3FYUB

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
318
structure length
317
Chain Sequence
MQLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
total genus 119
structure length 317
sequence length 318
chains with identical sequence D, H
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuB00
5ALUA 1YB7A 2BKLA 3VVMA 4DIUA 4KEAA 2WUDA 3I2JA 4EY6A 2R11A 4UFOA 3WK9A 1CUXA 4X94A 4X92A 4N5HX 4AMZA 3D59A 5DTIA 1F8UA 4C4ZA 1QIEA 1FSSA 3JYHA 5C7YA 5AM3A 2B4KA 1R4ZA 5H3HA 3I2GA 1HKHA 4INZA 1LPBB 2CKMA 1ZI6A 2PSEA 3L1IA 3AIOA 3V9AA 3IA2A 3W2TA 4C4XA 1GXSA 3TJMA 4XIIA 2XQGA 5HQ3A 2XUGA 5CURA 1PV1A 4B84A 1C4XA 3AIKA 5A71A 1TCCA 3F98A 1F6WA 1K5PA 3DD5A 3DL7A 1BN7A 3C6XA 1CUYA 3I2FA 1WPXA 2WKWA 1LBSA 2IITA 1HLGA 3IB3A 5KWIA 4PSUA 4L0CA 1YA8A 4AZ3A 2ACEA 2B61A 1AX9A 3GZJA 2Y2UA 3PFBA 3DDUA 5HCUA 1H2YA 3BWXA 3WLAA 3BDVA 3HJUA 1CFJA 1C7IA 1HDEA 3IUQA 4E15A 4Q3OA 4Q3KA 5AKKA 1UOPA 4Y2JA 3VJLA 3LLCA 5JADA 1DX4A 4QDTA 5K3BA 5LZ2A 2XDWA 3IULA 2WHPB 4J03A 2HA2A 4KYVA 2VT6A 3FYUA 3G0BA 4FLMA 2PUHA 1SCKA 1DQZA 2VATA 3T4UA 4KE8A 1MN6A 1H2ZA 2PPLA 3OTQA 4B9EA 3AZOA 1FFEA 1QTIA 3AFIA 4FBLA 1GT6A 2BGNA 2W22A 1K63A 2PU7A 4TVKA 2QM0A 1XZMA 3EIOA 3RLIA 4EY5A 3FLEA 4YPVA 5HQ3B 5LZ4A 3OC0A 1ODSA 2GYVA 3KD2A 4FLFA 4Y2QA 5ALRA 5ALXA 2VJAA 2CEKA 1E8NA 3WWOA 1XLVA 1YA4A 4MYSA 3DEAA 4XWGA 4RE6A 1QO7A 3C43A 1WM1A 4YASA 1A8UA 1WB6A 5JANA 1YAJA 4B6GA 4BTVA 5LZ9A 5IVHA 1SOMA 3A2MA 4AO8A 5AKZA 2RIPA 1MX1A 1DT5A 1LPNA 1XLWA 4KJXA 5ALVA 1HL7A 2HU8A 5K3DA 5IVKA 3ZLUA 4QLOA 1NX9A 5AI4A 5K3EA 1UZAA 1XZBA 2Y6UA 1YS2X 2VJCA 2G5PA 2ROQA 4G8DA 2AJDA 1LPSA 4EBBA 5C81A 1E89A 3WIBA 3QYJA 2XUDA 2AXEA 2JGMA 1H2XA 1T4MA 2P8SA 4B9AA 1C7JA 4H7HA 1XRNA 5ALGA 2PSHA 4GEGA 4OB8A 3OURA 1XRMA 1Q84A 2H7XA 3IDAA 3WKAA 5LZ8A 4AXBA 2QVBA 4FTWA 3UUEA 3N0TA 5JAPA 3F9CA 2XT0A 4OYLA 3GFFA 1J06A 3IUNA 1U8EA 2AJBA 1A7UA 3BJRA 4PW0A 5A7GA 3BF8A 3EQ7A 1IUOA 1ORVA 2J4CA 3H2IA 5BWBA 4MWSA 2WHRA 3C87A 1YR2A 3HYSA 4G8BA 5AM0A 4AQDA 2HDWA 1YCDA 1DX6A 1VE6A 4UBNA 1AUOA 2Z3WA 1QO9A 5AM1A 1QIGA 4U2FA 4BP8A 1JMKC 4WJLA 5DNVA 2V96A 4G1FA 4OSEA 4LHEA 5I8PA 3HXKA 4NS4A 3C8DA 4WFIA 2Z8ZA 1XRRA 3RKSA 1A8QA 5ESRA 5AICA 2G4LA 3R41A 5CXUA 3I6YA 2BGRA 3LS2A 3I1YA 3FLBA 1B41A 1ZD3A 1THGA 1QFMA 3GROA 3MGAA 5CMLA 2FJ0A 5AKGA 5KWJA 5AKXA 2WJ6A 4V2IA 2B20A 3G9XA 3OG9A 1CUBA 3QMWA 4FWBA 4C87A 3VXKA 5FPQA 4CG3A 4FBMA 1VZ2A 1A8SA 4UHDA 2WIGA 4I19A 1MPXA 5EFZA 1CUSA 3P2MA 5CT9A 1N1MA 3C5WP 3QPAA 5EHNA 3E1GA 2VQ6A 3DLTA 3HI4A 5JARA 1GQSA 5JALA 3OOSA 4H7FA 5AK5A 5JD5A 1KU6A 2PVSA 3Q0TA 2OCLA 3PF8A 2G5TA 4H0CA 4NMWA 5IVDA 5EHQA 3IIIA 1YSCA 1F0NA 5A2GA 1H22A 4BB0A 4BVJA 5ALOA 3ZLTA 2GBGA 5FDFA 2WLSA 3SX4A 1GQRA 4GLBA 2QUBA 4N8DA 3I1IA 6YASA 1R1DA 1QLWA 4OPMA 4A23A 1USWA 4ETWA 5JZBA 2WG2A 3ED1A 1ZJ4A 1EI9A 1RYYA 1XZCA 3ESDA 2O2IA 1VA5A 3H2JA 1THTA 4QE3A 1AURA 4EY7A 3PFCA 4H7EA 5AOAA 4G4JA 4PV7A 4KAJA 2ZYSA 1VXRA 1TCBA 3DJYA 1XQYA 3AJAA 5T4EA 3G0CA 5AKJA 4BAGA 3FVRA 2V98A 4J3JA 4MQMA 3HRHA 4BDTA 1VA4A 4B80A 1A88A 2QT9A 3VKFA 5HKBA 3FYUC 1WHSA 1XROA 2QR5A 4RE5A 2UZ0A 1LZLA 2OXEA 4DLNA 5C8VA 4X97A 2QOEA 4A5SA 4AZ0A 1DTEA 2XUIA 4M0EA 4W1RA 4E11A 2WIFA 1GGVA 2J4FA 1RWQA 1JJFA 5A7HA 4HXEB 1W4LA 3QBJA 4KAAA 5AOCA 4UBLA 5ISMA 1UT6A 3JW8A 3ESBA 1GKKA 3KSRA 4X93A 1CVLA 2WG1A 4B81A 4Y2UA 3WL7A 4ARBA 1EHYA 3G8YA 2ZYHA 2VA9A 5LP1A 1QIIA 2ZSIA 3PE6A 2RONA 2CJPA 1XZHA 3V1MA 2E3JA 1L7QA 2CUTA 4W1QA 1UXOA 3EQ9A 3A70A 5T4HA 3QPDA 2FJPA 4C6HA 3BIWA 1J1IA 2WTMA 1LBTA 4X6YA 3O4HA 3ZWQA 2XUJA 5AK6A 1EX9A 5CH5A 3B3QA 2EDCA 3WMRA 4GECA 3U0VA 4JYMA 4CIAA 1ZI8A 4AX4A 2JGKA 4UBMA 3IVMA 4WDQA 3AILA 4IQ4A 3VDXA 1UKAA 1YAHA 1FFAA 1N8SA 3QITA 5CT5A 2IX9A 2PSFA 5AKYA 2OAEA 4HXGA 4QDZA 3T52A 1G4HA 2R8BA 5FV4A 4OD0A 4MYDA 1QOZA 4JEIA 3DKRA 5CT8A 4XVCA 1BROA 2C7BA 5HZGA 4U2GA 1N5RA 4BATA 3ICVA 3B12A 2OGZA 3RK4A 1CUEA 4U2BA 2QUAA 1J2EA 1UOOA 4H7DA 2QMQA 3N2ZB 3I6ZA 2V9ZA 7YASA 3R3XA 2BUBA 5BV7A 3QZUA 3W06A 2HU5A 1JU3A 2DCMA 3K2IA 2OCGA 4E46A 3R3ZA 5AOBA 2VAXA 1XZFA 1R9MA 2VF2A 1HQDA 3R3UA 3DCNA 1K8QA 3M81A 3DS8A 5K3FA 4P9NA 1CUJA 2ZJ7A 1QONA 2OQIA 3CN7A 3MUNA 2JGEA 3H2KA 2JEZA 4BC0A 3R3YA 4XX1A 2BCEA 3D7RA 2BJHA 1GKLA 2WJ4A 5ALYA 1CPYA 1JJBA 3H18A 1YASA 1XZKA 2BFNA 4U2CA 3WWEA 4Y2XA 2WTNA 3G9UA 1D07A 3F8SA 5A7FA 5JD6A 4J0DA 3STXA 1K4YA 2HA6A 4Q1VA 1RP1A 2XMQA 1FFCA 5E4TA 1Q0ZA 1XRPA 4LYDA 4X6XA 3WK7A 1XZLA 2CBGA 2O7VA 3H17A 3FYTA 3GELA 5C8XA 1L7RA 3O4JA 2DSNA 3FCYA 1O6FA 2JF0A 3W05A 4UHEA 1F0PA 2C0QA 5IH7A 1KU0A 2X5XA 4L9AA 5HF8A 2WG0A 4BP9A 4C01A 2RAUA 4K6GA 4UPDA 3QMMA 4OUKX 5ALNA 2VJBA 2XUQA 1N5MA 3R0VA 4FKBA 5JD4A 1MU0A 3WKBA 4UHCA 1BS9A 1UFOA 2JBWA 5FKJA 5CH3A 3WYNA 1OILA 1BE0A 1TRHA 2DQYA 2XQKA 4DM7A 2XLCA 5AIAA 1AMNA 4CG1A 4J0IA 2FUKA 2IIVA 1GPKA 2AJLI 2I3DA 1CLEA 2ZVDA 4WCVA 2HHAA 3KXPA 2XUHA 1ZICA 3HSSA 3FOBA 2Z8XA 1QTRA 3H1BA 5AKHA 4N8EA 5HK9A 4ROTA 1LPMA 3H0CA 1CIJA 5KBYA 1TK3A 2WJ3A 4HRYA 1CQZA 4HRXA 4E14A 4AO6A 3VISA 2I3ZA 5F4ZA 5E4JA 3FCXA 1VXOA 3DOIA 1E66A 4BYMA 4ZI5A 3B5EA 1UK9A 3WK6A 1O6GA 4ZV7A 1AZWA 3QM1A 4MEAA 1W76A 4KRXA 4FFVA 4S0XA 5AI8A 4MXDA 5CRIA 4G4IA 3S8YA 3KOOA 4CCYA 1QJ4A 4W9RA 3ZPXA 2Q0XA 3PUIA 4AMYA 2GYWA 3H1AA 5JAOA 4UBIA 2DFPA 2Y6VA 2I03A 4LKOA 3ANSA 3UUFA 5K5EA 3WL8A 1CRLA 4OU4A 1CUDA 2WHQA 4DMCA 4NZZA 5LKRA 1CUWA 2HRQA 2GZSA 5IVIA 3CCCA 4H18A 3IURA 1EDDA 2OGSA 5ALMA 1R3DA 4BE4A 2OCKA 3A2LA 2BUAA 1DINA 1DQYA 2RHTA 4PSCA 3DQZA 3H19A 4JNCA 3WL5A 4BZZA 4CG2A 4WY8A 5AHXA 3STUA 5AH0A 5JYCA 2WIDA 3DYVA 2WIKA 1P0PA 4QDXA 4QWWA 5D6OA 1XRLA 1MAAA 1EINA 4AN0A 4X95A 3WL6A 1ORWA 5T4FA 5EHZA 2C0PA 5FUMA 1EK2A 4JH0A 5CTAA 5HK8A 3K6KA 5FPPA 2NW6A 2G63A 2X76A 5ALHA 2OG1A 5T4BA 2RGUA 2RI6A 2CZQA 5KREA 4U2DA 2OLEA 5CH8A 5HF5A 2OAGA 5LYYA 1ODTC 2O2HA 1CUGA 1AGYA 4I4CA 4B7ZA 5FP0A 2ZYIA 1UKCA 1SC9A 4J0HA 4N8SA 5BWCA 2XQJA 4U2EA 1MAHA 3WQHA 3GA7A 4UFPA 1XQVA 3BXPA 2EDAA 4QA9A 1BRTA 2DR0A 4UHHA 1X70A 2VSQA 5CT6A 2C58A 2WHPA 4FDMA 3E3AA 2XUOA 4BAUA 3VJMA 2HIHA 3WWDA 3CCBA 3OM8A 4G4GA 2YASA 4QDUA 4WFKA 3JWEA 3AZQA 1K6EA 4G5XA 4OYYA 4H7JA 2B9VA 4WFJA 2DHCA 2ZJFA 4M0MA 2XB6A 2YXPX 5CXXA 1P0QA 1VLQA 1IZ8A 2XUFA 1DT3A 4Y7DA 1FJ2A 4X71A 2VJDA 2WU3A 3TEJA 4CCWA 3QH4A 2FX5A 3TGLA 1BEEA 4L3WA 4DMKA 1CUAA 1EXWA 3VJKA 1I6WA 4K2AA 2ACKA 4FFWA 1EA5A 3WWPA 3FYUB 3KWJA 4KE7A 1TQHA 4C89A 1CV2A 4FHZA 1MX5A 2O2GA 1EB8A 1UK7A 1QE3A 1GPLA 4P93A 3ESCA 1UK6A 4IH9A 1LLFA 1QIJA 4BCDA 1JMYA 4ARAA 2ONCA 4DGQA 1T2NA 3WKDA 4IH4A 1QIMA 3EF3A 4Q34A 3V48A 3O4IA 1EH5A 4PQEA 2ECFA 3MVEA 1ZD4A 2GZRA 1G42A 5AP9A 5HF9A 2QS9A 4UBJA 5JASA 3ILSA 2PX6A 2V97A 4Q82A 1DWQA 1AC5A 1W75A 2QJRA 5AI9A 2HL6A 1BCRA 3F97A 1FFDA 4FLEA 2VAVA 4ZREA 3LCRA 3WZLA 1U65A 5HFAA 4X7BA 4CIBA 5ALZA 3NUZA 4J7AA 1NU6A 5ALQA 4HZGA 3R3VA 2HU7A 3HZOA 2C4HA 1XZDA 3S2ZA 1TAHA 3WKEA 2OPHA 2H7CA 2XMBA 4YK7A 4ZXFA 3UMJA 3PF9A 3SWWA 1MX9A 4L72A 5D7BA 1UOQA 1PJAA 2WILA 1CUCA 3I2KA 3E0XA 3RM3A 2PU5A 4G9GA 4BRSA 3WA7A 3HACA 4DNFA 3V1LA 3HABA 1SFRA 1BEZA 3LP5A 5DTJA 2GBCA 1H23A 5YASA 3NWOA 4Y2SA 4BE9A 2H9YA 4Y2RA 4PO3X 1EDBA 4BZWA 3DOHA 4B0PA 5AK4A 1YB6A 4UHFA 1R50A 2WSLA 4IHAA 3WYDA 2VTVA 4KR0A 1XKLA 4UBKA 3C8HA 2ZSHA 4OCZA 4PF1A 5ALIA 4EB0A 1E8DA 1W52X 5AIBA 2GBIA 5J3JA 2XUAA 1JI3A 3D2CA 3W04A 2WUGA 5ALWA 1QIKA 5DLPA 4UBOA 3K9BA 1CUZA 5SYNA 2HA3A 5HFNA 1OXMA 1LGYA 3WK8A 1ZOIA 1JU4A 1CR6A 1S8OA 1LPAB 4EUSA 3AUKA 3WA6A 1CUFA 3FSGA 1CUVA 4M0FA 2XMRA 3C6YA 2CB9A 2WFZA 1ODCA 1QFSA 2WU4A 4JYPA 1W1IA 3WK4A 1ZJ5A 3OPMA 3O0DA 3FNBA 2HA0A 2XMZA 5C8ZA 1Y7HA 2WUEA 4F0JA 4B0OA 1WHTA 1TKRA 5ALSA 4BVKA 5FRDA 2XE4A 3STWA 1U2EA 5EIHA 3ESAA 3C45A 4ZWNA 3G0IA 1UK8A 2GYUA 4X91A 4KRYA 3C6BA 2JGLA 2QJWA 4BC1A 4BAZA 1DWOA 4Y2VA 3D4LA 4WY5A 1ZIYA 5EHXA 1UWCA 1EDEA 1XZAA 3GUUA 1WPRA 4HS9A 5JIBA 2EEPA 4X6UA 4H7IA 4KACA 3AZPA 5ALDA 1EVQA 1AQLA 4O08A 2HRRA 2LIPA 2WUFA 5DNWA 3WZMA 2WFLB 4HTAA 5HF6A 3G0DA 2OQVA 3D0KA 2K2QB 1LZKA 3AINA 1X2BA 5I9IA 3ANTA 2Y2VA 2HA7A 2H1IA 3WIOA 2AJCA 3I6MA 3U1TA 1VKHA 4PNZA 4P92A 5AK3A 3R40A 4EY8A 1VOTA 5LLSA 2O7RA 2J3QA 4MJ3A 3R3WA 4Z49A 3E4DA 2WQZA 4CCYB 3I2HA 3BDIA 4MQLA 4H35A 4KAFA 4ZV9A 5K3CA 4B83A 3WJ2A 3G9ZA 2BAGA 4QEKA 2JEYA 3QMVA 3I28A 3LIPA 4GWLA 5D3ZA 2WIJA 1WCYA 1FFBA 3WKCA 2HADA 4LXIA 3WI7A 5AI0A 4J0KA 4KE6A 3L1JA 2H7YA 2XLBA 2XMSA 4BBZA 4QDOA 3IUMA 2ZJ6A 4H7KA 4C4YA 2Y1KA 2PL5A 1SCQA 3C5VA 2JIDA 4EHBA 5DNUA 4J0GA 3D3NA 1Q83A 1CUHA 1U4NA 4NVRA 1MT3A 4RNCA 5HKAA 3QVMA 5AKLA 5K3AA 1XRQA 2X8BA 4KE9A 3FBWA 5A62A 1E3QA 3A2NA 1MNAA 5ALJA 3STYA 3STTA 4GXNA 1ZD5A 4OU5A 4B85A 1JFRA 4F5ZA 1GPNA 4G8CA 4GI1A 1P0IA 4WDRA 3H2GA 3PI6A 3A6ZA 4RGYA 2DQZA 2XMGA 4UUQA 5JAHA 1B6GA 4MEBA 4BCBA 4YX9A 2QRUA 3D2AA 5CBKA 4Y2PA 2QKYA 1ACLA 1DWPA 3NOXA 5SYMA 1LNSA 1E8MA 2Z3ZA 2QXTA 3DKKA 3LIIA 3X3HA 5AKEA 3ZV7A 4J0JA 2OGTA 4IO0A 4EZIA 1BU8A 3CN9A 5CT4A 4Q3LA 2AJ8A 2HM7A 4K6KA 2QTBA 4AN1A 1LPOA 2J3DA 5LZ7A 1EK1A 4DYHA 5E4YA 1MTZA 3FWHA 3V1KA 4P08A 3D5EA 5DJ5A 3WWCA 1QGED 4MWTA 5AI5A 5AKIA 2GBFA 1MJ5A 1QIFA 3FSGD 3PDCA 4UHBA 5FOQA 1IZ7A 4QLAA 5AI6A 1ZGBA 1IUNA 1JKMA 3Q8WA 3C70A 5ALEA 2ORYA 5E2IA 4Y2YA 4HVTA 5AM5A 5LKAA 2JGJA 3C6ZA 5ALTA 3BJMA 3CXUA 3H04A 4K5QA 4EA6A 1PFQA 2WFLA 2XMDA 3VVLA 1XZIA 5EIAA 3M83A 5CW2A 1W6RA 4D9JA 3DYIA 1X2EA 5ALFA 1VE7A 4Y2TA 1CUIA 4FMPA 4UFNA 2HA4A 1HBJA 2XUKA 4DSAA 5DYYA 5BOVA 3SK0A 2JGFA 5D3KA 5I7UA 1L7AA 3G7NA 2HFJA 4Q05A 3F96A 1Z68A 4H77A 2ZYRA 5LZ5A 2D0DA 4JUIA 3KDAA 1Y7IA 1CUUA 2YYSA 4QWMA 1VZ3A 1QIHA 3M82A 3HEAA 3I2IA 1ETHA 2OCIA 3FVTA 3M3DA 1AKNA 2BUCA 1DU4A 1BCSA 2HFKA 2PM8A 1ZIXA 1VJ5A 3W9BA 4TGLA 1P0MA 4ZGBA 3MUOA 4DNQA 3NGMA 4W1SA 4BVLA 1QIDA 1XKTA 4X3CA 3RARA 4OB7A 3PICA 2Z5GA 3DNMA 5AO9A 3L1HA 1E5TA 3O95A 2RHWA 4TPKA 3WJ1A 3IUJA 3O9VA 3ZI7A 3ICWA 1CQWA 1MNQA 2I78A 4AO7A 1M33A 1Q0RA 4GBGA 5DYWA 4BRZA 1ISPA 1H2WA 4LYEA 1NU8A 1J07A 5EGNA 1GZ7A 4ITVA 2WM2A 3WK5A 4B82A 3IBTA 3F67A 5ALLA 1XQWA 2QZPA 5JATA 4FNGA 4LXHA 3G0GA 4GW3A 2PBLA 2PKYX 1CEXA 3EBLA 2PSDA 5A6VA 1G66A 3BIXA 4DTCA 2C5GA 4X00A 4LXGA 4X85A 5K3FB 3PUHA 4I3FA 2ES4A 3YASA 4W63A 5EI5A 2PSJA 1EB9A 3O9MA 3H2HA 4BDSA 3DL4A 1KEZA 4BCCA 4DNOA 2XUPA 1BN6A 3STVA 1YS1X 5ALPA 1UKBA 4FNMA 4OB6A 2D5LA 4W1PA 1MO2A 3W9UA 2W6CX 1IUPA 3FAKA 3HC7A 5AM2A 3BE8A 4DMFA 1HPLA 3KWFA 4QZVA 4G9EA 4DMHA 3HLKA 5ALKA 3SC2A 5LIPA 3D2BA 4XJVA 2VEOA 4AB1A 4FOLA 1WOMA 2QXUA 5FLKA 5DYTA 5JZ9A 2JGIA 4DNPA 4RPCA 4F60A 1IVYA 3G02A 1TIBA 1LPPA 5DWDA 4Y9SA 1WB5A 4ZRDA 2HA5A 3ZLVA 1XQXA 1R88A 4CFSA 2WFMA 5FXMA 1JJIA 3BF7A 3TRDA 5JZSA 1IMJA 1R9NA 4PSDA 3V1NA 2DHDA 4X90A 1ACJA 3AIMA 2C5FA 3O4GA 4GHWA 4A16A 3GBSA 4K6HA 4QNNA 1JT2A 4HAIA 4HXFB 2VT7A 1XLUA 1Y37A 4GDMA 2XI4A 4F21A 5AJHA 4BTLA 1TCAA 2PUJA 5JAUA 1SCIA 2DHEA 1ZD2P 1XZJA 2XMCA 4IH1A 4C88A 4CI9A 1OCEA 4EY4A 5EIEA 4LIPD 2CMFA 4J0CA 1G5FA 3QPCA 3G9TA 2YH2A 3EQ8A 4N5IX 1ZI9A 1WB4A 1EVEA 1XZEA 2XQFA 1ZGCA 1QZ3A 3BL8A 5AM4A 3FLAA 1XFDA 2XQIA 5IKXA 1XZGA 4DSZA
chains in the Genus database with same CATH superfamily
4NU6A 4CM4B 3LT4A 3OQPA 5IDQA 5AMXA 4BNNA 3DF9A 2YNMD 1YB7A 2NVBA 1AJEA 1R0CA 3UF0A 4QTUB 3K7EA 5JMWA 1IN1A 2HJSA 5GQSA 3H5OA 2XT6A 1P1HA 3QNWA 3I2JA 2VLIA 2IHTA 3AEKA 3C97A 4B3TB 1X3LA 1SHUX 3L8YA 3LT0A 5CJJA 3OJWA 4Z7JA 4JHXA 4LBVA 4EP1A 4D82A 3U44A 5DHQA 5G41A 4NJEB 3B51X 2R11A 4IIBA 1CF4A 3JQQA 3QFRA 1ETUA 4FHFA 4XIGS 3H3FA 4LJ7A 3RTDA 4B3SB 3D1JA 4B35A 1I1NA 4IYRA 5E7MA 2P6OA 3D59A 5DTIA 4A6XA 1N9GB 4UNPA 3I9KA 3NQ41 1VHJA 3L6DA 5ILGA 1E4YA 3LECA 4AYWA 3BWCA 1QIEA 4Q3AA 1FSSA 5C7YA 1YU6A 2ATVA 1XPRA 5H5JA 5AM3A 1ADBA 4YQYA 4X54A 2Q7DA 5KOYA 1AHNA 1Q12A 3O38A 4GMGA 1M2JA 4PS1A 2P6PA 2DFTA 2JAWA 3I2GA 4NBWA 2X22A 1HKHA 2CXHA 3OOJA 4R0VA 2AC4A 5I3CA 1RMQA 3WRYC 4S05A 1QX3A 2YS6A 1WXEA 3W5BA 4EQ6B 3AIOA 3DCIA 4RCVA 1NUPA 1M75A 3GN2A 1N8NA 4MS1B 3V9AA 1QRUA 3W2TA 2FN8A 4OLHA 5KYTA 3UH0A 2VSFA 1KQOA 4R68A 2XUGA 5HQ3A 1IZYA 1H6CA 2VRBA 1EUDA 2ZE8A 2FQXA 3MFYA 4C6TB 2QGNA 4BP1A 1U2QA 4YP9A 4L4ZA 3EG9B 4RWZA 4F3NA 4P53A 1LVUA 2J59A 4UZEA 2NYUA 4B84A 2PLFA 3CH5A 3FE2A 4RKWA 4R1NA 5A71A 3F6RA 5ECGC 2Y92A 3KEGA 4KQGA 1B6TA 3WISA 4HI0E 5HGXA 5G0SA 2EFEB 1F8XA 3QXJA 1I2CA 1YH3A 1GU7A 4JJAA 4LFCB 3DD5A 3DL7A 1G7TA 2OHGA 5KU7A 2JJ1A 2QRNA 1BN7A 3A4TA 2YDYA 1CUYA 1FXUA 1DLJA 1UDRA 1W48A 3CR3C 2UYYA 3QHPA 1WPXA 4OMCA 3DFIA 3M8KA 5TLSA 4FMDB 2OD9A 3GLSA 3UWKA 2IITA 2X4GA 2EL7A 4LJSA 4ZCMA 2GGSA 1CY4A 3LQRA 2Q6OA 4HAVA 2OCXA 4DDMA 3DW3X 1O08A 3PNKA 3F9RA 3GLGA 2W9XA 1EK0A 1TOAA 2NNLD 3KEOA 5D85A 4BV8A 4FEEA 5IXYA 4RK6A 2A1UA 4AZ3A 3K73O 1RT9A 1YZ3A 1VMIA 2LKCA 2JNWA 4O4LA 2R6ZA 2OGWA 4GAEA 4RGVA 4DMRA 1TIPA 2B61A 4DDUA 1AX9A 2PGIA 721PA 4YYZA 3GH1A 3GZJA 3RVQA 2BEUB 1QQ7A 1VYTA 3DLAA 2GZHA 3AF5A 3HEBA 3PFBA 4LFBB 2QJTA 3I72A 3WLAA 4EECA 1U7WA 3EEFA 4UQPA 1ITZA 2QT0A 4MRMA 2Z6UA 1QWSA 1H1LA 3HJUA 1C7IA 1HDEA 5IJ0B 4X64B 2ZBDA 4Q3OA 2RHMA 5AKKA 1UOPA 1JE0A 3CE9A 2BTQB 3DC2A 4Y2JA 1SOVA 4MR9B 5IP5A 4BX8A 1YF3A 3LLCA 3MJFA 2DJIA 4F11A 2WPNA 2P6RA 2G77B 4IHJA 4JQSA 4FN4A 3E23A 5BR7A 2AOTA 2Z1DA 1D5WA 3KSZO 1JSCA 4JFAA 4RCZA 4IFBA 5K3BA 1GAQA 1GLNA 1L5LA 3ADCA 3EZ7A 1WDWB 4J03A 3KXKA 2WPDA 3QKSB 4KYVA 1JDJA 2QX4A 5BYKA 1AKEA 2YBEA 2YV5A 1SCKA 2Q5FA 2QI9C 2RARA 3C1OA 4W8GA 4XXHA 3ZBPA 5J59A 3T5AA 1BE6A 3GI1A 1QC5A 2TMYA 3LPCA 4M9RA 5CFRA 1Z39A 2NSHA 3PKJA 3LP6A 1BGVA 1S2IA 3AZOA 5JXJA 4TN1A 1FFEA 1CEEA 4FBLA 3NU1A 3FNFA 3PI7A 2BGNA 1Q16A 2W22A 2CFRA 4MS3A 5EWJB 5GINE 2PU7A 1XCMA 3OT5A 4TVKA 3ZCRA 2I1LA 2QTTA 2ZTHA 2JANA 1A5TA 3N07A 1DMRA 2NTVA 1QP8A 4HEJA 3AXSA 2OCDA 1QMPA 1TQ6A 2EF0A 1IJFA 4LPKA 2J5QA 3FKQA 1JR3A 1W88A 2ZRDA 1KDRA 4TWRA 3UC5A 5DW0A 5I7WA 4IKEA 5B3KA 4QUIA 1YRAA 3PZRA 4TLMB 1PO7A 3RYFA 5EJIA 5KNBH 3PUXA 4KXFB 4F3CA 4DR4B 5ALRA 5ALXA 1QHYA 2VJAA 5K0GA 2CEKA 1PQPA 3H6HA 3MGKA 1ZIPA 4YWHA 1DO8A 4URUR 1HYGA 3FTDA 4OG2A 5IKEA 4HG2A 1ECBA 1LTQA 2I6SA 4RE6A 5JC8A 2JIRA 4HWPA 3U31A 3P0RA 1WS6A 4G0ZA 4ZOAA 4YASA 4ZIRA 5TX7A 3DEYX 3QJYA 4FR0A 3OOWA 1FSPA 3PNOA 2VOEA 4KQKA 1M2WA 2QN9A 3K0AB 3MB5A 3U7QA 4LRTB 2FDCA 4BTVA 3GLRA 3OJCA 5IVHA 1E2QA 1QKKA 2BHNA 3AETB 3KOWA 5AKZA 2A84A 4IIDA 4IZ6A 1M5RA 4IRMA 3K8ZA 4A4DA 4K40A 4RKRA 1E79A 1E61A 3PNVA 1TYBE 4R0NA 4XYLA 5C7IO 1EGMB 5CCXA 2OBLA 4PTYA 3TWOA 4MDYA 221PA 3ASZA 1JG4A 2F1IA 4WKBA 4R41A 2AK3A 4IWXA 4QUHA 4F5YA 5TVGA 5DXAA 3AV3A 3ONDA 3WIEA 1TVEA 2HU8A 1SVNA 3IAS1 5AD1A 5HRAA 3HP4A 5IVKA 4BNYA 5B3JA 3V8NA 2BDUA 2CDRA 3N2KB 1B2LA 1CFZA 4QLOA 5EZYA 3SYKA 3SZLA 5BN3B 2FPKA 3GRCA 3M34A 2DFNA 4I14A 2BCJQ 2UZ4A 4NCBA 5AXAA 2J3MA 1UZAA 1KQNA 3COJA 4CQLA 1XZBA 2PRIA 2WDPA 1OFTA 4HNSA 1OTXA 4R8VA 1RQLA 2G5PA 1EIZA 2JS7A 1BKYA 3JAKA 4RK1A 1OX5A 1RE0A 4CFZA 1TRKA 3H11A 2AJDA 3LW8A 4Q3DA 3VA7A 3U4CA 4Z1OA 1B8UA 3EXEA 2VHCA 2GX6A 4TLDA 2ZAOA 4QASA 1YZFA 3TBFA 2EEZA 4PANA 1NKSA 2V5VA 1PGJA 2AXEA 2VUHB 3MF4A 1XSEA 4PM4A 3UT5B 2X5OA 2FN4A 2VHVA 3K5IA 5KQRA 2OWDA 3U9SA 2Z6AA 3GNSA 3R4CA 2G0AA 2PSHA 1XDZA 4MI3A 3A6JA 4GEGA 4KN9S 3REQA 2QRJA 1YTLA 4P3PA 2JD0A 5DHAA 4ECEA 1SG0A 4PN7A 1Q84A 2VNJA 2DFKB 2ODTX 5TQ0A 1EJBA 1LK0A 2V6GA 3CLRC 5DF1A 4CMIB 4F1KA 1S8NA 2E82A 1QXSA 3NOVA 4MYTA 3KSBC 4D96A 3UWSA 1CB7A 2HHCA 4M54A 2OM6A 2IPNA 4GNRA 2ZTMA 3VNSA 1RJ9A 3N0TA 1N2OA 1WMSA 2Z8YA 4GPBA 2BKVA 2FHSA 3GT7A 4IRUB 4UEOA 3VU3A 5JAPA 2HKIA 2XA2A 5K0TA 3PS9A 3BA1A 2F67A 2XT0A 4FYJA 1Q6YA 4JCOA 4P1ZA 1SUEA 2O3QA 3VFDA 3W2GA 4V1CA 2J32A 3BMNB 3V00A 3ZIAD 5K2OA 4BLSA 1B0ZA 4ZC1A 4E2FA 2XGGA 5FTNA 3JU3A 3BJRA 4ZJUA 4PW0A 1HEIA 4IDHA 5KU1A 2R0QC 1YTUA 1Q91A 1FJXA 3BF8A 3QG5A 3S8EA 3NIGB 3RFTA 3KQVA 1Z7GA 4U5QA 1H9BA 1PLKA 1ORVA 2COKA 4Z8XA 1IG3A 5CCDA 1XDUA 2BGLA 1P9WA 3BH7A 2WHRA 4H31A 3T3HA 5BWBA 4B6JA 4DRYA 5F77A 1UDCA 1CT9A 1LXCA 3QNMA 5FOSA 5T67A 1U1GA 4BN4A 1ZK1A 5ERXA 3C87A 1NVUQ 3IAUA 1B3BA 1VP9A 3OU7A 1IC6A 1RYEA 3HE3A 3I04A 5EKXA 5KSPA 4G8BA 4B32A 4B3GA 1M2GA 3PP8A 1SH7A 5H02A 4AQDA 2XVMA 2A0FA 4ZHSA 4U6NA 2JZCA 1E2IA 3RH0A 4D3YA 5IRCD 3H3XA 2VWGA 2PEZA 1LFAA 4NE9A 2FV8A 3WR5A 1NN3A 3TOZA 4HO1X 1G6KA 1U0JA 4DEVA 3HBLA 5CB6A 3T41A 3SR4A 4AF6A 3DTVA 4Y2HA 3ZH9B 3BXEA 4WK0B 3D31A 3ZVNA 1ABFA 5CW1A 4WGFA 4Q00A 5KYWA 4WJLA 2CD7A 2ZPTX 3T5TA 1CIPA 4C78A 1WXWA 5K0JA 3JQAD 2J48A 2PX3A 2ZJOA 3N3BC 4HZIA 5G1PA 4E4YA 2JJMA 2D54A 2PVCA 1N0WA 2QSYA 4PPGA 2IHKA 2J9FA 4WFIA 4DF3A 4MR7B 5BW5A 2AZTA 5FA6A 1QLJA 1W96A 3RTCA 4D4MA 5KB3A 1Q7BA 3RKSA 3N0RA 2EC5A 1A8QA 3P0FA 5ESRA 4L28A 1KAEA 3GVXA 3OT1B 4BBJA 4FWIB 1N33B 4US2R 3FNHA 5LIRA 1NVEA 2E49A 2Z9DA 3LS2A 4WD3A 2VQ3A 1N4DA 3WNQA 4ED9A 3IE0A 3FLBA 1B41A 2EW8A 1DFGA 2IEGA 3A31A 1YMQA 1ZD3A 2AF4C 3BWDD 4JBNA 1U0EA 1M1ZA 1OUMA 1Q0LA 1GGEA 4ND5A 5E8JA 3PPVA 3BFVA 3GROA 5G0WA 3SI7A 5A2QA 2IXDA 3FPJA 2CXTA 4L8WB 4ESVA 3M4NA 2ZR8A 3D54D 1WUKS 4KSYA 1FDOA 1FFXA 1W93A 2FW1A 2VSOA 3AFMA 3QNUA 2EIHA 5DCUA 3TGPA 4V2IA 1HX7A 1IWBB 2NO9A 1JAHA 2HCRA 2B20A 3OQJA 1KVSA 3PNPA 1M3SA 3FCOA 4I1YA 1PG0A 3RSCA 5JC1A 4FHDA 3QMWA 3CJTA 4C87A 1W5SA 4TTAA 4O4HA 4CG3A 1JLKA 2I29A 1A8SA 4MWZA 3B1VA 1ORDA 3KHUA 2M6RA 3LYHA 3H99A 5EFZA 3C5CA 1CUSA 4LUCA 4EGQA 16PKA 2PA3A 5ICGA 1JYEA 1ZR4A 5J40A 3DLPX 1QLHA 3FPSA 2Q9AA 1NVKA 4HNUA 5A3JA 3J7TA 5JT1A 1GG5A 4LF7B 2ZR7A 3RWBA 1PWYE 4G0XA 3P71T 3VKUA 3J7AC 5EHNA 3UVEA 2CFSA 3ONWA 1SCNE 4EELA 3DLTA 3X2EA 3CLVA 1HURA 5L4LA 3M9LA 4OHMA 4C20A 4O59O 1REQB 5I9LA 3KRTA 5JARA 2A9QA 1XLTC 1GQSA 4K9QA 5BR8B 1LLUA 4JGBA 3L04A 2I1QA 1O9GA 4QEDA 3GUCA 4DDWA 2FZEA 2GJ9A 2QW0X 2R1UA 1YFZA 2UUOA 3JAWB 4EVIA 3NKLA 3NOOA 4ZQCB 1GNQA 3DA8A 4NZMA 4V39A 4J9UE 3FTEA 1MJGA 2OCAA 1U0GA 3IERA 4ABYA 2OHFA 4N0PA 1SVIA 1E99A 2D1QA 5A2GA 1FNCA 1YJCA 3EGVA 4LHWA 3RJZA 3WRYA 3ITKA 4E13A 1K89A 3GY0A 2D7JA 1MW9X 1NMSA 4LEIA 4YXWA 2G6TA 3PKZA 3AVYA 3VH2A 1MMFB 2ERXA 4PYRA 4DJTA 4GUAA 2GBGA 2X1VA 3I0ZA 3P1JA 4S1WA 5E6SB 1PX2A 2YY7A 5FAKA 1RAHA 4QICA 3SX4A 4JYZA 3LO5A 4DHWA 5JZSA 5DP1A 1ID8A 4GLBA 1M83A 1GY8A 3DUFA 4WI1A 1JW9B 4RQTA 6YASA 1XZNA 1ZMXA 1AUPA 1QLWA 2VBCA 3QLUA 4MITA 1TO6A 2NO7A 4HHEA 5IC6A 6NULA 3OQ1A 1KY5A 2ZVPX 5EVJA 2WG2A 1USIA 3M0EA 3L6RA 4ME6A 4CCAA 1YD7A 1IBCA 3ZCTA 4RHYA 1RLIA 1T4CB 4EZBA 5AESA 4Z0NA 1T15A 4PX2A 1W2HA 3ND8A 5CGQB 3H4VA 2RGAA 5L3SB 2VQFB 1QF6A 1BG6A 4LYGA 3QOXA 4W6ZA 1TM5E 3ESDA 2O2IA 3HDQA 4MB2A 4R98A 5BW4A 4UU8A 4G5GA 1VA5A 1SG9A 2GN0A 1R10A 1E6MA 3HNPA 4ZEVA 5KYGA 2IHUA 4L9RA 1ZY2A 5DHUA 3W5HA 3TPZA 4G81A 5SZKB 4FC7A 2BZ1A 2NVUA 4LZLA 2JLRA 5DN9A 4DR1B 1CERA 1ZVQA 4BMNA 3PFCA 4KXQA 2GXAA 2XYQA 2CLKB 2C94A 4QREA 1KDPA 4M1QA 4TMZA 2J3JA 2Q5HA 3OSUA 4NFSA 1LWOA 3QELA 4PLZA 2R1VB 4D3ZA 4HV4A 4FYXA 1P9NA 4J29A 3WMWA 3JZIA 1VIYA 3AJAA 2AE1A 3N6VA 1JLMA 3NORA 5T4EA 5EMNA 5ULLA 3A4MA 3G0CA 4RK5A 3L6OO 1IEWA 2IY8A 5I7OA 2X42A 2ZRJA 1I7QB 5IKMA 1FDSA 1P62B 2KB0A 1J2JA 4MQMA 2ZRPA 3NOQA 2C4TA 1GGNA 3S5UA 2JLYA 4DR6B 3AY7A 4BDTA 1YDGA 2YZ2A 1VA4A 3AP2A 3KHKA 1KIAA 3PX3A 3BSWA 5IC5A 3ZDEA 3D6VA 4B80A 4C7OB 2JGDA 7REQB 3O8LA 3INYA 3KCQA 2RHDA 1G18A 3N8KA 4P80A 3S55A 1A88A 4OKSA 4NK5A 1WUHS 2XEDA 4YALA 2YVUA 2DUUA 3M3PA 3TDNA 1WVIA 3NVDA 4RQBA 1USVA 1BFDA 2UZ0A 421PA 5K8UA 4DLNA 3OF2A 3M5PA 4I50F 4J4BA 4X97A 5EXPA 1DTEA 3TS1A 4POAA 5HCIA 3IAEA 4W1RA 1SXJC 2F59A 2AB0A 5ICMA 2CMDA 3HM9A 1QPZA 3AEUA 3GRUA 4HXEB 3A1CA 1HFEL 2P65A 3QBJA 3CHYA 4BVFA 2FZWA 5AOCA 1WAMA 1W5TA 4M1TA 4OKNA 3WMXA 4J07A 4LOIA 1YZUA 4QSMA 2PZ8A 3QTTA 1UT6A 2EBHX 1HE8B 4L07A 3KQSA 5K8TA 3NGXA 1T1JA 4MHOA 1OFVA 4KVGA 2WG1A 5TY0A 4RVFA 1NBHA 1FBTA 4F72A 1EFCA 1P7ZA 5CDYA 4YQFA 4M1WA 4M7RA 3C3YA 3F5MA 2BVNA 2QENA 3OKCA 1KI7A 2I4OA 5DXFA 2BW0A 4XYEA 3NP9A 5DLQC 3WE7A 2OO7A 3X43A 1Z5OA 3MWGA 3PITA 5DSTA 4G0MA 1EHCA 4AT1A 2Z6QA 1KY3A 3TR0A 4G85A 5DM60 4TYMA 2E3JA 5IN5A 3AW9A 3OZAA 1VB3A 1XHEA 4CDRA 4MGZR 4CZ2A 1W0JA 4EYKA 4W1QA 3PGLA 1E0DA 2IYWA 1JNYA 3BB4A 3IRVA 3B85A 5H1YA 4DLKA 4A2CA 4MLZA 2FJPA 1Y5NA 4JB2A 2ZRMA 3ZXIA 1P1RA 5EVCA 4C6HA 1N7GA 3IO5A 3K2EA 3OSZA 4IUCS 2C2ZA 2PDAA 4QODA 1UPTA 2Y71A 4TSKA 2O59A 2DBVO 3AVTA 2G71A 1HZZA 1O5TA 1VQ1A 1WO8A 2A1TR 3BGWA 2AQIA 1JA1A 3O4HA 1SCAA 3DMNA 3PVSA 3C98A 4IJQA 4HEA1 3ZIAA 3ZWQA 3K71B 4Y6QA 4LHZA 1O03A 5JI3E 3CQ9A 4P4UA 2Q3EA 2ZUFA 5JNTA 5FTWA 1TUBB 1C41A 3KXIA 3QRWA 4WXHA 3RKRA 4DSNA 3B3QA 3HVHA 1JX6A 2K7FA 3AUAA 4TUYB 4O4JF 1UKEA 1UXIA 1SKMA 3HFRA 2Y0CA 2WJHA 2O2CA 4L0QA 4JYMA 1JHXA 2J3HA 2OKCA 2H0RA 2FSUA 1XMVA 5F1PA 4AX4A 2ZJ2A 5IJ9A 4WZAA 1YBVA 5JH7F 2YWXA 3E81A 1MP0A 1TYAE 2CLFB 1PEYA 1U3FA 3F90A 1BHO1 1MZVA 1RP7A 4KOAA 3D3KA 3U3XA 2XGMA 4AJNA 1CNFA 3QY0A 4GVPA 4BQIA 1I33A 1YQDA 4UOEA 2OP0A 1IXYA 1YAHA 1FFAA 1K08A 4HDSB 1NYTA 3AH8A 2PSFA 3FMOB 2FDRA 1G17A 3DP9A 2W4QA 3ZJYA 5K20A 4DUZB 1G8FA 4Z9YA 4DADA 4DQLA 4GSKA 4JEHA 4KZKA 3WRXA 1D2MA 3WBBA 1FDUA 2LRHA 1T1SA 4QDZA 1LF5A 2HQSA 4ALJA 2YV2A 1ACMA 3NTOA 3T52A 1E5XA 4JBGA 4DRZA 4OHBA 4ENVA 4R1SA 4Z2AA 4RMHA 1K75A 4JJ8A 1KPIA 3PNQA 4GG1A 5FV4A 1J42A 1TVCA 3M6AA 4MYDA 3NAMA 4QUJA 1SCDA 3MLEA 3S2FA 4D44A 3ERCA 1TZJA 4DQKA 1EVLA 4BMDA 1OAKA 1Z28A 3WYCA 3IXQA 1JFSA 2X13A 2DWPA 1T9CA 3HHPA 2ID9A 4XVCA 1BROA 2XY4A 1P0FA 3U09A 3ZJVA 2EWMA 2IXGA 4U2GA 4BN0A 3FMVA 1RRPA 5INTA 3H9GA 1UMCB 2VK8A 3B12A 1RQNA 3WGHA 2COEA 2RMKA 2ZRKA 2D8AA 5CB0A 4D26A 3VJRA 4B4DA 4ID3A 2ZREA 3TUIC 2R00C 3JQRA 2YMPA 3I39X 3HB7A 3NDPA 2NUPB 2FTKE 3HA3A 1K8YB 2I7TA 1A50B 3N2ZB 3FWPA 3PHJA 3I6ZA 4FHCA 1YACA 3GBVA 1W2GA 3L8ZA 2H2IA 4F9GA 3KL2A 3R3XA 2QUIA 2BUBA 3CJQA 2R6JA 5BSUA 1SVLA 1ZVMA 5LYJB 3PTLA 5KQSA 3UMGA 5GONA 3DCJA 3RAJA 1N32B 1C4KA 1TQ8A 1TZBA 3C3PA 3CRMA 1M2KA 3GLHA 1M6HA 4HH0A 4HTFA 4MV7A 4D9HA 3KU1A 2NUBA 3WHKA 3W8RA 2P30A 4RK4A 1SA0B 3UJ9A 3RWMB 2JGRA 3LAWA 3LNCA 1WY5A 4FX5A 2W8BB 4P6VF 2JH3A 3NBXX 2DF8A 4RXMA 2YYAA 4E46A 3R3ZA 1KJ9A 2VAXA 2MT9A 3OWHA 4MTLA 1Z4QA 3BK7A 3NDJA 3PXDA 3SVTA 3OZSA 4X8HA 2PRZA 5CDGA 3R3UA 3L93A 3RQSA 2YN0A 4PFSA 3RE1A 2X9NA 1K8QA 5DBGA 3DAOA 2W2KB 3E7WA 4R51A 4E2WA 2ZZKA 1THMA 3DS8A 1QK4A 4TQAA 3UTCA 2PX4A 1U8FO 3SS8A 3EAGA 4WEOA 1E92A 2B1RA 2JI6A 1JDUA 1M72A 1WDMA 3D6MA 4PQGA 3O47A 2JEZA 3DMPA 1TVKB 1F2VA 2O6LA 3KQQA 2WTEA 2PXHA 4RORA 1CS4C 2BSAA 1Z26A 4WLOA 1I7LA 2DWUA 3GA0A 4A15A 3DE5X 2ZJZA 1IOVA 3E3NA 3FHOA 2BCEA 4XCXA 5EIOA 3D7RA 5FPSA 5FHQA 1GKLA 4EEXA 4C4RA 2ZR0A 3UQZA 3G23A 3JALA 2QX8A 3EODA 4BEVA 4CEIA 1Y0BA 2I6QA 2WKRA 3WNVA 2EZUA 1HO3A 3PC2A 1JJBA 4XWKA 1PL8A 4PX5A 5KNCH 3BRCA 1KMNA 1YASA 4OLJA 1E7QA 1VJ0A 4JL6A 4YAEA 2GT1A 1OLUA 3A1SA 2R00A 1WKVA 4RWEA 1XZKA 3WWEA 2Z1NA 1GAJA 3AF3A 1WXXA 3PL1A 4Y2XA 4FIDA 1JQBA 1HKUA 3G9UA 1YJXA 4CT4B 1AGNA 1MC8A 4AUNA 2HSEA 4CBVA 1AGXA 2A5LA 4ZAVA 1C0IA 2OORC 2AZDA 2BTOA 3D1LA 4R3UC 4A6PA 4OMFG 1DBPA 1WW2A 4ENQA 3C48A 3EIEA 1RP1A 4RDHA 3WFJA 1H93A 2ZVJA 5BV1A 4IGEA 5DMHA 1Y7TA 1Q2UA 1E9CA 3FHTA 5ICCA 3QMPA 4RLQA 4RIIA 2ZZMA 3PUYA 3GGDA 4OIMA 3BGVA 2H1SA 2GFQA 4CN9A 5JBIA 3PUVA 3IP5A 4YJ2F 3LHKA 1GZ6A 1XRPA 2P67A 1JHUA 2XNKA 2KHZA 4LYDA 4NYMQ 1XOIA 3EUWA 5J4KA 2GZ2A 1XZLA 4HFRA 4ZAZA 1HDRA 3WK7A 4L16A 2B4QA 3PHIA 3RU2A 1PBTA 4I08A 4O2AA 1RZRD 3FYTA 3UENA 1XLTA 3HKCB 2Q3JA 4ZT2A 2CCGA 2R85A 1XTZA 5LFAA 1GZ3A 1RZVA 2PAFA 2PUTA 2R4QA 4FCTA 2CBXA 4BKQA 4EPTA 1USGA 1PR4A 4KQJA 3TLMA 2CLDX 4G1BA 2VS1A 2ZITA 4F8YA 4Z4CA 2XBLA 1K06A 1FMLA 1JXMA 2V7EA 2ZM6B 1CU1A 1TZ2A 3FAZA 2RK4A 3U44B 4NI5A 3WVNA 4IMIB 1E2EA 1E1YA 4K6GA 4YTEA 2ZUEA 3HNOA 1OWMA 4RIGA 1XAGA 3ACBA 3QMMA 2HJWA 3QWHA 5EA2A 5K1ZA 4N76A 2X8JA 1HM5A 3UPDA 1MIHA 2DUMA 4OHVA 1EZ4A 4JI4B 4KCGA 1E59A 3DBLB 4IIXA 4ZVMA 5B64A 3F2VA 1LCIA 3RROA 2NTEA 4IXMA 2PT6A 3HBFA 1X1RA 1WUTA 4UHCA 2VXOA 4LOAA 5DBOA 4C2AA 2AD1A 1TF5A 3AUJB 4OUDA 5SY9A 1ABEA 1RQXA 5JO0A 3CKMA 3PEFA 2PVPA 1MJNA 1TDJA 2BGGA 5E1MA 4AY2A 2Q99A 5FR1A 3W3AH 3OM0A 4M83A 4RY2A 5JPDA 1USUA 2B98A 4C9BA 1O6ZA 1UBJS 4H3HB 2IW3A 3P9XA 4MWCA 4TVOA 1Z0ZA 2XQKA 3M6FA 2O48X 4DJEC 4E08A 4YMTA 1FPMA 4HN4B 3ORYA 5JS2A 4CMGA 1RQGA 3PE3A 4FI3C 4CG1A 3VAZA 5JCXA 1SUPA 3QVKA 2P9TA 2YWHA 4GS5A 1KK0A 2F1OA 2C98A 3FF1A 4MVCA 2DRIA 1Q7RA 1SHLA 2EQ5A 2IJGX 2QD2A 2YWEA 1CLEA 3K1JA 5F35A 2R66A 5LYJF 4AICA 4U6QA 3KXPA 1TEZA 5F7OA 4Z1MD 2XUHA 1Z22A 3RQIA 3PJRA 2Z8XA 4EUKA 1CD5A 1QH1B 2E4VA 2WNHA 3VHRA 4B09A 3N1UA 3SFZA 3JQPA 5IJ9B 1FP2A 4QQ8A 4MVJI 3PXBA 1G8KA 1CP2A 2BDEA 2ISSD 5AKHA 3FMGA 2GS9A 1DO0A 1H8ED 3A25A 1CIJA 3H0CA 3JSAA 4GGOA 3N2YA 4JYCA 4TLBA 3TH5A 1II8A 4FCCA 2QG9A 1CQZA 1QZXA 3P4YA 4PLWA 2QRGA 3BOSA 4QVKA 4LN1A 3U62A 4YUZA 4TZKA 2UXCB 3BSYA 5FL3A 2QBYB 4PBTA 2ZAYA 4NZ9A 1VXOA 1L8AA 3MGBA 1NBME 3B3GA 3LBFA 5F73A 3IAHA 2QRQA 4MYHA 1L1FA 1DKRA 2FPIA 4ZMSA 1WDTA 1WZIA 1K0UA 2G1AA 3Q7PA 3T6KA 1G9TA 3DFKA 3WK6A 1ZVKA 5LQSA 4CV3A 1GUBA 3HU2A 3LDUA 1AZWA 3E8XA 4RH3A 4AUMA 1U2RA 3HL0A 3KKPA 2VF4X 1PGNA 4NCIA 3T4XA 1GTSA 3NBKA 1B43A 1X7HA 3AEUB 3BG5A 2VO1A 1KZ4A 1XEXB 4FFVA 1N5KA 3EGXB 5CRIA 2Z9BA 3UW1A 4QU9A 3A4LA 4MWDA 3AUTA 3ZWYA 4IDFA 3TZKA 3A9WA 5K0BA 2XOXA 3H1GA 4II7A 1H2RS 2A35A 3WTCA 2A59A 4RFSA 4ZHQA 3EVNA 3CB2A 3WXMA 2DTDA 2FY8A 4MB0A 3ROGA 3QEJA 1JEEA 5DWVA 3PSAA 3W6ZA 2B94A 1KDZA 4C3UA 3RUPA 4QARA 4JASB 1G20B 4XYGA 3UWMA 2GNOA 1X77A 2WJYA 1VE5A 3AVVA 1B2RA 1J2YA 2Q3HA 1P45A 4LKOA 4ISBA 5C1IA 4D98A 5EP1A 5LP6F 4GXQA 4NPCA 4ZOLB 1T34A 3UJDA 4QT0A 5F5NA 2YHIB 1JSXA 1CRLA 4FPXA 1MB3A 2W2OA 1YB2A 1GKUB 1QGUB 2J45A 2GRAA 2H0AA 2X23A 1C30A 4LBZA 3EEQA 4NZZA 4EUSA 2DCUA 2HRQA 2JJ2A 1NIJA 3O2NA 1H2BA 2V7QA 2HWYA 3WIVA 4GZLA 2LNDA 3DT9A 5KYUB 1EDDA 1KDOA 2PYIA 5EEHA 5HEKA 2QUHA 1QS0A 2V65A 1GUYA 1ZUHA 2FPMA 3VTKA 2QIOA 3FKSA 1QFXA 3A9CA 4GEKA 4R4JA 3RS8A 3F6YA 1HGXA 1UDWA 2JH9A 3KBOA 3ME5A 1DINA 1WOYA 2RHTA 3A3OA 4KDCA 4KWTA 3T1HB 1J4AA 1AV6A 3AUXA 4X1YA 5JYEA 4FUTA 1LK5A 2QI9F 1NXOA 1TPYA 1Z8NA 3BVPA 1M7HA 3T06B 2P4EA 2DB3A 2MYPA 2GM9A 5EMJA 2BLNA 5JYCA 1GTL1 3ORQA 4DDHA 2YJNA 4F5EA 3AP1A 4WCFA 4MK4A 1V1RB 1O4VA 4N3AA 1CEYA 4BGIA 3LVBA 2SCUB 4QWWA 5L6MB 2FPPA 1QH9A 2C9BA 1HSZA 1V11A 3ABRB 4M0DA 1I8TA 3N0VA 3BXZA 4EX7A 3DE7X 5REQA 5BYAA 1DHRA 4CDMA 1W46A 1ORWA 3FSEA 1S7CA 4GUDA 4MVJM 5A0VA 1K6JA 3ZDCA 2HSZA 3K1TA 4KK3A 5EJ4A 2VKQA 1VDZA 1YVRA 1SBIA 1XCGB 4P2BA 3TQOA 4PR0A 3V8BA 1YBMA 3H75A 3SSNA 1YI0A 2N1MA 3O4VA 3ZR4B 5CTAA 5D5QA 2XB8A 2I1WA 1SBQA 4CPDA 3IJEB 2MDTA 1EM8B 4UDYX 3HY6A 3CONA 2CLOB 1A2KC 1YRBA 4PU0A 3MMNA 3DHWC 2O07A 2OG1A 3ULKA 3P2OA 4UNSA 4TV8A 3LOQA 5BSFA 1TJ4A 4YCLA 5T4BA 2RGUA 1PGOA 3DPUA 2RI6A 1ZH4A 3RT7A 3MTAA 3QVGB 5KREA 2BCGY 2P9EA 4U2DA 4BWFB 1N2XA 4JI0B 2OLEA 3DNPA 3F3MA 5IYZA 5KPJA 1ODTC 2FQYA 1MAVA 1T0PA 1K2VN 4MWGA 3F47A 3TX2A 1CUGA 3SY8A 1S3SA 3DWFA 4JR0A 5I6DA 1UP4A 4XDGA 2HBYA 1IEXA 5ER6A 3EIUA 5THKA 3GRFA 3O1IC 3M6XA 3A58B 3EDRA 1UBOS 2IHVA 5IAKA 2XSZD 3GEPA 4J0HA 5H8WA 3F0TA 1T9ZA 4U2EA 1RIFA 3U26A 1F60A 5KMGB 1XAIA 4KH1A 5L45A 3BXPA 2RGCA 1W35A 1XCJA 1N2CA 4V38A 1SXJB 3F1LA 3PQ8A 1W87A 1E63A 2C2WA 2P78A 2B1GA 2OT3B 1P5FA 3QYAA 4QAJA 4B6QA 4U7WA 3AKDA 4HQNA 2APJA 3B36A 2WHPA 3U48A 3UBTA 4DB4A 1RXCA 3LO8A 5IT4A 1QGAA 3E5RA 1FB5A 4WK4B 3DDZX 4AS2A 4RA6A 4US0R 3V8MA 3E3AA 2CDBA 2NP7A 4L9SA 4PAMA 5TXGA 1PP4A 4QKQA 5KYXA 3A27A 3VC7A 1QE5A 3GGGA 1IY0A 3IBGA 2RGNC 1MZPA 2IHNA 1DTWA 2HIHA 2NXJA 3F5FA 2XAUA 3JZMA 3G8CA 4MIEA 5F1KA 4JLBA 4OQDA 1AF7A 1WTCA 3RTBA 3S2UA 2JFUA 4KC0A 4EMSA 3VC1A 3N28A 5LQUA 4KH0A 3UW3A 5KTYA 1W19A 4LE2A 4MQ4A 5FB3A 2Q3BA 4WFKA 4AJ2A 4PX3A 3DMRA 3FOAA 4FT4A 3DLCA 1YMVA 3TQIA 3VHQA 5BNZA 5IG2A 4OH7A 4N39A 4C3OB 1TK9A 2VBFA 5IBRA 3ZCPA 5G53C 1C8KA 3W4IA 5IFKA 3RUIA 2AWOA 3INTA 2DHCA 2C3UA 1QFJA 2ZJFA 3HU5A 3M6UA 3M6VA 4M0MA 1WETA 1FDWA 5CJ2A 1UZMA 2AW3A 2XB6A 3KOZA 1CF2O 2DBYA 1IZ0A 4E5VA 4QUDA 4Q19A 4GF5A 1Z38A 5CXXA 3A04A 1P0QA 1VLQA 1AA9A 1CNMA 2YJTD 5H3LA 2XUFA 5ELXA 1YB4A 1GPH1 2JI7A 4OP1A 3I76A 2F4VB 1KYXA 1UPCA 3PQ6A 4FDTA 4FILA 3DHEA 4C0KA 2BPOA 2JGAA 1GU0A 2IYLD 4EAQA 1J23A 3IUPA 4PGMA 2NU9B 4PG7A 3IXLA 4K6MA 3VO1A 3TEJA 3WP0A 1HNZB 3UKOA 3WZ2A 5C53B 5TDHA 2YJ6A 3VZCA 4UAJA 4BNLA 4KXMA 4CV1A 3G2KA 3MS2A 3DBIA 5J9FA 4W8OA 4E6EA 1I6WA 4JNKA 2BBOA 3ZE6A 5C51B 4FFWA 1EA5A 1D2RA 4LF8B 3JQ9A 3KWJA 4FK8A 1JDNA 3OX3A 1ZP6A 4F7DA 5IPFA 4C4OA 1EB8A 4UCFA 3EZ6A 3JQAA 3MAJA 4IVQA 3N0WA 1GPLA 1SVWA 4P93A 4F2HA 3K0CC 2JLVA 1OJLA 5A6SA 2BZGA 3RIHA 2RAPA 4ZOBA 3PXXA 5B2ZA 2FN7A 1T9GR 3T1QA 3DZGA 1M1NA 3FVQA 4O2LA 2YMQA 3ESQA 4KX5A 1QIJA 3CIFA 4KYUA 3SKXA 1Q92A 3ZYCA 1N3BA 2WRZA 1VFPA 2QX7A 3R3SA 4MH0R 4PHCA 5CK4A 1JMYA 4Q12A 4CMJA 2IYUA 2QTFA 3EMBA 3VPCA 5A5DA 1ZKMA 3IE2A 4LSZA 2P27A 2D0PB 4C3ZA 3W2HA 1C2TA 1NBOA 2OHVA 2QVGA 3C3DA 1FS6A 5DLEA 2GN6A 3H7AA 1NUTA 3T7IA 2CYBA 3A1VA 4PIMA 2ECQA 3QUTA 4DV6B 4JJ6A 3ESXA 5H83A 3PEVA 2VUTA 2PZLA 1N2IA 2ECFA 3WLPA 4GRIA 3ZQJA 5FTMA 5LOVB 3NATA 1NJGA 2O3JA 5AP9A 2GZRA 1G42A 2OFPA 2R2GA 2O2SA 3CZMA 3FLMA 1EXDA 2O1SA 2VRCD 4RETA 4R6XA 3ROFA 2QL9A 4NFLA 2JFNA 5JASA 2A1TS 3HN2A 1NJ2A 4F84A 3UWPA 3IOYA 1XMXA 3E48A 5B1DA 1WBJB 2HOQA 4KFSA 4RHFA 5LJIA 3PC8C 1FX0B 1AC5A 1BCSB 4M87A 5KJCA 5COBA 4GP7A 1ZR2A 2HJRA 2PFSA 4P5DA 3L4BA 4INJA 4IAOA 3FFAA 3H9JA 1R8XA 4UEKA 4JP8A 1MH1A 2JLUA 4Z3DA 3GJSA 4UM5A 5BVGB 1W5BA 4K46A 2YWJA 3RUHA 5AI9A 2X4IA 4MUMA 1T8SA 1DS6A 3JR3A 2VPYA 2VYNA 1ISJA 1NOJA 2WB2A 1XPOA 3T3IA 2VPIA 4UD2A 1DAHA 1U9IA 4LXYA 2P7IA 3KUDA 1GQQA 1K92A 2VAVA 4FLEA 3AB7A 1DUIA 3H3JA 1QVZA 2LW7A 3CEAA 2ZQYA 1F2UB 2LVBA 5A4AA 1U65A 2VYVA 2O8BA 4YREA 1Y9JA 3N7AA 4RHXA 1FVOA 1H6DA 4MYUA 4YMSA 1UBLS 5C9ZA 5HUQA 1P2UA 2A6PA 1F20A 4E88A 2R8XA 3P97A 1IY8A 1PCXA 5EQFA 2X40A 2ZWMA 5FWXA 4B3BA 5ALZA 3NRBA 4YXFA 2EIXA 4CIBA 1ABBA 3IEPA 1K7XB 4J7AA 2F3TA 1ECFA 2WTUA 3RTEA 1XEWX 1JECA 2J5KA 4R54A 3CWCA 3R3VA 4WK6A 1T36B 1LJLA 4EJSB 4ETIA 1HE1C 2VDMB 4WLUA 3LHDA 3EG9A 4TL6A 2XA9A 5FAXA 3WKEA 2ZBFA 3BMXA 3LW7A 3LMKA 5LDDC 1KO7A 3DF7A 4UU7A 5F9FA 1P81A 4A0SA 2VH5R 3SWWA 2EERA 2GPJA 4RZ2A 3PR1A 1Z17A 3AL3A 1MX9A 1R18A 3ANXA 3ZI0A 4UUBA 2FHPA 3V3TA 2ISQA 1V6AA 4LCBA 1VDMA 5JFGA 4HLNA 4KXXA 4PGFA 4WBNA 2WILA 3S2GA 3ZVMA 4ZQIA 2OZLA 1UC4B 2OOKA 2V7VA 3GQBA 3S1AA 3U7RA 2Q4EA 2PU5A 3RM3A 3SHOA 4G1EB 3NBMA 5FEMA 2BGJA 1DV2A 2XJ9A 1XVIA 4DXAA 2Z4TA 2HRBA 1KO1A 1WPGA 3IIEA 3L4BC 4J0QA 4Y1RA 4LF9B 2LCFA 1SBHA 2GLUA 5DTJA 3LP5A 1CNEA 3DHYA 3RFFA 5HM6A 2X41A 3CG4A 1GIAA 3NWOA 4Y2SA 2H9YA 4KSBA 4LDPA 4DC1A 1EDBA 4RYLA 1KSHA 1SURA 3AY3A 3GA5A 1U04A 3KP1A 1KF0A 2VWPA 1KZGB 3GN1A 2X0EA 1L5RA 1TPZA 4UHFA 1R50A 1T6ZA 1J0XO 3P2KA 5EKDA 4AY4A 7MDHA 2JFBA 2Q5OA 4CLRB 3NC1C 1E20A 3ZKAA 3FPGA 2FZGA 5A5EA 3WYDA 4FMBB 1POWA 2KI5A 1MOSA 3CW8X 3EA4A 4KR0A 3E7FA 1I1OA 1IQPA 3ECCA 3RC9A 5JDIA 4UBKA 3EXFB 2HF2A 4OA8A 1UBKS 3T99A 1M73E 1G8PA 3MYRA 3S0JA 2NACA 5DHSA 3CRZA 3D7LA 4NJMB 1E8DA 3WFZA 3V1UA 4BFXA 1I7SB 2RC5A 2Z08A 2PJDA 1T36A 5J3JA 3VSBA 1FNSA 3NI2A 2ZIUB 3D2CA 3IFSA 5L9AA 2HMAA 1RCTE 3G7UA 2WUGA 5KOHB 3WGVA 9LDBA 5KTRA 1T91A 1QCCA 2A9FA 1U9ZA 1C9KA 3OE7A 3TBKA 1LV8A 2BFDA 1TZKA 4QTZA 1YZYA 4BXOB 2FMHA 4ZEOA 1DXHA 1GDDA 2WMOB 1ODLA 4NBLA 5I4CA 2C4WA 1S8AA 5EZYF 4DKXA 1P9LA 1OZFA 1C4OA 5H0IA 5HBGA 3C6MA 2NO1A 3MJDA 3HP1A 3USES 3W8DA 4CNQA 1G98A 1DKOA 2PANA 3NHMA 4OQMA 3RV4A 1OXMA 1LGYA 1A76A 2RB4A 4M89A 3K92A 3GP3A 3QWIA 3QLTA 4IV5A 1NIPA 3SQMA 4TTJA 1S8OA 2QAGB 2JAHA 1ZMOA 4Y1FA 1PEAA 3SG0A 2Y99A 4DPLA 1PG2A 4B6EA 4XGIA 4JXXA 3GMDA 1HT0A 1O96B 5A0FA 1DZIA 3LQ2A 5LD2C 2PLRA 2PGNA 1NHGA 1Y3IA 2GZ3A 4RV4A 4LYHA 2JDID 3KPJA 3QVXA 1LY1A 2H9IA 1NP3A 3IC5A 4I1SA 4C7VA 3WA6A 4DLVA 1J90A 4X3OA 1U2SA 1ZNWA 1LI4A 5J4YA 2EHJA 2PMFA 1XA0A 5JQGB 1P74A 1V9LA 3L0OA 3I5AA 2WDZA 2OFXA 5E8RA 2FWIA 3C6YA 1P31A 5DT2A 3NHKA 4HPWA 5T5QA 4ZCSA 2R25B 2G9NA 1JDBB 5I47A 1K98A 3D81A 4RJ2A 3NVMB 1W1IA 3U7QB 1CE8A 1NDUA 4BGUA 1KFCB 4AP5A 1MORA 2PK3A 1NQVA 3ILXA 4FN5A 4MRAA 3FNBA 4A92A 4G0WA 3A1TA 4OX9Y 2GEKA 1Y7HA 2AI3A 3GVIA 4BZQA 1QK5A 2MSCB 1G8YA 2ZWAA 1ZVVA 4X1OA 2EGUA 4HLDA 5C46F 2CEAA 2FCAA 1WHTA 4NMMA 1U63A 1TKRA 2ZB3A 1QU2A 3CE6A 2WT9A 5ALSA 1B8NA 1TKAA 3FGZA 3KC2A 4HGPA 1ODIA 4DV7B 3LF1A 2C9OA 3DBHA 3DKIA 1YVDA 4PLHA 1Z25A 3S29A 2E89A 1JIIA 4GBJA 4KXNA 3ZY2A 2ZUWA 3N2KA 1O8CA 3ESAA 3C45A 1E2JA 1NV9A 1OVMA 1X0XA 2GYUA 4N4AA 5GM1A 3ST7A 4ZT3A 1KZYC 2O14A 1OXVA 2XA1A 3H2YA 5EY5B 5LC1A 1WSBA 2H31A 3NJ4A 4GX0A 4BC1A 4D43A 1RMYA 5C5CA 1SEVA 2CW5A 3DGEC 4I5GA 5IK2A 3JAKB 3Q12A 4FJ2A 1ZIYA 4CFYA 1AMUA 7REQA 4DJFC 3R7DA 1RHMA 3RIXA 4U7JA 3RF7A 3G5LA 4R7ZA 3F7NA 4NENA 1EDEA 4MVJH 1T8PA 1VB5A 2IXTA 3GUUA 1AKWA 3UG6A 1YOVA 2G36A 3DEJA 5DXJA 4I4LA 2KYRA 2JKZA 5JIBA 4JP5A 3O9ZA 4X6UA 2XDQA 1EFPA 1GHTA 4KACA 2H1LA 5FEUA 1UFRA 2GUGA 2CJFA 3G8BA 5HOEA 3I6IA 3QP9A 2LDBA 5ESXA 3EMDA 4B4UA 3CIOA 1VJCA 2G7ZA 2YDXA 4O08A 4R40A 5DTMA 5CFNA 1JJ7A 4L85A 4EA7A 2IQIA 1RC1A 2Y77A 1CVIA 4NAVA 1HE4A 5DNWA 1X7DA 4DV5B 2WJPA 2WFLB 3FB4A 3VBEA 4PLGA 4MV5A 4Y98A 4YDRA 1IJBA 2PSSA 1AKMA 3I9FA 4AF7A 2AMYA 4QBGB 3W8EA 2GHIA 5HVNA 4B48A 3UANA 4GU5A 4QG7A 3O6VA 3QFTA 1E2HA 4CKXA 4OJMX 4DDVA 1RI2A 4LGCA 5TPWB 3M6WA 2K2QB 4DDKA 1JR6A 2IUSA 2I6XA 4X45A 1TD9A 2LXNA 2I2FA 1MC4A 1U28C 3GRRA 4DMUB 1RHUA 1N2ZA 5JVDA 1V7CA 5I9TA 2JAOA 3OCWA 4DTIA 2V3VA 5CA1B 1PQWA 1JG7A 2BFMA 3ANTA 4G1CA 4C08A 1YUMA 3FPBA 3CRVA 1SNYA 2Y2VA 3WQSB 1E9DA 3VR5H 1ZXLA 1G5QA 2HIAA 2AJCA 4AM8A 4L08A 4YHHB 3D4OA 3MD9A 1C14A 1ZH6A 2JGNA 5BT8A 1OOEA 1IBMB 2JLWA 5AK3A 2JFWA 1JBQA 1D9ZA 4MLPA 4EY8A 4XEHA 2D2EA 5K0NA 3UBMA 3V8EA 1E3EA 5LLSA 3KQUA 4IY1A 2O7RA 5LJLA 1F8FA 1PJ8A 1W85B 1PHPA 2CB0A 3QKRA 2EFGA 2QWXA 1U8AA 3DR3A 4CIXA 4YP0A 5EQDA 2QMOA 3HZHA 2J67A 3EAFA 3UJNA 4CCYB 4NXMB 3I2HA 3ED5A 1SJ9A 2Q3FA 2CVOA 4PYQA 4ZHQF 4MQLA 1E9FA 3HUEA 4QOGA 4ZV9A 3BH6A 3GFOA 3ICEA 3PR3A 3U60B 1TAUA 4QDJA 1UADA 3EE6A 3TXAA 3AF1A 3NJRA 5KHAA 4UVEA 6AT1A 4PFQA 4RHCA 2CXQA 3PCXA 3VR0A 5IXSA 4MVJE 1DAIA 2JBAA 3WQBA 4NICA 4CR6A 3H4TA 2C9YA 4BX9A 1AXEA 1BDHA 4EY5A 1FFBA 1UDBA 4PHTA 2W2TA 1OFIA 4YJ3B 2YIVX 1LEHA 3HMQA 4RZHA 2QYTA 4Y1EA 5DW3A 3TE7A 5JFTA 6ADHA 1NJSA 2IF2A 3KCNA 2IYPA 4HDSA 4UULA 3R7NA 1Z8HA 4EFNA 5ABPA 3L1JA 3N2GB 4C7KA 4KHPB 4DSOA 4BMCA 4MPRA 4PG4A 1SN7A 4ZU1X 2XMSA 3JY6A 4QVGA 4WNAB 4BBZA 2XTJA 3SZ3A 5H80A 4TTPA 1MHPA 2E1RA 2QW8A 4KO8A 1ZMRA 4PPFA 1NLMA 4QDOA 4XIYA 1D6NA 2C5BA 3RC3A 3ZXXA 1A4RA 1SXHA 4M1OA 3UPUA 4Q3EA 2ZJ6A 1I4LD 4D74A 4PTZA 4M86A 3LX5A 3PGJA 4DV1B 3QJ5A 1V37A 4FYIA 4Z7OB 4O0LA 4HDNA 4EDHA 3IJRA 2FUEA 1KFBB 1U6JA 4N5DA 1SCQA 3C2QA 3C5VA 3GVHA 3BXHA 4G5QA 4B46A 5JXHA 4JXZA 4HJRA 5DNUA 4D3FA 3D3NA 1YL6A 1FCJA 1O95C 1Q83A 3H86A 1BYIA 2H5IA 2JLXA 1G7SA 3IVRA 4Z4GA 2ZRAA 3JALB 2YVLA 3N6XA 1MT3A 4P3OA 5SYAA 4BFCA 5DT9A 4C2TA 1JMVA 3QVLA 3I9JA 5JG7A 2YW2A 1SZCA 3E53A 3R2JA 5EIBD 3QVMA 2GPNA 4OGKA 2DLCX 5T6BA 4W5WA 1JTFA 4OSOA 3IEVA 3G0HA 3VR6A 5HRCA 2ISCA 4KO1S 1PR2A 3EN0A 1GM5A 2V0GA 3E70C 3ELBA 2JFOA 3EDCA 3GQVA 3RD5A 4GYWA 2F6RA 5EIFA 5EZSA 5ALJA 4L8VA 5K3SA 4DIFA 5AW2A 2A92A 1IOZA 3W9SA 4L5BA 3ENNA 1OASA 3OJOA 2GFHA 1IHYA 1ZD5A 4OU5A 4B76A 2PEYA 4MTCA 5BSTA 2RH8A 4PBSA 1XCBA 4ZJZA 2GEDA 4TL7A 4Q6WA 1P0IA 2PL3A 2XOKA 3CMCO 1S2LA 4MAMA 2ZQZA 2N46A 3TCNA 4B79A 3PI6A 4IPTA 2F1KA 3PDIA 3SU8A 1XZQA 3FCSB 4F91B 1WCV1 5JO9A 1S2NA 3N2GA 4IYJA 2QU7A 5ECYA 3TIGA 1M0EA 2V0CA 1HDOA 4ZAGA 5GADl 1ST2A 1B6GA 1R27A 3V4OA 2FI1A 3LY5A 5EIXA 3CNEA 3QI2A 2HAEA 4QNMA 4FYPA 4U39A 4AG5A 2IP4A 4NU8X 1XWIA 1NUHA 3I2YX 4MEBA 3WO1A 4BCBA 4YX9A 1RM0A 3MC1A 2HK8A 2GBPA 3K0AA 4YMWA 4RD3A 3KG2A 1EUYA 2GTHA 2YXDA 4KR3A 4A91A 1X15A 3B7PA 1ACLA 5L3VA 4PAQA 1PJ2A 4R8RA 2H1CA 2C8LA 1LNSA 1E8MA 4M0KA 2QROA 2Q4RA 4TTIA 4ZCTA 4HSEA 2X14A 3DKKA 5JSQA 1CJMA 1OXTA 1ZBQA 4FQ7A 2V3CC 1C2YA 4GT1A 2G1KA 2C7RA 4Z0TA 1R0KA 2R62A 1U7ZA 1WXFA 3EYAA 4JELA 1JHZA 4ZEXA 3ZDYB 4DG5A 3THWA 4OBWA 2OGTA 3AHCA 3E3MA 1GA1A 3NT2A 1O89A 3GB9A 2QN3A 2P9JA 2NZXA 2ZLBA 3HLYA 2WWYA 4MKIA 5A4MS 4L75A 1ZK0A 2C2XA 2RHJA 3DEHA 4MUYA 1LPOA 3UT6A 4AN1A 2WNIA 4FEGA 2QQGA 4K8OA 3DHNA 2VR1A 1ZD9A 4WLEA 1E2BA 2CFTA 1ZL2A 4V0NA 5KSOA 1WV0A 2QQFA 1T13A 3ZNNA 1E7MA 4KUGA 4E1VA 4M7WA 4EW3A 3K0HA 4NCKA 4HAOA 3SEAA 2QN7A 4BMYA 2VYVD 2JIZD 4FHEA 1KMHB 3KLBA 4LX0A 1C7FA 1CR0A 1UANA 3QELB 4WKGA 2VHQA 3OZEA 3UT0A 2PH1A 4MUGA 1QGED 3CUYA 2R751 3P45A 5EXSA 2JCGA 1DBIA 4MW9A 2RSLA 1QU3A 3PDIB 3JRXA 3FSGD 4BXOA 4TTRA 1WTAA 4UOZA 2JAPA 1LFDB 1F2TA 1LV7A 1ZNQO 4G63A 4LMBA 1BX0A 1CVRA 2M2IA 1LRKA 2IV2X 1JQ3A 4HVLA 4XLLA 3ADDA 1U2DA 3OBBA 3RKUA 5FOQA 1WVGA 4QLAA 1MB9A 2X8AA 2RGNA 2XVZA 2IPAB 3MMPA 2PX8A 4LJAA 4D8TA 4PO8A 1LRLA 5CYFA 2X3FA 3E7PA 4KGVA 2IEAA 1ADGA 3V6MA 2OZPA 1J22A 3HU1A 4IR7A 4OQFA 3E7XA 5E2IA 2WUWE 4UTPA 4XRGA 2QVYX 1TQ4A 3QVUA 5AM5A 3GCWA 5BR1A 2AR0A 2JGJA 3H5IA 3TD2A 1NQAO 1FYEA 1ZRNA 5HZHA 3H04A 1XEAA 4YAJA 2GI4A 2GK3A 4CKEA 3LTNC 3V1TC 3OP1A 4TTTS 1FTYA 4C6SA 2YY5A 3S8MA 4AKSA 4CWAA 1LDNA 1TT5B 2PH3A 4GBMA 3M83A 5CW2A 4GOOD 2C8VA 1XK6A 4Z86A 3IESA 1DO2A 2FMFA 3OP4A 1TGYA 3MJCA 5AHOA 4ZVLA 3V4LA 4D9JA 1V71A 3E3OA 3NKFA 4HB3A 4OQXA 2JI9A 3SYRA 3GJTA 1VE7A 1Q1ZA 3OOHA 4IDCA 5IWCA 1G3QA 1ZK4A 2AC2A 1DKLA 1KJZA 4P8RA 5AQ1A 1IQ0A 4HNQA 4LGVA 1R8JA 1L7XA 5D2CA 2Q9BA 3CZRA 4V1CB 2GBLA 2JGFA 1E1DA 5D3KA 2GCEA 1PFYA 4CTMA 1L7AA 2XYHA 2YV4A 3DMFA 2CHQA 1ST3A 3SBXA 3HVJA 3F96A 3UT5A 1XMQB 1KH2A 1Z9BA 1Z68A 3COVA 4QHYA 1RYDA 3D64A 1HEYA 2WWVD 4NZNA 6Q21A 4D6YA 3B5IA 1G7RA 4E09A 4JUIA 1QFYA 1BDMA 1DRWA 3GZNA 1PNRA 2XTNA 1O6BA 4GYJA 1AKQA 1TU0A 1HFWA 1T9KA 4EB6B 1N2BA 2F43A 1VFNA 2AQ8A 2OV2A 2YYSA 6ABPA 3PWSA 4DAEA 1HTWA 4IICA 5TPZD 3SBEA 2BL4A 2OORA 3HEAA 2NT3A 4GX1A 3SR3A 3V6LA 1KZ9A 3RI3A 3ZHSA 1L9KA 5K45A 4XGRA 4R1LA 2OVFA 4LQCA 1C3XA 1XDDA 1PK8A 5EHGA 2P9QA 2I3GA 5J5AA 4B3HA 4NDZA 2RIRA 3IHKA 1WL8A 3KWMA 3FVTA 3FYCA 1OVGA 1T4BA 1UZNA 2VBIA 3P96A 4U0JA 5FL7A 2F3QA 3SS9X 1MEEA 4B7UA 4ZTZB 4R8MA 3IQEA 1JDTA 1B3RA 1JU9A 4IDBA 1KRXA 2HFKA 1CQJB 1G38A 3DBVO 2PM8A 4JN6B 2VJQA 4KX3A 3Q8LA 1VJ5A 2XWJI 1XQ1A 3DZCA 4JLMA 4UCWA 1YRWA 3RFUA 2DBQA 4QFBA 3AW8A 3LBHA 3THXA 2O8EB 4G09A 4BFYA 2WTXA 4I6JA 4LW8A 4ZGBA 1ZM2A 3TRIA 4DNQA 1CIVA 4U7HA 2R1TA 2B37A 2FEAA 2Y9MB 3VVBA 5JXIA 4I55F 5KS2A 2YBDA 1YQWA 5E9WA 4RH0A 5EZ6B 4AUEA 3WAGA 1KNXA 5LMCA 3BERA 3GARA 3D4PA 2YZKA 4C4PA 2VQSA 3OMXA 5FFMA 4DQXA 2GZDA 3ANLA 1J1ZA 2OBFA 3CXRA 3FHCB 4RF2A 3G9QA 4OB7A 1QR2A 1ISGA 4LRQA 2XITA 1Z6TA 4DEYA 4JEUA 2BP7B 1U7DA 3PICA 5REQB 1EVKA 5LXTA 4NOKA 1NQ5A 1T29A 3DNMA 3T3PB 3K30A 3RF6A 2HF9A 1CY8A 3VI3B 5AW4A 2EG9A 3RGWS 3O95A 3E61A 5G40A 4ZVTA 4W9MC 4D0SA 2UXDB 4TLAA 3VNQA 3IUJA 3DFZA 3LQYA 5U4QA 4EPVA 3DAFA 2EBFX 2X7HA 1Q20A 4YJGA 2PZBA 1G5TA 4AO7A 1LBQA 4N3BA 5DYGA 3WYAA 1IAVA 1BTOA 2GCOA 2V58A 3STHA 4BO3A 5H68A 4ETMA 3FWYA 4TL9A 2HCTA 4P5PA 1CZLA 4R7GA 2CE7A 1PYDA 2FQQA 3O90A 1COWD 2JLAA 1ORHA 1P3DA 3F3KA 3H7IA 1C9NA 1NU8A 4TMVA 3THOA 2JLBA 1XPUA 1RJDA 3EVZA 4LJ6A 2WM2A 4GKBA 3IPLA 3WK5A 4GC9A 1GN9A 1N6RA 2X2EA 1O0BA 5JWHA 3WWYA 1DKQA 5GMOA 3PU6A 1GEGA 4FNGA 4ENWA 1I80A 2PGDA 3EHDA 4MAFA 2P2GA 2Q1TA 3LYUA 1KYZA 1O3YA 2WOOA 5CVEA 3E8SA 5K01A 3EBLA 1M6VA 2QDKA 3EZNA 5DASA 2L69A 2JFVA 5A6VA 5ICSA 3F8TA 1F1BA 3W7AA 1WZEA 3JTEA 3HSKA 3P9PA 4DTCA 5IHPA 3MELA 2ZJ4A 4X00A 4BMXA 2Y76A 5KX5A 3BS4A 3R7LA 5K3FB 1KAOA 1RLMA 2WMDA 4I3FA 4MRPA 4Q4AB 3HZZA 1OH8A 5DB4A 2A58A 4WNYA 1Z4OA 2PUVA 3GR6A 4UMEA 3FYHA 1E1KA 2P6NA 1OC4A 2PPVA 4L4UA 3NS7A 5HDBB 4YP7A 2GO7A 2EKLA 4CU5A 4F9FA 5M2QA 3B13B 1PNOA 2D6FA 1V11B 2C83A 4RA6B 2VTKA 1Y3DE 2BP7A 4AW9A 1NBMA 2GZMA 3T5CA 3X1JA 3ZE9A 1BAPA 4Q7LA 4GBED 1L5GB 1SCUA 1DJLA 2C8KA 3G2HA 3WO0A 1BN6A 1EJ2A 5G1NA 2A1IA 4OFXA 1UP6A 2I8LA 2ZKLA 4XD7A 2CKDA 1KJNA 3STVA 1J6UA 3K72B 1UKBA 1UBTS 1PJLA 1HOXA 3EDMA 2ST1A 2GK4A 4MA4A 5IDWA 4DA6A 3S81A 3BB3A 4IV8A 2H4YA 4F4UA 5IJ0A 1E9SA 1IUPA 2RJOA 2MR6A 2FW0A 4XWAA 3OCYA 3RJTA 4EGJA 4MIKA 4RH1A 3FAKA 3OZTA 2CXUA 4L3VA 3HY3A 2Y1XA 3SDBA 1OB2A 1FLNA 4CL2A 3Q1KA 1TYZA 2W0SA 5JY6A 5I5EA 4FFRA 1AHPA 2NUTB 4QZVA 4G9EA 1GA6A 4AD8A 3CNNA 3LUGA 4CM7A 4DMHA 2ADOA 1ULBA 1F48A 3HFGA 3FNIA 4MCIA 5ARDA 5I7SA 4ZCPA 4TROA 4UE2A 3IX7A 1ZIDA 3M1IA 3DEIA 2BI8A 3PZBA 3PC4A 4QPDA 3TR6A 4EYSA 1H3NA 2ZUSA 3RYTC 2GJSA 2BM1A 3I30X 1RI1A 3KOMA 4KZPA 4WN3A 4ZDIA 4I9FA 4MS3B 4Q9KA 3W5IA 1BEUB 4RZSA 1WOMA 5F33A 4QPNA 2ID7A 1V3QE 2QXUA 4B44A 3GCZA 3JASB 3LVFO 2W4IA 2WU1A 1FDTA 3EZFA 5E95A 3VR2A 3BFKA 1JIQA 1FC0A 3OQBA 4RV9A 4F06A 4DNPA 4LWZA 4KMOA 4RPCA 3T7KA 1NG1A 3R3JA 2F55A 1I7DA 1IVYA 4X3PA 1P5HA 4EHLA 1XAHA 4R8SA 1BQEA 3G02A 4B5LA 5KQGA 1NPDA 3M4JA 3TLCA 1TIBA 5FIUA 4MWBA 2QG6A 5AUPB 2ZPAA 2NYVA 4D4JA 3OIDA 2NAPA 3O21A 4H6XA 5EERA 3T34A 2XYRA 3ES9A 2EJVA 1I2BA 1M1YB 1WB5A 4FYHA 4Q47A 4C6RA 4CGYA 2UKDA 2M6LA 4QPJC 2HA5A 1YZNA 4QGAA 1I6MA 3GF4A 5FXMA 1GQYA 1JJIA 1FRFS 1FA9A 1NR1A 1ODFA 1SU8A 4FT2A 1IMJA 1R9NA 2ALJA 1QHIA 1Z18A 2O1EA 2O2EA 2VAWA 2QRKA 3IPRA 3Q5DA 4O2RA 4RVCA 3PHCA 1E3SA 4OJNA 5EPUA 1ACJA 1A9ZA 3OLVA 2IE8A 1V43A 5KTSA 4CEHB 3K4HA 2VXYA 1V6CA 1ZJJA 3I45A 1X8JA 3OA0A 3B6EA 1VL8A 5ECDA 3UFBA 3V9PA 5BWMA 1VMAA 2RH9B 2BM0A 1CF9A 1I4WA 2C78A 4F4HA 3DVLA 1SUIA 1R4AA 1OIXA 3G8AA 4K6HA 2AN1A 4XJTA 4A16A 1MQ9A