5TQ0B 4HDSA 1GA1A 4PG6A 2O8CA 2C2WA 3WFZA 1LBTA 1PJQA 2GEJA 2WD8A 2IZ7A 5T4FA 2X0DA 1DOHA 2H8KA 1T25A 5DYYA 1BD3A 5GP1A 2PYDA 2RH9B 4LYFA 1GCUA 2FQXA 3H75A 1ZMTA 5DLQC 3VHRA 1GG8A 2J0QA 2MHCA 4U2KA 2QT0A 2QL7A 2Z9BA 5ICMA 3EBLA 2EJVA 2CJPA 5LXTB 3O3OB 4WA8A 1VB3A 5CDUA 5KOHB 4A0HA 1ISJA 2JGDB 4GZ6A 1TJ5A 4JXJA 1YFLA 3U61B 2OGZA 3PVCA 4S12A 5JZOA 2A9VA 1JLMA 2BFNA 4KAAA 5LYYA 4RK0A 4YMSA 2GD6A 1E60A 2OCBA 2WKRA 3RTEA 4BNVA 2GK3A 4YYEA 3VKUA 4IDPA 4ZYXA 5LYJB 3IAS1 1TIPA 1N2OA 2BHLA 4RQTA 3HCPA 2XUOA 3GU3A 1K3FA 2Z8YM 2E4WA 4HH3C 4PZZA 5J63A 1UPCA 1NW3A 3U4HA 3VYRB 1J00A 5IWCA 2I8CA 3NVKI 1C0EA 2E37A 3I2GA 2JAUA 5JSQA 1JFRA 1SRRA 1W2HA 2QYOA 4GXQA 3S81A 4QVKA 4H6PA 3AVQA 3H8JA 1V1RA 1QIDA 4CPDA 2J9ZB 3HXOA 1IY0A 5AVUA 2LGJA 4P80A 3QBTA 4MX8A 3RSHA 1QX3A 4DRZA 2F55A 5CXXA 1EK2A 4GEKA 4C6TA 4DLYA 3KB6A 3TX2A 2UZAA 3QWBA 3DVAA 4DA8A 4N18A 1XTVA 3DBLB 2E7ZA 4BBZA 1U0FA 1AVTA 2H57A 2DWOA 5DLDA 2ZIWB 4D9GA 2GN6A 4GVPA 1ML4A 3A4TA 3E82A 3R23A 4BNZA 1Z83A 5EZ5A 1NVMB 1I51A 5C2JB 5JMTA 3GFBA 4AMZA 3CF2A 4REQA 1NONA 3RYFB 2QROA 4PRLA 3R44A 4TUYB 3ZR4B 2VQFB 2A1TR 1SA0B 4IEEA 5J4KA 4ZVNA 4MDYA 1YS9A 4E5PA 1JKFA 4UBKA 1EZ1A 1T43A 1KAQA 5FBWB 2RC5A 3KDAA 3COWA 5CCBA 5A9SB 2ZIVB 4YI5A 1IFXA 3HFJA 1NF9A 1L0BA 3BL5A 2CNWD 4QUDA 3TEFA 1J1UA 3R3ZA 3FRHA 2FTKE 4ZAZA 1U9JA 4BJ1A 1HDEA 1AGPA 2I54A 1U1EA 2H54A 2JEYA 2NVOA 2P6UA 2VF4X 5DHUA 2SHKA 3BZWA 3ZBTA 3B9PA 1EDBA 2PX5A 3HQ4O 4FKBA 4YJ2B 5D5PA 5KKCA 2NIPA 3AERA 2V8OA 3GCWA 3L4EA 3QEOA 3X2EA 2JLXA 4X6XA 5TMDA 1IULA 4NH4A 1QR2A 4BFUA 4BZPA 2WHQA 3BEOA 4OU5A 2EX0A 1JHRA 2QD4A 2JJ1D 3P0FA 1T3TA 2QMZA 3L6CA 4HNSA 4JLPA 1EQ2A 3INNA 4N3BA 4YRCA 5E3IA 4IV8A 1I80A 3PHJA 4BMOB 3IAEA 3RUIA 3PUIA 2HF2A 3Q1LA 5LBIA 3UENA 5CDHA 3PNVA 5KYWB 3DBRA 3WY9A 3C6BA 3M1AA 2YVLA 3KKNA 4TLBA 5AKGA 1G16A 2PSEA 2AFHA 3I6YA 1BXGB 1DDOA 2BR4A 3KHUA 3MPOA 3ND9A 3LT1A 4GYYA 1YT5A 2OVBA 2YBDA 3NANA 3SS8A 3NTRA 3D7RA 3ZHBA 4DCGA 1WL8A 5BSEA 4KXFB 1PGNA 3GV0A 1JA0A 3P97A 1GCGA 3D8RA 2X0KA 4ZVQA 2PGDA 2RGNA 4IDBA 4B6EA 3DYIA 1P2BA 5E4TA 5ITZA 3GEPA 4XCXA 4U39A 2NYAA 3QZUA 5IT9A 1EBBA 2Q3LA 4LYHA 3LCMA 3N39C 1CLUA 3QEMA 1FYFA 5HIKA 1C81A 2YR0A 3FCAA 3LF2A 3AR6A 3RRNA 2VI5A 4ZVRA 3FIUA 3P27A 3PUKA 3H5WA 1IZYA 3OTOB 4WXYB 4YQEA 5TRTA 4D92A 1I1QB 1SXHA 1VFNA 4NFSA 1JYFA 5EIEA 3DA8A 4MICA 1XN1A 2WJWA 3BIJA 3VNRA 2X4LA 4TWRA 1AKWA 4BFLA 2XEXA 4K6CA 4ZYYA 5JAMA 1NULA 1TE2A 1JKJA 1UFQA 3CZAA 2OGTA 3FTDA 1NR1A 3D6AA 4ER3A 2HCJB 1L7NA 1NHGA 1MC1A 1Z8FA 2Y67A 3MT8A 4HDNB 3JARB 4FB4A 5BWLA 3PC7A 4OK6A 1DFGA 4BVEA 4N3CA 1KI3A 4FS3A 4IRXA 1YS7A 5ERXA 3VHLB 1SK8A 2YHIA 4ZDKA 4Y2VA 4MKZA 4CQNA 1EVQA 2H5LA 1ULHA 2QRNA 3DQQA 5EGSA 1KJJA 3FOCA 3OIFA 4WDQA 3OZUA 5KTRA 1KJ8A 2E21A 1IEVA 1Y5MA 4UUOA 2K2QB 1QIGA 2YMMA 4NYIR 1SULA 2B1IA 1BEUB 4KC0A 2XUJA 4KQ2A 4RX1A 5GIOE 4H3HB 4OY3A 3IVMA 5DLPA 4YV2A 1UM8A 3VAYA 1HUQA 1PR0A 5H9WA 3CKYA 3PUXA 3N0VA 2XDQA 4GAEA 5B3LA 5K9ZA 2XVZA 4Z7NB 2BGRA 1W29A 5EE3A 2NADA 5K3CA 3S28A 4E4RA 5G02A 1B0PA 1MJHA 2A4KA 3OJEA 4GM1A 3UJPA 2KW5A 2IVZA 1Q0RA 4KVFA 5EAIA 2Q3EA 1XP5A 4E1VA 5A4IS 6NULA 5EHNA 4B3RB 4BNUA 4YRFA 1JWAB 1U99A 3CZRA 2YMPA 3ETNA 3N6RA 4PZ9A 1UKCA 3BZBA 5EHXA 4FDLA 4G5QA 3JASB 3L6EA 5D01A 1ZOPA 4P7KA 3KE8A 5EJ8A 4EI2A 1V3UA 5CFZA 1UBKS 2ODTX 1A9TA 4IO0A 1JQAA 1Y8QB 2VPPA 2EFDB 4CTKA 1OWPA 1THGA 3OQIB 3TTYA 3FMGA 4PGGA 2YZNA 1WDKA 4FHCA 1AMNA 2OBXA 2OUIA 4AK9A 5DM60 1ZGZA 4GOXA 4L95C 3PFIA 5ALOA 4DQKA 1RWPA 1CUFA 2E85A 4RACA 3NS7A 2IEIA 1VRWA 3DVRX 4ZTBA 1BDHA 2O8BB 1XQ1A 3A3NA 1VPDA 1MNAA 2DT5A 1D1TA 1FP4A 2BKXA 2QP3A 2VDOB 3P0RA 1VP3A 1IEQA 3WL4A 3FNFA 1B73A 3D5EA 1OLXA 3ZHOA 4AQYB 5KOJA 4ZD6A 2CL5A 3THOA 5L4NA 1FXUA 1YBHA 3H5IA 1HM5A 4IFEA 1MC4A 2R47A 4S2EA 2IU3A 2P9JA 5L4LA 4DMUB 3NBYC 3KZXA 1H2RS 3FB4A 1XBTA 3JQDA 4Y1RA 4B6RA 1NAIA 1E4YA 3HU3A 3OICA 4L5CA 4JN6B 2WWGA 3CZ5A 1CY6A 3E3OA 4XTRA 2EARA 1RAHA 1TA9A 4WZBA 4JODA 1SCUB 3B7WA 1C1XA 2WTNA 4OXQA 3UHFA 4B43A 4UUPA 3MSCA 4Z99A 1I0IA 1Y1TA 1I6MA 4OGLA 3BULA 5CA1A 1VHJA 3GAZA 2CFTA 5E4JA 4MI1A 2EZ4A 3HS3A 1R6XA 2D3TA 2AXPA 3KJNA 4BB9A 2NZYA 1HE4A 2PKWA 1V5IA 1A27A 2CVZA 2I1LA 2QLMA 3ZC3A 1DIAA 1WMDA 3TLXA 1Z36A 1ECFA 4X44A 1GA6A 1HE5A 4XQ0A 1H2BA 1ZIXA 1BJRE 4HSGA 1K6EA 2FQ1A 4Y0NA 4DVJA 4DDUA 5CD9A 1EUZA 1H8EA 3U7JA 2R0QC 2IH2A 4L73A 5K6AA 1XDDA 1KIAA 3CA8A 3V7FA 2GRUA 2QIOA 3JQGB 1E1RA 2QDKA 2I67A 2VBGA 3N2NA 1B43A 2FZVA 4RA6A 3PTZA 2NUAB 1FF9A 4URYR 3QU9A 3RDPA 1P72A 3TQTA 1ESNA 2Z95A 1I14A 1E6KA 4TVBA 3INTA 5DCYA 2ZTSA 3AEQB 1LS1A 4OAOA 4RE5A 2LPMA 5DWQA 3L01A 4CGZA 1U4SA 3UTDA 3AJDA 3MS7A 1XRRA 4IIYA 3EC1A 2NZXA 3WLAA 2PWZA 4MR9A 3QVMA 2VTKA 1P17A 1T2UA 2C3OA 3M1IA 4HDOB 1WX1A 5FOWA 1QNLA 4WKGA 3QNUA 3V1UA 5CD1A 1TMGE 4FMCB 1JQ3A 1E1QA 3AWIA 3LC7O 4ZHQA 2Z9DA 3SIXA 5B1YA 1AC5A 1KJIA 2WIKA 1K0UA 2NTVA 3ZWXA 4BMCA 2VJCA 4RD0A 5FOXA 4X1IB 2ADOA 3OFKA 2O7VA 2ZWAA 3OCXA 1ZGGA 2GA9A 1U9CA 2DWCA 2A9OA 3EISA 3G7SA 3MQ4A 4NCKA 3EWNA 3PFGA 3FAZA 1HE1C 3GWGA 2HZ7A 4BNIA 2OCXA 4HQNA 3K0HA 1L8OA 1T5OA 5JZVA 2J3MA 3SOZA 3R24A 3FYUA 1XKLA 3U3XA 3QH4A 1KIFA 5EG5A 1BFUA 3TMKA 2QTCA 2EKDA 4PGMA 4H4CA 2ADMA 5ICFA 3ZE1B 3G8CA 4OYLA 2OXIA 2IEYA 1IBLB 4OQFA 4JD5A 4LIPD 3JAKA 5IULC 4O8CA 1GTVA 4G0WA 2Y6UA 1L4NA 3A6DA 3Q3CA 1B8UA 2NYVA 4OJYA 5JD3A 4JJ8A 1UM9B 4IOJA 3C7KA 2C57A 3MGGA 5EA2A 1ZESA 3KTDA 3TLAA 4B45A 1MZPA 2ZW9A 3CM0A 3H87A 3P9CA 2YJZA 3HWWA 1QK4A 3FCEA 3I9V6 4KRGA 3PQFA 5IT0A 4YDHB 4M1WA 1JQDA 1UK7A 2XZPA 1GTG1 4M37A 4R1QA 2CLKB 2LP4Y 3OTGA 1TLLA 3DVSX 5EQDA 1N5JA 4PBRA 4KWEA 3IAM6 4XTCS 6LDHA 1MJFA 5CPFA 4HH0A 4PZLA 5COQA 2YQ5A 1R6TA 1OT5A 1C4WA 1EI9A 3Q8WA 4YK7A 3HFGA 1YVDA 3DO8A 3HXTA 3EIWA 4ZO7A 2O7NA 2FW6A 2ZQYA 1C1HA 4IICA 5BSKA 2EQAA 4I8XA 5M7EA 3LZCA 3L6UA 1KDRA 521PA 4HI0E 4TKUA 1CYDA 1QVZA 2RGCA 3R5KA 1ULSA 1GVNB 2VCHA 2WDZA 3AB7A 2HY7A 3BDIA 3UMVA 2L2QA 4RO0A 2CWDA 3CEMA 1C5KA 2XUZA 3EHDA 4OGKA 3HB0A 1UINA 4RH3A 3C74A 2AD5A 2G70A 5BSVA 3KYCA 5FAXA 5F21A 3IMFA 1XL1A 3L8ZA 4IIEA 1RKVA 4BV3A 3QYJA 4DANA 2G72A 4RV4A 1AK2A 3BK2A 2BHSA 4GYWA 5ES3A 2G8NA 5I7WA 1IN1A 1IYZA 4UD2A 2IYZA 4RULA 1EG7A 3DXFA 1HQDA 3KC2A 1DJQA 1WWKA 1YDHA 2SKDA 4PRYA 2P7HA 4LWZA 4PQGA 5IH3A 2IHUA 4C5CA 1PUXA 4P38A 3RR2A 5HWSA 1E5QA 1LNZA 2A1UA 3BIXA 4Q7EA 1M1NB 3DWEX 4L27A 4DN6A 3CLTD 2I6XA 3STUA 3MERA 1BDJA 1K3UB 4YBZA 1YRAA 1TQ8A 1F12A 1K8RA 5EE0A 1Y3HA 2BGLA 2FPOA 2WD9A 4G5SA 5JNSA 3CNOA 3OWHA 4QXPA 5JQGB 2ZTMA 1I3MA 2HDOA 3OLVA 4ALKA 3Q0IA 1OVMA 1M2JA 2DR2A 3OZXA 2QRVB 3FZEA 2P2NA 3G3EA 2FDRA 4R0MA 2HPZA 3BJRA 1A1VA 3MSXA 4YH1A 4JJ6A 2H1IA 2DQYA 4DLXA 1W19A 3MGBA 5LWQA 1JJFA 1ZGBA 1M34A 1Z0UA 1IIRA 1WDLA 3B1FA 4MV9A 5LZ9A 1CQIB 1QYVA 3PCTA 2PXHA 2O8DA 4HDMA 1OT3A 3CX7A 2IKSA 4H3KB 4O4IF 2WIFA 1AO0A 2MR6A 3PYXA 3V4FA 3UH1A 4KR9A 4WSOA 4D9BA 4UXIA 4FW8A 1EAMA 1VL2A 4Y1RB 5C80A 3UN1A 4IDFA 3EXEB 4UEKA 3DE1X 4EL0A 5I5EA 2H5EA 1SU4A 1ZD8A 3M4NA 3T0IA 3UMFA 4KMMA 5JNVA 2XXAA 1SPXA 4Q7KA 2WUVA 3ITDA 4TS9A 5EZSA 3NGXA 1ZW1A 4BZWA 5BN4B 4H9GA 2WNIA 4LBYA 1G8SA 3SR0A 3F3YA 4AMBA 2I2BA 4P7JA 3HR4A 4PNZA 4TMXA 8MHTA 3TBKA 1ABEA 2VP2A 1WMSA 1MA3A 2X0JA 5AESA 1KI6B 1POWA 3FG9A 4ZEWA 1VKHA 3NBKA 4CIVA 1PKEA 2FA9A 4LWQA 4RIIA 4OYYA 3A3YA 3F5MA 1J5EB 2O8FB 1R74A 2QZJA 4QOIA 4RSRA 1GGEA 1NI4B 1Y0BA 4V0ME 3QG5A 2HX1A 3FPAA 3JQBA 4J8PA 5BT9A 5LD2B 4CUKA 1TFUA 2PJDA 3MUEA 4IJVA 5ANRB 3PPIA 3L18A 2JH3A 3M3DA 2V7WA 3C14C 4H35A 4NYMR 5HA5A 3F96A 2OOKA 4LC0A 4F92B 3SFVA 2QYSA 4BMZA 2ZR8A 4BHTA 4QLBA 4U3JB 3D7LA 1UJBA 3ZTTA 4CG3A 4KV9A 3IEKA 3BXXA 1ZHHA 2QTVA 1XCOA 3KM0A 2PFSA 4W7IA 4OHXA 1FLDA 4AN0A 1OIXA 2KYRA 4MKHA 1CLEA 1VKOA 3R4CA 5DYNA 1G0NA 4HDRB 3NBMA 1CX9B 5M2QA 2J3QA 3ICPA 1J24A 2B4AA 1P7PA 1LDMA 4F71A 3I0MA 1KRWA 5JJKA 5KWJA 3C85A 3JQ7B 1L4MA 3FLAA 3QPDA 5D7NA 4QXRA 3I3SR 4QLAA 2R3SA 4WFIA 1BMDA 1P2GA 4X7MA 1CY0A 5L3SA 4XB6B 1ZBQA 1E79A 4JLWA 2GWRA 1D8TA 1S2DA 5TT1A 1E3DA 3TB6A 3UT5A 3KX2A 4W5QA 1D6NA 1M6VA 3Q7QA 1VCOA 2ZDGA 3A1WA 1O94C 4IGIA 4LRYA 3SJUA 4OX9Y 2D6FA 1H2ZA 4A91A 5E2BA 2V97A 3UWMA 4Q34A 2QVLA 2QTAA 3ND8A 4IXMA 3ZNPA 4EHNA 3BWCA 3UJDA 1ABFA 3IDOA 4FBMA 5CLGA 5FI0B 4MVJE 3BD8A 1NY6A 3D8HA 4YNBA 4KPUB 4TMWA 2WA1A 4EZBA 1MO2A 2ZM6B 3TW0A 3ZV3A 3LUGA 4X3PA 1JMKC 1YMQA 4A5OA 2XTMA 2VDWB 2I5PO 3A14A 3GRPA 3N0RA 4PGHA 3C39A 1Q2XA 2PRYA 3H18A 2I91A 1JU4A 3IPLA 1T8WA 2GN0A 1X1QA 1U1CA 2VA9A 4G1MB 1CULC 3S2GA 3WRVA 1CK4A 4YWHA 4LC1A 1E5XA 1EX9A 2VPZA 2HA2A 3N8NA 4KQEA 5JY6A 5HZGA 1M8GA 2PGIA 2RGNC 4MUYA 5C7YA 5E9WA 1ODFA 1ZA2A 2YX1A 4MK4A 1E7WA 1UBOS 4PQYA 2XJ4A 3NM4A 3B51X 4WLNA 1Z4IA 3R41A 4OQLA 4OQNA 4DFDA 1Y1LA 2JZOA 2W6CX 2FLKA 3QLVC 1K7SN 3EA5A 3K9HA 4ND1A 1IXRC 2A3NA 2O3QA 3W8FA 3M4ZA 2CD7A 4QTXA 3ZGXA 1ZNXA 3KQYA 4EG3A 1X1BA 2D3WA 1NPYA 3CVOA 5DH9A 3UUWA 1M1YB 5J23A 1JV2B 3MOSA 4GPZA 4JEIA 5ED0A 3LUHA 2IU4A 3BTSA 4GMDA 2FN4A 4Z9AA 4PXYA 4HFJA 4H6WA 4JOBA 3ND7A 4UNPA 1HEIA 2AXNA 2VSQA 1E89A 3JQ8B 3N86A 3P26A 4IHJA 5H7XA 3H9EO 4YUWA 2J48A 4JP2A 4FPXA 4MLPA 4HUQB 4CIDA 3MRVA 3OE5A 4NMMA 4XUEA 4BP9A 1PR6A 1Q6ZA 4YJKA 2ECFA 2VAWA 3V8MA 1ZL2A 5FUVA 4BP8A 4NOJA 3RB8A 2RSLA 2FK8A 1FNCA 1FP6A 2GPAA 3HEAA 1YB7A 4MHTA 1R8XA 2ZUWA 3EZNA 1Z0JA 1ZP6A 5I7RA 4F5DA 3EGEA 3ZW8A 3KRTA 5HP4A 5B6JA 3ZWPA 1ZKMA 2Q4BA 2PEYA 3F47A 4BNKA 1OH8A 1DT3A 2FPMA 1A7KA 1AO3A 1XVUA 1TF7A 3G2MA 1DTWA 2PLRA 2AZXA 2X42A 2YICA 4CTNA 2QORA 3DOIA 2FV8A 3KOWA 3C3MA 1N2HA 4OQPA 5CNKA 1GV0A 5EZYA 1RXEA 3A9TA 1X92A 1P3JA 2X14A 4WESA 3FHOA 4Z0PA 4JVNA 1KS2A 1TK2A 4DIFA 1MHTA 1PJBA 3X1JA 5KTOA 2BUCA 1K89A 1E2NA 3RS5A 5LZ2A 1GKLA 4NABA 4L6AA 1L7AA 1YI0A 1AHNA 1SCQA 1VKZA 3NBUA 5K45A 1Z3CA 1O94A 2ONJA 1R5BA 2OXRA 3PA6A 3CH7A 1Z4KA 1P7CA 2WMNB 2I7TA 4KYTA 1C3XA 4UBMA 3IHTA 2Z43A 5FFNA 1IY8A 4XRGA 2R48A 4ZI3A 3E2PA 4DIMA 4WK0B 1REQA 1P5JA 2RGUA 5EKSA 5B1HA 5IK2D 2JG3A 2XGJA 2XVYA 4ESHA 2ZBQA 5KJ6A 5JSKA 4RCYA 2XTAA 3LKVA 5U1PA 3OZSA 1DGQA 3AUYA 1DC3A 1UBSB 3ESAA 4KUEA 4I4TA 4KXNA 1O03A 2DFVA 1XDGA 2QPAA 4R40A 3ZYCA 5A6SB 1JKMA 3QVTA 5B12A 1OC4A 4J1NA 5F1OA 4CKEA 1IY1A 1E5LA 3LGSA 2AQIA 1CQPA 2IE0A 3FI0A 2P9GA 3KXKA 4OGFA 4PW0A 3AFHA 4WEOA 3PT5A 5DT2A 5EP1A 4HDAA 5K3FB 4IS2A 1DJPA 5F33A 4G8JA 4WJKB 1PQWA 1RNLA 1V5GA 3EW7A 4J2HA 3H1GA 4WLEA 2Z8YA 4IDOA 4XDGA 3WL7A 1CXZA 3ZXUB 3I73A 1KVRA 3JQBC 2WVJA 4MB2A 4AZSA 3AM4A 4ZVPA 1FZTA 3DM9B 1LBSA 2QT1A 4E4TA 4IMPA 1HV8A 3JYHA 3HJFA 1C4XA 1U3WA 3A0UA 1IOVA 1E1QD 2GTPA 3BFVA 3DZHA 3KFLA 3LQKA 3A36A 2O1SA 4JELA 4KQIA 4MRMA 5HMMA 2UZ1B 2FUNB 1KDVA 4ACAA 4M38A 5A7FA 2X40A 3WQRA 4UFPA 5BYKA 5JWOA 1YL6A 2HO4A 4CMKA 3CO5A 4LPSA 4JNCA 3OZVA 4MUEA 4E2FA 4FNAA 4XWYA 4EPVA 2AC2A 4RY0A 4MTLA 1Z5OA 1FSFA 3AJ8A 1NFQA 1U2TA 3MXOA 3NC0C 4AKIA 3VDRA 4QQ8A 5KIAA 2X5KO 2ZYAA 2RJ3A 4FGJA 1UFRA 5EUBA 5HGXA 4G4SP 3S2EA 4U2GA 3QXJA 3B8EA 2VHEA 1MEOA 1QYRA 2YMLA 1UOEA 4BE9A 3ZOKA 3DFIA 1O97C 5IYZF 3RV4A 4L0MA 5F2KA 4N7JA 2WHYA 1Z56C 2J9XB 4PCVA 1JTFA 1VLQA 3ZI0A 3RHFA 1YB1A 2IYAA 4LEIA 1G8PA 1XO1A 1K4MA 2EKZA 1QUEA 4KK4A 3D9QX 4L4UA 2JVIA 4K28A 5UKDA 1CUAA 2PRZA 3BMQB 4HG2A 5A4KA 5A6VA 1QP0A 4L5AA 4RVOA 1MAHA 3TD6A 2J0EA 1E1DA 2OECA 1R5NA 3W8RA 3RYCA 1GAJA 5DNVA 2GZAA 4Q4HB 3KG2A 1BW9B 4DKXA 4GZ5A 1P5ZB 2TMKA 5PGMA 2JBAA 4AI6A 3VPHA 4E21A 4GBMA 5DKFA 1SCNE 3AL2A 1LSSA 1U3GA 3AB3A 4UHCA 4CM3A 4YMIA 5K3AA 5ALPA 1XN4A 1N9KA 3HNPA 3RFUA 1KU0A 2B0CA 1N7JA 2P8SA 3JZFA 4GKAA 1E3LA 4I5IA 3S6JA 3DLBA 2I6GA 2OG2A 2GCNA 1FX0A 1FDTA 1P4SA 2QD5A 4RVUA 4CHTA 4FVTA 1NQAO 2AXQA 3QRWA 3EUEA 4EGQA 2JFHA 3UMBA 2PSFA 1C4OA 2FG6C 3G8YA 4I50B 4LHVA 1CNEA 1OJLA 3CS3A 3QE9Y 4YJHB 4JB0A 1YC5A 1HG1A 4Q1AA 3NGLA 1L6RA 1OXMA 2AL7A 2IW1A 3OX1A 4MQ5A 1M7HA 1NXVA 1VJ1A 2C99A 2ZYIA 3NC1C 4CF3A 2PU5A 1GCOA 2ZBEA 2HU7A 2Q5JA 5CHEA 1A71A 4G37A 3S29A 2WWXA 1TOAA 2O8VA 2F1KA 2ODNA 3C6YA 5LQSA 3CUEF 2WM8A 2CHEA 3A31A 3I6BA 1PI3A 3OZCA 3EUFA 4BN5A 1NE7A 3AINA 4KN5A 4JLOA 3IESA 4RHEA 2NU8B 1D5WA 3N8DA 5F98A 1TJYA 1DWPA 5LU8A 4FMBB 1VLZA 2AMFA 3QUBA 4X5OA 3ZWAA 3T7RA 3AVPA 1H1LA 4LECA 2D2IA 3B6MA 3TRHA 2CFIA 2JI7A 3NAGA 1IB0A 4CKEB 1JDZA 1JW9B 1T9GR 2OBFA 4I55F 4IOMA 4K6HA 4NCHA 3E4DA 5T4HA 3FTPA 2PZEA 5BV0A 4YYZA 3AZPA 2OO3A 1N8KA 1P7VA 1CJVC 1U7PA 1I2MA 1N8SA 4OOFA 4ZN6A 3RRYA 2ZE8A 4II2A 4QSHA 5CEEA 3KDSE 3L6BA 2OHXA 1ADCA 5KWEA 2RAUA 4BAGA 3ANLA 2RIPA 1N3LA 1N6OA 1MJGA 1PT5A 3HP1A 3JYLA 4F4IA 3QA9A 1DKNA 1G7RA 4LJLA 3WAJA 1IXYA 1V0JA 4B4KA 1J0CA 4KIWA 4OREX 1V4BA 2OAP1 5K7SA 5HQJA 4E5KA 1P1BA 1CJUC 2GX6A 4YP0A 4BUCA 2ZWMA 4MGYR 3O4JA 1R50A 2CLDX 1B0UA 2BPOA 3NGMA 3PG5A 4NOLA 4OH1A 5J9FA 3D6UA 1B26A 4UDYX 3V4ZA 1TT5A 3AI2A 4L8LA 3HSKA 3MJEA 3NHAA 5FOTA 1R6VA 1RFGE 1Z17A 2IGBA 3FMOB 2OK8A 1Z5WA 3OZDA 3QYPA 1RYDA 1M8KA 1L4EA 2CBXA 1RWWA 3Q87B 3PRYA 5MDHA 3OFVA 4MMXB 3ZJUA 2HLNA 4NXMB 3QBJA 4UMFA 2Q50A 4X90A 3HI4A 4N7RA 1TM1E 2G36A 5AI4A 4DVGA 3AR7A 2VDMB 1HMPA 3A11A 1XE3A 3PXEA 3VNBA 4YCSA 2RIRA 1QYWA 4BWYA 1JFTA 16PKA 4DQXA 4AM8A 4QSMA 4JP1A 2V9ZA 3I05A 1NF8A 1DVRA 1NMSA 1DZ3A 3GWZA 3RG2A 1NVWQ 1GTL1 5IKMA 5CT4A 4NBNA 4UCQA 4LS3A 4DV1B 2PL9A 2PCLA 1P7YA 4B9AA 2BOVA 5JPCA 3A58B 4GPIB 3K6RA 5AW2A 5HPYB 3K8QA 3LG2A 4GKKB 1OZAA 1YR8A 5JXHA 4IO1A 2EKQA 2HDNB 4FJ0A 1HR0B 1NSTA 3CY6A 4E2XA 4I4IA 4EHAA 3QUAA 3LU1A 4GMHA 3GLGA 1UQTA 4OI0A 1H4SA 1JAXA 3FPGA 5ALTA 3R9WA 4M1SA 4IUBS 5LD2C 3CEHA 3B5IA 1ZMOA 4NKRA 3H5TA 3EDYA 2OCPA 3RUHA 1K8YB 1PYGA 3IKTA 4OLBA 1T8YA 2HT6A 3KLNA 3UW3A 3FVTA 4B79A 2NUPB 5AOVA 4YQZA 1HLGA 1HOXA 1QH0A 2VSFA 5BSGA 3AR2A 4QRIA 3C5VA 3FMFA 2A92A 1Y3AA 3O91A 1GRQA 2W6ID 1U81A 1A5ZA 3R09A 2H1VA 4FMCF 1M7BA 4NBUA 1G5TA 1P2VA 4ALNA 3T41A 2J6BA 3WSVA 4F5WA 1T2CA 1EXMA 4CCWA 2QUKA 3I9LA 4P4TA 3I9JA 2AG1A 1OIWA 2Q1SA 4CT0A 5HM8A 4S05A 3PC8C 4EUSA 3LNTA 1NTRA 5CT9A 2XOKA 4MUAA 1JIJA 5IVHA 3KQMA 2J9RA 3II6X 3S7TA 1V11B 3O3NB 1ZYUA 3PI6A 1JSLA 3EZFA 4P54A 1ESEA 3ZLJA 1DJNA 3FMIA 4FQ8A 1H1LB 2ZYSA 2R66A 1WSBA 5FNZA 3I9V1 1I7LA 4YASA 2MR5A 1GNLA 3ADKA 3GG9A 3I52A 3IJRA 4LK3A 5EE1A 2W6JA 3U3MA 4LF4B 2XMBA 2QYHA 2WKWA 3UJHA 1QIHA 4MWBA 4CMEC 3GP8A 3OQIA 1H94A 4FWBA 2C7RA 2O0LA 1Z88A 2ZSJA 4KN9S 3B38A 3L7AA 4RDCA 3T95A 4QJ3A 5C7IO 1GKIA 2JGAA 1E6LA 1TMKA 4B32A 2G0AA 4XFKA 2AUMA 4TS1A 1CHNA 2C1XA 4GMKA 2BW0A 3LVFO 2Y0DA 3OECA 5G4KB 5CT6A 3VZQA 1C1DB 1NDUA 2E55A 3I2FA 1JQKA 1N6HA 3LLSA 3O03A 3ZLUA 4BWGA 4X85A 3WX0A 3F1LA 1KQGA 1V48A 3CVYA 1T0PA 3FYUC 3NDRA 3ZHSA 2BEJA 3T15A 1XVLA 2EIXA 2J8ZA 1PJSA 4UNRA 2DM6A 4B3JA 2POQX 4ES6A 1E9SA 3WRXA 2W6QA 5FFFA 2PMCA 4H4EA 1XRMA 3R9KA 4UM9B 1XPOA 3GPLA 3JZIA 2GWHA 1I2BA 1AN0A 3OPVA 3G85A 2XCQA 1LQTA 5C5EA 2I2XB 4A6EA 4PHHA 5F1KA 5E4YA 3R0IA 1W85A 1PJCA 2KMLA 3QF7A 4X3CA 3RC9A 4L8WB 4BQPA 3TRJA 4GX2A 4NK4A 2J33A 3HYTA 1Y1SA 1GQSA 3GFSA 5D3MA 4QKQA 3ZX5A 3AL0C 2IZ0A 4LKOA 2HCTA 4W1PA 4KBFA 1NBAA 5LFAA 2PGOA 1I2ZA 2PX6A 4JA2A 4S35A 1ZNYA 5E95A 2YRFA 2BBTA 4MRAA 1T2AA 1NPDA 2UVPA 1O4VA 2ZRNA 3G0GA 2OP1A 3G2JA 4HZIA 4IPTA 4J0IA 5D00A 5A3VA 3RVNA 2OL4A 2XB8A 3D1LA 2ZG6A 1KSGA 4M36A 5JSFA 2NO4A 1PZGA 1EIZA 2I8LA 2NUBA 1ZD1A 4H3SA 3WBJA 1H3FA 2JRLA 2CHQA 3L2OB 2QRUA 3CX3A 3LHIA 3QV2A 4E5VA 3ZGOA 1KZ1A 5HJEA 1V5EA 5GZ3A 4UJ3A 2BLLA 2JLZA 2HDHA 4MITA 1PJTA 2MCFA 2BGKA 4C3VA 3DAPA 4A92A 2C96A 2IKQA 2B8JA 4PLYA 2OA0A 5BQFA 2Q3CA 4RZIA 1WULS 1NXSA 1IN8A 5FR1A 1IATA 3GFFA 1S4MA 1U7OA 1XL0A 2HEIA 3B2QA 2Y6VA 3IQEA 1IVNA 2XSZD 4IVRA 3RTBA 4CM9D 5BW8A 2HK9A 1UT6A 5EIAA 4UOZA 4KKXB 1V5WA 2CLLB 2GM3A 2R5WA 3A3OA 4HAZA 4Q3LA 2DQZA 1GSOA 5EWJA 3D8SA 1DC8A 3E5HA 3RSLA 4GXRA 2VJMB 4ZK2A 5ILOA 2NO7A 5I51A 3A4NA 3NHRA 5K8IA 4JI1B 5K0JA 3TF5A 3ROXA 1YZKA 4P8RA 1JA1A 4DXDA 1M33A 2HF9A 4LHZA 1MRNA 4RKRA 5BWBA 2XZLA 3TW4A 3T9AA 1DAIA 3LUDA 3WICA 1G6OA 1FSSA 1UXOA 4P0QB 2WV9A 1N25A 4KQHA 2C2XA 2WT8A 1DLJA 4ND8A 2XQIA 1YCHA 3CR3C 3N3BC 4E22A 1WF6A 4L5BA 5HHTA 2GT1A 2AFIA 4R68A 4QNRA 3SZRA 1SO8A 4ZDIA 2G6BA 1SUPA 1IHOA 4HGPA 3UOGA 3VR6D 3M9LA 3LCUA 4JY7A 4E13A 1X1TA 2CV1A 5E0OA 4KIFA 3PXAA 1W87A 2O5EA 1C8LA 2E87A 2ZT6A 1YZVA 3MN1A 1KO1A 3DW3X 3D4BA 3IAHA 3IVCA 5IS2A 1GRNA 3A70A 3BE6A 4YQFA 4Z9BA 3KYJB 3FOFC 1JDJA 3CW8X 1SD5A 2TSYB 1X74A 2UZ3A 1N2CE 2R44A 3CB2A 3LX8A 4LQ4A 4XPZA 3SHFA 2C83A 2OVFA 4AJ9A 2FFJA 1U0EA 3O4GA 4FSXA 1TK9A 2V7QA 2CF5A 4PC6A 4PZ0A 1XMVA 5AUQA 4YIHA 3U3OA 2E49A 4LJ7A 4MAAA 5JMWA 3G5MA 1USVA 1Q3HA 2H7CA 1AV6A 2B82A 3PEEA 5FOSA 3ME5A 1NBWB 2VBIA 1RRPA 1A9QA 1ADYA 4II3A 4LWOA 4MRNA 3RCBA 1RM3A 4QUIA 1WCWA 2RKOA 4BY9E 2G9NA 1P9OA 2PMEA 5KMGB 2UUPA 2VAPA 3LZDA 2FP3A 2MSWA 3MUOA 4J29A 3HB9A 3PIIA 5B7GA 1KVTA 3MW8A 1E94E 4QPDA 4FHDA 2C9OA 4NPHA 4Z0HO 5LVAA 1OOEA 2R87A 3U31A 5G0UA 4P3YA 2ET6A 1C7FA 3TTXA 2P6MA 1Q12A 5DHSA 1XXHA 4DV4B 2BH2A 4CMHA 4ZOCA 2BJHA 4WZAA 3MS2A 4NZ9A 3NYIA 1U6KA 2NTNA 3MHPA 3TDMA 5K4GA 2L18A 2FP4B 3BS4A 3PXUA 3LWZA 4QJIA 3AVYA 3NH9A 5FUMA 3LPAA 5AD1A 3P2OA 3UT6A 2BMDA 4AJ1A 5CFQA 5AJZA 1AX9A 2F90A 5F2NA 3PL1A 3WGYA 3UM9A 4IJUA 2H5JA 1AHHA 1H5QA 1GVHA 5IWAB 4QU8A 1Z6ZA 1KI1A 4ENQA 4F56A 3VPGA 1EX6A 2P68A 4U0JA 4K9DA 3AEZA 2V3WA 2RAFA 4FEEA 3QU4A 3A05A 5DTRA 1I7DA 3HPRA 5CXUA 3LCCA 3M2TA 1OY1A 2M6LA 5IXSA 5AKKA 4FC7A 3PWZA 4XOUA 2FUG6 4RD6A 4AKSA 2HB6A 1IM2A 2ZUUA 1JHOA 4ETIA 3OEHD 3I01M 4R7GA 3NM6B 3K4PA 1KZ4A 1KPGA 2I33A 3ZD8A 4JDPA 1XV5A 3PDJA 4JC0A 2VTDA 2ILVA 2J1LA 5EIXA 2R25B 2XF8A 4TTJA 121PA 3KEGA 5F9FA 2E2WA 2W2MA 5J2TF 4F1JA 2C1EA 1Y6FA 1QOZA 1JB9A 3R9XA 2IPMA 4WOPA 3P4UA 4KH1A 2XI4A 2PGLA 2JCBA 4MW2A 3KSRA 2IE8A 1N3BA 4GRDA 1KJYA 4X91A 4A6PA 4DDMA 4BC1A 3B3GA 1TUEA 1UWVA 4HRAA 5KYKA 3RVJA 1NN5A 2P6PA 5IG2A 1ISRA 2HU2A 5BSMA 1OBVA 2FSIA 1S2NA 2EEZA 2ACWA 4UMVA 2FF5A 3I04M 1OYVA 1ZC4A 3QKTA 4RMIA 2WG0A 1EKXA 3FOAA 1P60A 1PJ3A 3RV3A 1GQRA 5F7XA 2YS6A 3TKAA 1N2EA 3D7SA 4HAOA 1RD4A 3IAS6 3QX7A 3I3OA 1I32A 3IDFA 3WFIA 4BBPA 2D00A 3W1EA 3OO0A 2GYUA 2R86A 1PWEA 1H2FA 1JR4A 5AK6A 5TJ9A 3OCWA 4U02A 4PLTA 3FNGA 3ROMA 1UC9A 4PVCA 1T5LA 2BKVA 4B4WA 1RRKA 3AY3A 2W37A 4M1MA 5EIFA 1MRZA 3L1KA 5GM2A 3UC9A 1VI5A 2ZB4A 4PC1A 2K5UA 1CBUA 5T4EA 2BEVA 3PZBA 4OCZA 3W2FA 1INLA 4RFLA 3AFMA 1OYOA 4QVGA 4CM8B 1EFDN 5E3HA 4JLUA 4O6VA 4PEVA 4PS1A 1RP7A 3N9IA 4Q1FA 2I22A 1M76A 3C3YA 4YAKA 1NF2A 2A0KA 2XD4A 5BN5A 1DPGA 1ZGJA 2HRBA 3G6KA 2D2FA 2D13A 2XHEA 3L1IA 1V4NA 3NORA 1AA6A 4J6EA 9MHTA 4MTCA 4BJ5A 1CDZA 2HWUA 1XD8A 1A9XA 2JHAA 3FCXA 4RK4A 3ZUPA 2ZTVA 1MUUA 2XAUA 4G09A 5CDFE 3BCSA 1DQSA 5ECYA 1F8UA 3EPRA 5JQGA 2RC6A 3TPFA 1N78A 1XEXA 2FSSA 1ZH2A 2WTAA 3KUDA 4ILEA 2EC5A 5EPEA 3BT7A 3HU5A 1W4CA 1J70A 3X2SA 5J2UF 3I62A 1GCAA 2W58A 3QOWA 5HJ2A 5KYVA 1ULTA 3D6VA 4UBNA 1UAAA 2PKQO 2WYOA 3GROA 5ALFA 4CF5A 5HKOA 3W5DA 2NACA 2Y1OA 3AH8A 3I64A 1JAIA 1CIJA 3NW9A 4I9FA 1TVCA 2GBGA 1G4HA 1UH5A 5HK8A 1OFHA 3IUYA 4YDSA 1IUKA 3W2HA 1ZNQO 2EJTA 2MSDB 3A1VA 3L8EA 3M89A 3OJCA 3L82B 4L2IB 4EY4A 2XCRB 3E53A 4KRXA 3LBFA 5KC8A 1QDLB 2WB4A 4ZCQA 1XRNA 2IUYA 2LCQA 4E6EA 2GTHA 2Y1GA 1YB2A 3KEOA 4XGNA 3GD7A 3WKBA 1LNSA 3GYGA 3QMMA 4L22A 4YRLA 2YJGA 3LYAA 1AUQA 4A0FA 3F7MA 1JPUA 2V45A 1NBME 3RVSA 1E99A 2WTMA 5TVKA 1WAMA 3VOTA 4AROA 4D4LA 4XYLA 2WTUA 1U31A 2YC4C 3C8HA 1JFVA 2FZKA 2XQJA 3G2KA 3L41A 4OXKA 2Q5FA 3V4OA 4QLOA 2LWIA 5BVGA 1GRVA 4J1TA 2FW7A 1LBIA 1P9LA 3MTGA 1QH1B 3TRDA 5SZHB 1XF9A 2F6RA 2H2FA 1NVUQ 5I3ZA 4FDMA 4M22A 5FBRB 5BQ5A 2FPPA 5JS8A 3K8YA 3GLIA 2VWQA 2GBPA 4EW3A 1J0BA 1YVUA 2GXUA 1J1ZA 2VDRB 4QPCA 2E4YA 4X6LA 1R3UA 5EFZA 1QONA 5ECWA 1E3EA 3WLFA 1EXDA 1V9SA 3WMRA 4ZO4A 5K8VA 4BU1A 1YZGA 1Q7EA 2OYSA 5F5XA 3G5AA 1NFFA 1OZ0A 2X15A 3IE0A 3QKUA 4EAAA 3ZQJA 5LM3A 4UEQA 2Q0HA 4QU0A 1RXIA 4MI6A 3K70C 3GFOA 1OE0A 4JK3A 3QXCA 1Y80A 3QVUA 4IXDA 4I6GA 4WVLA 1F7UA 3P94A 5HIJA 4V1CA 4UULA 2VUSA 5LIRA 1JU3A 5DNCA 2Z1NA 3JWHA 1YDGA 2C31A 2IITA 1QLJA 2QTMA 4MYTA 5L7YA 3HBLA 1CKEA 3PC8A 4EX6A 1LV8A 3S1SA 3RFTA 4C04A 4DQLA 3JZDA 3WV5A 1V1MB 3LPDA 4WXRA 3GLFE 3KUCA 3AOGA 4N7MA 4UEWA 5HKLA 5EOVA 2DFKB 3N5KA 3U09A 5B3KA 2QG9A 3PR3A 3Q8XB 4TL8A 3ZX4A 2ZRKA 3A4YA 2F3PA 2YIMA 4R84A 3W5VA 4J3FA 4CQJA 1J8QA 3QSYA 1ZCZA 4PZEA 5AR1A 3AUJB 4RF2A 1Z08A 1VDMA 3SD7A 3MWDB 1PT6A 2D8MA 3E0XA 5C81A 5IAGA 1LLCA 4X94A 1RPNA 2PT9A 3KR2A 4X8OA 3UA4A 5AVRA 2I8AA 4RKEA 5I9SA 2O19A 1NKVA 3LFHA 1XNQB 2QZZA 2WTEA 4M8NE 4Y6OA 4WEQA 1HQYE 1JLLB 1JSRA 1E63A 1TO1E 3X1YA 3RFCA 4QGBA 1OX5A 4AQDA 3LX6A 2ZXUA 5ARBA 1RHUA 1UKZA 5EWLB 2C07A 4BMXA 5B64A 2HI0A 3IP3A 3RSZA 1Y63A 2ONKA 4C08A 1KZ7B 4OHBA 3R77A 5GMOA 4N6GA 4QT4A 4XQGA 3MRTA 3L4JA 5DNWA 2PY6A 2Q62A 4M6WA 2PUJA 1GILA 2BL4A 4RLQA 1GG9A 1UMBA 3WIBA 3VKHA 3RVKA 2DC1A 1P1FA 4CFYA 5I7SA 2AN3A 5K2OA 3EGOA 3ZCXA 1TT7A 1DIOB 1ZOIA 4MYRA 1WZ2A 1E6MA 1ODSA 2AMLA 2B4YA 2OZEA 3BXFA 1X9IA 3Q85A 3DLIA 4RUKA 1HNWB 3HBNA 1K7YA 3FUWA 3ZPXA 1BTOA 4YPOA 4NX2A 3W2GA 1R10A 3F4KA 4JOCA 4XJVA 3U3RA 3PB3A 3CN7A 3OIGA 4MHOA 4B47A 1JHUA 3NYRA 2NXJA 4RHFA 3AHCA 1ZIPA 2FQYA 1X70A 2VSYA 1IBKB 4N49A 3W3AD 2CXHA 5J4YA 1J6UA 1O5OA 4A23A 4FR2A 4CLRA 1C9KA 5A7GA 2Y0PA 1KP2A 4CKCB 2PM8A 3A6GA 2OG1A 2PN1A 3PYMA 4KAFA 2J0SA 4C07A 4C6RA 2GEVA 2C0QA 4RHYA 1HDCA 5HFJA 1C30A 1DZIA 3CURA 2MWMA 4OK5A 4EB0A 2XA2A 1WNFA 2QTLA 2WF8A 2WM2A 1U94A 1YE3A 3QTBA 4IDNA 1RZRD 4O4IB 3FCUB 3D43A 1G8KA 3S44A 2QY6A 2ATEA 1E9BA 1XMOB 2DY1A 3NZEA 1SIWA 1Y3CE 4XSHA 2PX4A 2PG3A 3ZVKA 1RYZA 4D96A 3JATB 3L49A 1QH1A 2JGEA 4J1QA 1AGYA 3ZWDA 1XTUA 5EFOA 3FKJA 4E32A 2AJDA 2I4LA 4GGOA 4Y2TA 3RAEC 4NBSA 4OXYA 2WYUA 1CJKC 2QL6A 4UVGA 5KPDA 4ZCTA 5IBPA 3TJZA 1Z8HA 4HKTA 1KEZA 2BONA 1OTHA 4J6FA 1XFDA 3KT6A 1D0SA 4R54A 4UFNA 3TRFA 1YGYA 5IK2A 3GLIE 1PV4A 1C7EA 1UXGA 2FQQA 1YZQA 2C4VA 1ZMXA 4YY3B 1L7DA 2ZJZA 1N33B 4UREA 3GMIA 3HWX1 1ORIA 2BGWA 1NLYA 1P6QA 1BMQA 2OUKA 1USGA 3BMOB 1RLIA 5IFLA 3VPSA 4FYMA 1MB9A 3PEUA 5C37A 3I0ZA 2BSAA 2W00A 1XA0A 5CVEA 5A1JA 5IJ0B 1NBMA 5BV2P 4QNMA 2KLHA 4E7PA 3M6AA 4NE2A 4ZAXA 5DGCA 2ZT5A 1TZBA 3MGCA 4E3WA 4L15A 3ZUGA 4FNGA 4MJLA 4WKNA 2DFTA 4YT2A 4L76A 4AO7A 2JHFA 3PJRA 3BMCB 2GVZC 3OT1A 1NUTA 1HDGO 1NVFA 4CLDA 3HPQA 4TMTA 4AT1A 4G07A 4DMRA 2QKYA 4Q9JA 3A6ZA 4NCXA 4NV3A 2B5VA 2ZJ2A 1OU4A 2BEWB 1KYXA 2XNKA 3C70A 5E3JA 3GEDA 4ZEOA 3HKBB 2EQ5A 3MGKA 3G9ZA 5DM2A 3ZWWA 3NV9A 2QLLA 3I45A 5DI3B 2CNWA 4X63A 2FX3A 3MINB 1X3SA 3I2HA 4Q9LA 4EUNA 3ITNA 3L7MA 2B78A 2ZIGA 4NP6A 3QA3E 2GUGA 3UK6A 3FCYA 1QVAA 2C94A 1JIIA 4N01A 4JQZA 4RH0A 1CSEE 4HFRA 1ELOA 2X5JO 2DERA 3G8BA 3WDMA 2B3DA 2VTVA 5J4VA 1QOPB 1KMQA 4CETA 3S68A 3L7LA 2C8JA 3T5MA 1OHHA 1FSPA 1A8SA 3C87A 4GR5A 4CEHB 2VDLB 4OLHA 4C4PA 2JIZD 3ELYA 3VYTB 2WYWA 3HR7A 4UE2A 3PTAA 3HYNA 2B8WA 1CJBA 2VO1A 3KO8A 4EBBA 3I61A 2ADFA 1YZ3A 1W5AA 2C42A 5EJIA 4JJ4A 5LMZA 4C4XA 4QOJA 3UK1A 4JIMA 1P81A 5AI5A 5IUNC 4QUJA 3V5NA 3JQAD 1I2CA 2G8LA 4HAXA 5THQA 3VFDA 5L45A 1Q7GA 1R4MB 3EDOA 5GONB 3K20A 1FFAA 3MQFA 3RODA 1MP0A 4LRSB 5JJIA 1FRFS 4WWHA 4PLCA 3I5XA 2VVTA 4BCDA 1DWOA 3GGDA 4QOEA 3DDZX 3ZHTA 2DETA 3ZJVA 1I1NA 3G2NA 1U65A 4RTNA 1VPVA 3D6MA 3EY4A 4FYPA 3TXYA 5IX8A 2ATIA 2UYGA 1IN6A 1H1TA 4DOMA 4BGUA 5AVSA 4YCDA 2XNDA 4P7FA 1NBHA 2H1WA 3FUVA 3WLKX 2OXEA 4LX0A 2UXDB 2IELA 1SXJC 1PZFA 2P4QA 3JD0A 3ZXXA 3D7KA 2KLBA 4UTRA 2PZGA 3T3NA 1H3NA 3EGWA 1D2EA 1UPBA 1E3SA 3S2ZA 4EY3A 5C7OO 4MJXA 1T4DA 3NBZC 4MPPA 5L4SA 1YZTA 1QIEA 1V6CA 4LHYA 1K75A 4R2WA 2II6A 2Q28A 3NHUA 4G86A 1KSHA 3A7DA 4UBOA 2P90A 1XAJA 4EB6B 4E1BA 6AT1A 4GLJA 2HA0A 4GKVA 4V0KA 1RM4A 1G66A 2N46A 2FPGB 3SQDA 1R4AA 4B5KA 6PFKA 3IUEA 4LMPA 1IH8A 3E2IA 3G0DA 3OA2A 4P0TA 1OF1A 2V7GA 3NVDA 4QECA 3AHGA 4C30A 1YFKA 4HAYA 3O7WA 3PGKA 4PE5B 4IUCS 3WWZA 1YCFA 2ZYVX 3ENQA 1VGQA 3GJ4A 3L0OA 3CXUA 1YGPA 2CMFA 3GH3A 4D99A 1EDEA 1CVLA 3WO0A 3CLTC 3UCEA 3PUHA 4G5OA 3NRJA 1OPRA 5CVDA 3GRRA 4E1AA 4LDZA 1B76A 5BR4A 1CUEA 4CDMA 4YAEA 1XU9A 1XZQA 2Y9PB 1GN9A 2IEBA 3EDQA 2G09A 1O58A 1DMRA 2QRJA 1E1LA 3PQ6A 2I3GA 3WJ7A 3V8EA 2VP4A 5IUKC 2FP4A 2H2AA 2ZB7A 3L7DA 1X9HA 3NAZA 3O2QB 4OP3A 1KZYC 4MUIA 3RSQA 5CW2A 5D8DA 3Q98A 1V5FA 2P77A 4KVGA 1KFBB 3T4XA 1Z0DA 5AKZA 3LL4A 1I2DA 4JFRA 3H3XA 3WRXC 3ZK7A 3ZIAA 4QXMA 1PWXA 3L0BA 2HR1A 2O54A 3P5BA 5SYNA 2CDCA 1D7AA 3CKMA 1YQ9A 2AE2A 1WXQA 1L5FA 1K5GA 1WZIA 3LXXA 2Z04A 4ZHSA 1JDTA 2YY5A 1IXZA 1MV5A 3EVCA 3U17A 3DNFA 1PJLA 1IPEA 4UOEA 3EXIB 1HZZC 3Q8MA 2VPWA 2VP9A 4I5DA 1CUUA 1XVVA 5LLSA 3V9AA 3ASZA 3T4UA 1J42A 3AUSA 5D86A 4X54A 3O47A 2UYOA 2H9YA 4BAZA 4U2DA 1G3UA 3HBAA 3ONWA 4X8MA 1DFHA 1GLNA 3E6AA 3S8MA 3U4GA 4CG1A 3IKJA 2WF9A 1A77A 3MCZA 5TQJA