3FYWX

Staph. aureus dhfr complexed with nadph and ar-101
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
158
structure length
158
Chain Sequence
TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitory properties and X-ray crystallographic study of the binding of AR-101, AR-102 and iclaprim in ternary complexes with NADPH and dihydrofolate reductase from Staphylococcus aureus
pubmed doi rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase
source organism Staphylococcus aureus
total genus 40
structure length 158
sequence length 158
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3fywX00
5EAJA 1DR1A 4M2XA 1S3YA 4CD2A 4PTHA 5CCCA 1DYHA 3DG8A 3RG9A 4M6JA 4HA9A 4QLFA 1DYRA 4QHVA 1DR3A 4ELFA 3TQBA 1RX3A 3NRRA 2BLAA 3QLWA 3CSEA 3S7AA 1DR6A 3N0HA 5E8QA 4TU5X 4PSSA 4GH8A 3QG2A 4KD7A 4FGGA 4X5HA 4XT8A 3K74A 4P3QA 3D84X 5HSUA 3FRAX 4XT4A 4ELHA 4PSTA 3FQCA 3NXXA 3SRWX 4EIZA 1KMVA 4ELGA 2KGKA 1RX1A 1CZ3A 1DR2A 4KYAA 5CC9A 3JSUA 4DDRA 3F91A 3F8YA 3KY8A 2FZHA 4XE6X 3F8ZA 4ELEA 1RF7A 3QL3A 3SQYX 4NX7A 1M78A 2W9GA 4KEBA 3SAIA 4ELBA 4HA7A 2DRCA 3NZ6X 1LY4A 3SR5X 3IA5A 1DAJA 5HSRA 2JYBA 1YHOA 3NZAX 3SA2A 1LY3A 3FREX 4PSYA 4IXED 3CLBA 2FZJA 1AI9A 3JVXA 3S3VA 1DDSA 3FRFX 1RX7A 3NZBX 1VDRA 5DXVA 2W9TA 3EEJA 3NZ9X 1DG7A 4KJLA 1LUDA 1DLRA 3QYOA 3FL9A 5HI6A 2W9HA 4X5IA 1DHIA 5HF0X 1IA3A 4HOGA 3FQFA 4NX6A 4QJCA 3DGAA 3I3RA 3KFYA 5HQYA 1RX5A 3DL5A 1TDRA 3D80A 2HM9A 1HFPA 4PDJA 4Q6AA 1M79A 1QZFA 3NTZA 3QLXA 3SRSX 3INVA 1RX6A 4OSGA 1RX9A 4KY4A 3SA1A 4H96A 2ITHA 3EELA 4KLXA 1DHFA 4HOFA 3VCOA 4QLGA 4KM2A 4X5GA 1D1GA 3L3RA 1RX8A 3F0VX 1S3WA 1U72A 3QYLA 3GI2A 1HFQA 1JUVA 4IXGX 1BOZA 4DPDA 4P66A 1IA1A 3F0BX 3QLYA 2FZIA 3ZPGA 3NZDA 3QLSA 2L28A 5JG0X 3TQ9A 1CD2A 5HUIA 1DF7A 4X5JA 4QI9A 4KFJA 1U70A 3LG4A 1J3IA 3KJSA 4EJ1A 1RX2A 3DATA 3NZCX 5ECXA 2D0KA 4XT6A 4I13A 1AO8A 2CD2A 4LAEX 3GHWA 3FQ0A 3JWCA 5U27A 3GHCA 4ECKA 1DISA 3ZPCA 4LEKX 1DRFA 4KY8A 4M6KA 3GYFA 3EIGA 1RA2A 1S3VA 3JWFA 3NXYA 4DPHA 1DR4A 3K47A 2ANOA 3FL8A 3ROAA 5JA3A 3TQAA 3NXRA 3FY8X 3FYVX 2G6VA 3NXVA 3FQOA 3SRQX 3FQZA 2HQPA 1RA9A 4EIGA 2BLCA 1BZFA 2W3AA 4XT7A 4Q0DA 3IRNA 3SRUX 3NU0A 3FRBX 5HPBA 3QL0A 4QJZD 4EILA 2W3VA 3DAUA 3OAFA 5HVBA 3EEMA 1DYIA 1JOLA 3QLZA 3EEKA 3SGYA 1JOMA 3I8AX 3F0SX 4H95A 4P68A 4LAHX 3QGTA 4KJJA 2OIPA 4M7UA 3JWKA 1DHJA 4RGCA 5HT5A 4G8ZX 6DFRA 3EX8A 3NXOA 4XECX 2QK8A 2AZNA 5ECCA 3JW5A 1DIUA 3DFRA 4HOEA 2W3BA 3HJ3A 4P3RA 4KBNA 4M6LA 3SRRX 5HQZA 3OCHA 1U71A 1PD8A 5DFRA 3JTWA 4FGHA 1HFRA 2P4GA 1PD9A 1KLKA 2W3WA 4XRBA 2W3MA 3TD8A 4DP3A 1DRHA 3IX9A 3FYWX 3FY9X 1DG8A 4LAGX 3KJRA 2BLBA 2XW7A 3FQVA 1RH3A 3UM6A 4XT5A 4KNEA 5U26A 3DRCA 4QLEA 1MVTA 1RC4A 1OHKA 1DREA 2BL9A 4DFRA 3GHVA 2C2SA 1RX4A 3HBBA 4Q0EA 2HXVA 1E26A 3F0XX 1RA1A 4FHBA 4OR7A 3E0BA 3JWMA 3UM5A 2LF1A 1RA8A 7DFRA 5FDAA 2OBCA 2ZZAA 3TQ8A 2D5NA 1M7AA 3S9UA 1DR5A 3FS6A 2B3ZA 1DRAA 3M09A 4M7VA 1DG5A 1SEJA 4PTJA 3SH2A 1DR7A 3KGYA 5HF2X 3R33A 1J3KA 1DRBA 2H2QA 3FRDX 2C2TA 3M08A 3QFXA 2GD9A 1DLSA 1J3JA 3K45A 2O7PA 5HVEA 3RO9A 3IA4A 1IA4A 3IROA 2ANQA 1PDBA 3UM8A 1ZDRA 4H98A 4I1NA 1AOEA 1RE7A 4KM0A 1MVSA 4G95A 3F0UX 1OHJA 1IA2A 1VJ3A 3K2HA 1S3UA 3CD2A 4KAKA 3QLRA 1DDRA 2CIGA 3Q1HA 1RD7A 2W9SA 3F0QX 4X5FA 1RB3A 5HT4A 1RG7A 4H97A 3IRMA 2INQA 4G3MA 1RA3A 3JW3A 1DYJA 4KL9A 1RB2A 8DFRA 4IXFX 3NXTA 3CL9A 4Q67A 2DHFA 4KJKA 3DL6A 1KMSA
chains in the Genus database with same CATH superfamily
5EAJA 1DR1A 4M2XA 1S3YA 4CD2A 4PTHA 5CCCA 1DYHA 3DG8A 3RG9A 4M6JA 4HA9A 4QLFA 1DYRA 4QHVA 1DR3A 4ELFA 3TQBA 1RX3A 3NRRA 2BLAA 3QLWA 3CSEA 3S7AA 1DR6A 3N0HA 5E8QA 4TU5X 4PSSA 4GH8A 3QG2A 4KD7A 4FGGA 4X5HA 4XT8A 3K74A 4P3QA 3D84X 5HSUA 3FRAX 4XT4A 4ELHA 4PSTA 3FQCA 3NXXA 3SRWX 4EIZA 1KMVA 4ELGA 2KGKA 1RX1A 1CZ3A 1DR2A 4KYAA 5CC9A 3JSUA 4DDRA 3F91A 3F8YA 3KY8A 2FZHA 4XE6X 3F8ZA 4ELEA 1RF7A 3QL3A 3SQYX 4NX7A 1M78A 2W9GA 4KEBA 3SAIA 4ELBA 4HA7A 2DRCA 3NZ6X 1LY4A 3SR5X 3IA5A 1DAJA 5HSRA 2JYBA 1YHOA 3NZAX 3SA2A 1LY3A 3FREX 4PSYA 4IXED 3CLBA 2FZJA 1AI9A 3JVXA 3S3VA 1DDSA 3FRFX 1RX7A 3NZBX 1VDRA 5DXVA 2W9TA 3EEJA 3NZ9X 1DG7A 4KJLA 1LUDA 1DLRA 3QYOA 3FL9A 5HI6A 2W9HA 4X5IA 1DHIA 5HF0X 1IA3A 4HOGA 3FQFA 4NX6A 4QJCA 3DGAA 3I3RA 3KFYA 5HQYA 1RX5A 3DL5A 1TDRA 3D80A 2HM9A 1HFPA 4PDJA 4Q6AA 1M79A 1QZFA 3NTZA 3QLXA 3SRSX 3INVA 1RX6A 4OSGA 1RX9A 4KY4A 3SA1A 4H96A 2ITHA 3EELA 4KLXA 1DHFA 4HOFA 3VCOA 4QLGA 4KM2A 4X5GA 1D1GA 3L3RA 1RX8A 3F0VX 1S3WA 1U72A 3QYLA 3GI2A 1HFQA 1JUVA 4IXGX 1BOZA 4DPDA 4P66A 1IA1A 3F0BX 3QLYA 2FZIA 3ZPGA 3NZDA 3QLSA 2L28A 5JG0X 3TQ9A 1CD2A 5HUIA 1DF7A 4X5JA 4QI9A 4KFJA 1U70A 3LG4A 1J3IA 3KJSA 4EJ1A 1RX2A 3DATA 3NZCX 5ECXA 2D0KA 4XT6A 4I13A 1AO8A 2CD2A 4LAEX 3GHWA 3FQ0A 3JWCA 5U27A 3GHCA 4ECKA 1DISA 3ZPCA 4LEKX 1DRFA 4KY8A 4M6KA 3GYFA 3EIGA 1RA2A 1S3VA 3JWFA 3NXYA 4DPHA 1DR4A 3K47A 2ANOA 3FL8A 3ROAA 5JA3A 3TQAA 3NXRA 3FY8X 3FYVX 2G6VA 3NXVA 3FQOA 3SRQX 3FQZA 2HQPA 1RA9A 4EIGA 2BLCA 1BZFA 2W3AA 4XT7A 4Q0DA 3IRNA 3SRUX 3NU0A 3FRBX 5HPBA 3QL0A 4QJZD 4EILA 2W3VA 3DAUA 3OAFA 5HVBA 3EEMA 1DYIA 1JOLA 3QLZA 3EEKA 3SGYA 1JOMA 3I8AX 3F0SX 4H95A 4P68A 4LAHX 3QGTA 4KJJA 2OIPA 4M7UA 3JWKA 1DHJA 4RGCA 5HT5A 4G8ZX 6DFRA 3EX8A 3NXOA 4XECX 2QK8A 2AZNA 5ECCA 3JW5A 1DIUA 3DFRA 4HOEA 2W3BA 3HJ3A 4P3RA 4KBNA 4M6LA 3SRRX 5HQZA 3OCHA 1U71A 1PD8A 5DFRA 3JTWA 4FGHA 1HFRA 2P4GA 1PD9A 1KLKA 2W3WA 4XRBA 2W3MA 3TD8A 4DP3A 1DRHA 3IX9A 3FYWX 3FY9X 1DG8A 4LAGX 3KJRA 2BLBA 2XW7A 3FQVA 1RH3A 3UM6A 4XT5A 4KNEA 5U26A 3DRCA 4QLEA 1MVTA 1RC4A 1OHKA 1DREA 2BL9A 4DFRA 3GHVA 2C2SA 1RX4A 3HBBA 4Q0EA 2HXVA 1E26A 3F0XX 1RA1A 4FHBA 4OR7A 3E0BA 3JWMA 3UM5A 2LF1A 1RA8A 7DFRA 5FDAA 2OBCA 2ZZAA 3TQ8A 2D5NA 1M7AA 3S9UA 1DR5A 3FS6A 2B3ZA 1DRAA 3M09A 4M7VA 1DG5A 1SEJA 4PTJA 3SH2A 1DR7A 3KGYA 5HF2X 3R33A 1J3KA 1DRBA 2H2QA 3FRDX 2C2TA 3M08A 3QFXA 2GD9A 1DLSA 1J3JA 3K45A 2O7PA 5HVEA 3RO9A 3IA4A 1IA4A 3IROA 2ANQA 1PDBA 3UM8A 1ZDRA 4H98A 4I1NA 1AOEA 1RE7A 4KM0A 1MVSA 4G95A 3F0UX 1OHJA 1IA2A 1VJ3A 3K2HA 1S3UA 3CD2A 4KAKA 3QLRA 1DDRA 2CIGA 3Q1HA 1RD7A 2W9SA 3F0QX 4X5FA 1RB3A 5HT4A 1RG7A 4H97A 3IRMA 2INQA 4G3MA 1RA3A 3JW3A 1DYJA 4KL9A 1RB2A 8DFRA 4IXFX 3NXTA 3CL9A 4Q67A 2DHFA 4KJKA 3DL6A 1KMSA
chains in the Genus database with same CATH topology
5EAJA 1DR1A 4M2XA 1S3YA 4CD2A 4PTHA 5CCCA 1DYHA 3DG8A 3RG9A 4M6JA 4HA9A 4QLFA 1DYRA 4QHVA 1DR3A 4ELFA 3TQBA 1RX3A 3NRRA 2BLAA 3QLWA 3CSEA 3S7AA 1DR6A 3N0HA 5E8QA 4TU5X 4PSSA 4GH8A 3QG2A 4KD7A 4FGGA 4X5HA 4XT8A 3K74A 4P3QA 3D84X 5HSUA 3FRAX 4XT4A 4ELHA 4PSTA 3FQCA 3NXXA 3SRWX 4EIZA 1KMVA 4ELGA 2KGKA 1RX1A 1CZ3A 1DR2A 4KYAA 5CC9A 3JSUA 4DDRA 3F91A 3F8YA 3KY8A 2FZHA 4XE6X 3F8ZA 4ELEA 1RF7A 3QL3A 3SQYX 4NX7A 1M78A 2W9GA 4KEBA 3SAIA 4ELBA 4HA7A 2DRCA 3NZ6X 1LY4A 3SR5X 3IA5A 1DAJA 5HSRA 2JYBA 1YHOA 3NZAX 3SA2A 1LY3A 3FREX 4PSYA 4IXED 3CLBA 2FZJA 1AI9A 3JVXA 3S3VA 1DDSA 3FRFX 1RX7A 3NZBX 1VDRA 5DXVA 2W9TA 3EEJA 3NZ9X 1DG7A 4KJLA 1LUDA 1DLRA 3QYOA 3FL9A 5HI6A 2W9HA 4X5IA 1DHIA 5HF0X 1IA3A 4HOGA 3FQFA 4NX6A 4QJCA 3DGAA 3I3RA 3KFYA 5HQYA 1RX5A 3DL5A 1TDRA 3D80A 2HM9A 1HFPA 4PDJA 4Q6AA 1M79A 1QZFA 3NTZA 3QLXA 3SRSX 3INVA 1RX6A 4OSGA 1RX9A 4KY4A 3SA1A 4H96A 2ITHA 3EELA 4KLXA 1DHFA 4HOFA 3VCOA 4QLGA 4KM2A 4X5GA 1D1GA 3L3RA 1RX8A 3F0VX 1S3WA 1U72A 3QYLA 3GI2A 1HFQA 1JUVA 4IXGX 1BOZA 4DPDA 4P66A 1IA1A 3F0BX 3QLYA 2FZIA 3ZPGA 3NZDA 3QLSA 2L28A 5JG0X 3TQ9A 1CD2A 5HUIA 1DF7A 4X5JA 4QI9A 4KFJA 1U70A 3LG4A 1J3IA 3KJSA 4EJ1A 1RX2A 3DATA 3NZCX 5ECXA 2D0KA 4XT6A 4I13A 1AO8A 2CD2A 4LAEX 3GHWA 3FQ0A 3JWCA 5U27A 3GHCA 4ECKA 1DISA 3ZPCA 4LEKX 1DRFA 4KY8A 4M6KA 3GYFA 3EIGA 1RA2A 1S3VA 3JWFA 3NXYA 4DPHA 1DR4A 3K47A 2ANOA 3FL8A 3ROAA 5JA3A 3TQAA 3NXRA 3FY8X 3FYVX 2G6VA 3NXVA 3FQOA 3SRQX 3FQZA 2HQPA 1RA9A 4EIGA 2BLCA 1BZFA 2W3AA 4XT7A 4Q0DA 3IRNA 3SRUX 3NU0A 3FRBX 5HPBA 3QL0A 4QJZD 4EILA 2W3VA 3DAUA 3OAFA 5HVBA 3EEMA 1DYIA 1JOLA 3QLZA 3EEKA 3SGYA 1JOMA 3I8AX 3F0SX 4H95A 4P68A 4LAHX 3QGTA 4KJJA 2OIPA 4M7UA 3JWKA 1DHJA 4RGCA 5HT5A 4G8ZX 6DFRA 3EX8A 3NXOA 4XECX 2QK8A 2AZNA 5ECCA 3JW5A 1DIUA 3DFRA 4HOEA 2W3BA 3HJ3A 4P3RA 4KBNA 4M6LA 3SRRX 5HQZA 3OCHA 1U71A 1PD8A 5DFRA 3JTWA 4FGHA 1HFRA 2P4GA 1PD9A 1KLKA 2W3WA 4XRBA 2W3MA 3TD8A 4DP3A 1DRHA 3IX9A 3FYWX 3FY9X 1DG8A 4LAGX 3KJRA 2BLBA 2XW7A 3FQVA 1RH3A 3UM6A 4XT5A 4KNEA 5U26A 3DRCA 4QLEA 1MVTA 1RC4A 1OHKA 1DREA 2BL9A 4DFRA 3GHVA 2C2SA 1RX4A 3HBBA 4Q0EA 2HXVA 1E26A 3F0XX 1RA1A 4FHBA 4OR7A 3E0BA 3JWMA 3UM5A 2LF1A 1RA8A 7DFRA 5FDAA 2OBCA 2ZZAA 3TQ8A 2D5NA 1M7AA 3S9UA 1DR5A 3FS6A 2B3ZA 1DRAA 3M09A 4M7VA 1DG5A 1SEJA 4PTJA 3SH2A 1DR7A 3KGYA 5HF2X 3R33A 1J3KA 1DRBA 2H2QA 3FRDX 2C2TA 3M08A 3QFXA 2GD9A 1DLSA 1J3JA 3K45A 2O7PA 5HVEA 3RO9A 3IA4A 1IA4A 3IROA 2ANQA 1PDBA 3UM8A 1ZDRA 4H98A 4I1NA 1AOEA 1RE7A 4KM0A 1MVSA 4G95A 3F0UX 1OHJA 1IA2A 1VJ3A 3K2HA 1S3UA 3CD2A 4KAKA 3QLRA 1DDRA 2CIGA 3Q1HA 1RD7A 2W9SA 3F0QX 4X5FA 1RB3A 5HT4A 1RG7A 4H97A 3IRMA 2INQA 4G3MA 1RA3A 3JW3A 1DYJA 4KL9A 1RB2A 8DFRA 4IXFX 3NXTA 3CL9A 4Q67A 2DHFA 4KJKA 3DL6A 1KMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAJ A;  1DR1 A;  4M2X A;  1S3Y A;  4CD2 A;  4PTH A;  5CCC A;  1DYH A;  3DG8 A;  3RG9 A;  4M6J A;  4HA9 A;  4QLF A;  1DYR A;  4QHV A;  1DR3 A;  4ELF A;  3TQB A;  1RX3 A;  3NRR A;  2BLA A;  3QLW A;  3CSE A;  3S7A A;  1DR6 A;  3N0H A;  5E8Q A;  4TU5 X;  4PSS A;  4GH8 A;  3QG2 A;  4KD7 A;  4FGG A;  4X5H A;  4XT8 A;  3K74 A;  4P3Q A;  3D84 X;  5HSU A;  3FRA X;  4XT4 A;  4ELH A;  4PST A;  3FQC A;  3NXX A;  3SRW X;  4EIZ A;  1KMV A;  4ELG A;  2KGK A;  1RX1 A;  1CZ3 A;  1DR2 A;  4KYA A;  5CC9 A;  3JSU A;  4DDR A;  3F91 A;  3F8Y A;  3KY8 A;  2FZH A;  4XE6 X;  3F8Z A;  4ELE A;  1RF7 A;  3QL3 A;  3SQY X;  4NX7 A;  1M78 A;  2W9G A;  4KEB A;  3SAI A;  4ELB A;  4HA7 A;  2DRC A;  3NZ6 X;  1LY4 A;  3SR5 X;  3IA5 A;  1DAJ A;  5HSR A;  2JYB A;  1YHO A;  3NZA X;  3SA2 A;  1LY3 A;  3FRE X;  4PSY A;  4IXE D;  3CLB A;  2FZJ A;  1AI9 A;  3JVX A;  3S3V A;  1DDS A;  3FRF X;  1RX7 A;  3NZB X;  1VDR A;  5DXV A;  2W9T A;  3EEJ A;  3NZ9 X;  1DG7 A;  4KJL A;  1LUD A;  1DLR A;  3QYO A;  3FL9 A;  5HI6 A;  2W9H A;  4X5I A;  1DHI A;  5HF0 X;  1IA3 A;  4HOG A;  3FQF A;  4NX6 A;  4QJC A;  3DGA A;  3I3R A;  3KFY A;  5HQY A;  1RX5 A;  3DL5 A;  1TDR A;  3D80 A;  2HM9 A;  1HFP A;  4PDJ A;  4Q6A A;  1M79 A;  1QZF A;  3NTZ A;  3QLX A;  3SRS X;  3INV A;  1RX6 A;  4OSG A;  1RX9 A;  4KY4 A;  3SA1 A;  4H96 A;  2ITH A;  3EEL A;  4KLX A;  1DHF A;  4HOF A;  3VCO A;  4QLG A;  4KM2 A;  4X5G A;  1D1G A;  3L3R A;  1RX8 A;  3F0V X;  1S3W A;  1U72 A;  3QYL A;  3GI2 A;  1HFQ A;  1JUV A;  4IXG X;  1BOZ A;  4DPD A;  4P66 A;  1IA1 A;  3F0B X;  3QLY A;  2FZI A;  3ZPG A;  3NZD A;  3QLS A;  2L28 A;  5JG0 X;  3TQ9 A;  1CD2 A;  5HUI A;  1DF7 A;  4X5J A;  4QI9 A;  4KFJ A;  1U70 A;  3LG4 A;  1J3I A;  3KJS A;  4EJ1 A;  1RX2 A;  3DAT A;  3NZC X;  5ECX A;  2D0K A;  4XT6 A;  4I13 A;  1AO8 A;  2CD2 A;  4LAE X;  3GHW A;  3FQ0 A;  3JWC A;  5U27 A;  3GHC A;  4ECK A;  1DIS A;  3ZPC A;  4LEK X;  1DRF A;  4KY8 A;  4M6K A;  3GYF A;  3EIG A;  1RA2 A;  1S3V A;  3JWF A;  3NXY A;  4DPH A;  1DR4 A;  3K47 A;  2ANO A;  3FL8 A;  3ROA A;  5JA3 A;  3TQA A;  3NXR A;  3FY8 X;  3FYV X;  2G6V A;  3NXV A;  3FQO A;  3SRQ X;  3FQZ A;  2HQP A;  1RA9 A;  4EIG A;  2BLC A;  1BZF A;  2W3A A;  4XT7 A;  4Q0D A;  3IRN A;  3SRU X;  3NU0 A;  3FRB X;  5HPB A;  3QL0 A;  4QJZ D;  4EIL A;  2W3V A;  3DAU A;  3OAF A;  5HVB A;  3EEM A;  1DYI A;  1JOL A;  3QLZ A;  3EEK A;  3SGY A;  1JOM A;  3I8A X;  3F0S X;  4H95 A;  4P68 A;  4LAH X;  3QGT A;  4KJJ A;  2OIP A;  4M7U A;  3JWK A;  1DHJ A;  4RGC A;  5HT5 A;  4G8Z X;  6DFR A;  3EX8 A;  3NXO A;  4XEC X;  2QK8 A;  2AZN A;  5ECC A;  3JW5 A;  1DIU A;  3DFR A;  4HOE A;  2W3B A;  3HJ3 A;  4P3R A;  4KBN A;  4M6L A;  3SRR X;  5HQZ A;  3OCH A;  1U71 A;  1PD8 A;  5DFR A;  3JTW A;  4FGH A;  1HFR A;  2P4G A;  1PD9 A;  1KLK A;  2W3W A;  4XRB A;  2W3M A;  3TD8 A;  4DP3 A;  1DRH A;  3IX9 A;  3FYW X;  3FY9 X;  1DG8 A;  4LAG X;  3KJR A;  2BLB A;  2XW7 A;  3FQV A;  1RH3 A;  3UM6 A;  4XT5 A;  4KNE A;  5U26 A;  3DRC A;  4QLE A;  1MVT A;  1RC4 A;  1OHK A;  1DRE A;  2BL9 A;  4DFR A;  3GHV A;  2C2S A;  1RX4 A;  3HBB A;  4Q0E A;  2HXV A;  1E26 A;  3F0X X;  1RA1 A;  4FHB A;  4OR7 A;  3E0B A;  3JWM A;  3UM5 A;  2LF1 A;  1RA8 A;  7DFR A;  5FDA A;  2OBC A;  2ZZA A;  3TQ8 A;  2D5N A;  1M7A A;  3S9U A;  1DR5 A;  3FS6 A;  2B3Z A;  1DRA A;  3M09 A;  4M7V A;  1DG5 A;  1SEJ A;  4PTJ A;  3SH2 A;  1DR7 A;  3KGY A;  5HF2 X;  3R33 A;  1J3K A;  1DRB A;  2H2Q A;  3FRD X;  2C2T A;  3M08 A;  3QFX A;  2GD9 A;  1DLS A;  1J3J A;  3K45 A;  2O7P A;  5HVE A;  3RO9 A;  3IA4 A;  1IA4 A;  3IRO A;  2ANQ A;  1PDB A;  3UM8 A;  1ZDR A;  4H98 A;  4I1N A;  1AOE A;  1RE7 A;  4KM0 A;  1MVS A;  4G95 A;  3F0U X;  1OHJ A;  1IA2 A;  1VJ3 A;  3K2H A;  1S3U A;  3CD2 A;  4KAK A;  3QLR A;  1DDR A;  2CIG A;  3Q1H A;  1RD7 A;  2W9S A;  3F0Q X;  4X5F A;  1RB3 A;  5HT4 A;  1RG7 A;  4H97 A;  3IRM A;  2INQ A;  4G3M A;  1RA3 A;  3JW3 A;  1DYJ A;  4KL9 A;  1RB2 A;  8DFR A;  4IXF X;  3NXT A;  3CL9 A;  4Q67 A;  2DHF A;  4KJK A;  3DL6 A;  1KMS A; 
#chains in the Genus database with same CATH topology
 5EAJ A;  1DR1 A;  4M2X A;  1S3Y A;  4CD2 A;  4PTH A;  5CCC A;  1DYH A;  3DG8 A;  3RG9 A;  4M6J A;  4HA9 A;  4QLF A;  1DYR A;  4QHV A;  1DR3 A;  4ELF A;  3TQB A;  1RX3 A;  3NRR A;  2BLA A;  3QLW A;  3CSE A;  3S7A A;  1DR6 A;  3N0H A;  5E8Q A;  4TU5 X;  4PSS A;  4GH8 A;  3QG2 A;  4KD7 A;  4FGG A;  4X5H A;  4XT8 A;  3K74 A;  4P3Q A;  3D84 X;  5HSU A;  3FRA X;  4XT4 A;  4ELH A;  4PST A;  3FQC A;  3NXX A;  3SRW X;  4EIZ A;  1KMV A;  4ELG A;  2KGK A;  1RX1 A;  1CZ3 A;  1DR2 A;  4KYA A;  5CC9 A;  3JSU A;  4DDR A;  3F91 A;  3F8Y A;  3KY8 A;  2FZH A;  4XE6 X;  3F8Z A;  4ELE A;  1RF7 A;  3QL3 A;  3SQY X;  4NX7 A;  1M78 A;  2W9G A;  4KEB A;  3SAI A;  4ELB A;  4HA7 A;  2DRC A;  3NZ6 X;  1LY4 A;  3SR5 X;  3IA5 A;  1DAJ A;  5HSR A;  2JYB A;  1YHO A;  3NZA X;  3SA2 A;  1LY3 A;  3FRE X;  4PSY A;  4IXE D;  3CLB A;  2FZJ A;  1AI9 A;  3JVX A;  3S3V A;  1DDS A;  3FRF X;  1RX7 A;  3NZB X;  1VDR A;  5DXV A;  2W9T A;  3EEJ A;  3NZ9 X;  1DG7 A;  4KJL A;  1LUD A;  1DLR A;  3QYO A;  3FL9 A;  5HI6 A;  2W9H A;  4X5I A;  1DHI A;  5HF0 X;  1IA3 A;  4HOG A;  3FQF A;  4NX6 A;  4QJC A;  3DGA A;  3I3R A;  3KFY A;  5HQY A;  1RX5 A;  3DL5 A;  1TDR A;  3D80 A;  2HM9 A;  1HFP A;  4PDJ A;  4Q6A A;  1M79 A;  1QZF A;  3NTZ A;  3QLX A;  3SRS X;  3INV A;  1RX6 A;  4OSG A;  1RX9 A;  4KY4 A;  3SA1 A;  4H96 A;  2ITH A;  3EEL A;  4KLX A;  1DHF A;  4HOF A;  3VCO A;  4QLG A;  4KM2 A;  4X5G A;  1D1G A;  3L3R A;  1RX8 A;  3F0V X;  1S3W A;  1U72 A;  3QYL A;  3GI2 A;  1HFQ A;  1JUV A;  4IXG X;  1BOZ A;  4DPD A;  4P66 A;  1IA1 A;  3F0B X;  3QLY A;  2FZI A;  3ZPG A;  3NZD A;  3QLS A;  2L28 A;  5JG0 X;  3TQ9 A;  1CD2 A;  5HUI A;  1DF7 A;  4X5J A;  4QI9 A;  4KFJ A;  1U70 A;  3LG4 A;  1J3I A;  3KJS A;  4EJ1 A;  1RX2 A;  3DAT A;  3NZC X;  5ECX A;  2D0K A;  4XT6 A;  4I13 A;  1AO8 A;  2CD2 A;  4LAE X;  3GHW A;  3FQ0 A;  3JWC A;  5U27 A;  3GHC A;  4ECK A;  1DIS A;  3ZPC A;  4LEK X;  1DRF A;  4KY8 A;  4M6K A;  3GYF A;  3EIG A;  1RA2 A;  1S3V A;  3JWF A;  3NXY A;  4DPH A;  1DR4 A;  3K47 A;  2ANO A;  3FL8 A;  3ROA A;  5JA3 A;  3TQA A;  3NXR A;  3FY8 X;  3FYV X;  2G6V A;  3NXV A;  3FQO A;  3SRQ X;  3FQZ A;  2HQP A;  1RA9 A;  4EIG A;  2BLC A;  1BZF A;  2W3A A;  4XT7 A;  4Q0D A;  3IRN A;  3SRU X;  3NU0 A;  3FRB X;  5HPB A;  3QL0 A;  4QJZ D;  4EIL A;  2W3V A;  3DAU A;  3OAF A;  5HVB A;  3EEM A;  1DYI A;  1JOL A;  3QLZ A;  3EEK A;  3SGY A;  1JOM A;  3I8A X;  3F0S X;  4H95 A;  4P68 A;  4LAH X;  3QGT A;  4KJJ A;  2OIP A;  4M7U A;  3JWK A;  1DHJ A;  4RGC A;  5HT5 A;  4G8Z X;  6DFR A;  3EX8 A;  3NXO A;  4XEC X;  2QK8 A;  2AZN A;  5ECC A;  3JW5 A;  1DIU A;  3DFR A;  4HOE A;  2W3B A;  3HJ3 A;  4P3R A;  4KBN A;  4M6L A;  3SRR X;  5HQZ A;  3OCH A;  1U71 A;  1PD8 A;  5DFR A;  3JTW A;  4FGH A;  1HFR A;  2P4G A;  1PD9 A;  1KLK A;  2W3W A;  4XRB A;  2W3M A;  3TD8 A;  4DP3 A;  1DRH A;  3IX9 A;  3FYW X;  3FY9 X;  1DG8 A;  4LAG X;  3KJR A;  2BLB A;  2XW7 A;  3FQV A;  1RH3 A;  3UM6 A;  4XT5 A;  4KNE A;  5U26 A;  3DRC A;  4QLE A;  1MVT A;  1RC4 A;  1OHK A;  1DRE A;  2BL9 A;  4DFR A;  3GHV A;  2C2S A;  1RX4 A;  3HBB A;  4Q0E A;  2HXV A;  1E26 A;  3F0X X;  1RA1 A;  4FHB A;  4OR7 A;  3E0B A;  3JWM A;  3UM5 A;  2LF1 A;  1RA8 A;  7DFR A;  5FDA A;  2OBC A;  2ZZA A;  3TQ8 A;  2D5N A;  1M7A A;  3S9U A;  1DR5 A;  3FS6 A;  2B3Z A;  1DRA A;  3M09 A;  4M7V A;  1DG5 A;  1SEJ A;  4PTJ A;  3SH2 A;  1DR7 A;  3KGY A;  5HF2 X;  3R33 A;  1J3K A;  1DRB A;  2H2Q A;  3FRD X;  2C2T A;  3M08 A;  3QFX A;  2GD9 A;  1DLS A;  1J3J A;  3K45 A;  2O7P A;  5HVE A;  3RO9 A;  3IA4 A;  1IA4 A;  3IRO A;  2ANQ A;  1PDB A;  3UM8 A;  1ZDR A;  4H98 A;  4I1N A;  1AOE A;  1RE7 A;  4KM0 A;  1MVS A;  4G95 A;  3F0U X;  1OHJ A;  1IA2 A;  1VJ3 A;  3K2H A;  1S3U A;  3CD2 A;  4KAK A;  3QLR A;  1DDR A;  2CIG A;  3Q1H A;  1RD7 A;  2W9S A;  3F0Q X;  4X5F A;  1RB3 A;  5HT4 A;  1RG7 A;  4H97 A;  3IRM A;  2INQ A;  4G3M A;  1RA3 A;  3JW3 A;  1DYJ A;  4KL9 A;  1RB2 A;  8DFR A;  4IXF X;  3NXT A;  3CL9 A;  4Q67 A;  2DHF A;  4KJK A;  3DL6 A;  1KMS A; 
#chains in the Genus database with same CATH homology
 5EAJ A;  1DR1 A;  4M2X A;  1S3Y A;  4CD2 A;  4PTH A;  5CCC A;  1DYH A;  3DG8 A;  3RG9 A;  4M6J A;  4HA9 A;  4QLF A;  1DYR A;  4QHV A;  1DR3 A;  4ELF A;  3TQB A;  1RX3 A;  3NRR A;  2BLA A;  3QLW A;  3CSE A;  3S7A A;  1DR6 A;  3N0H A;  5E8Q A;  4TU5 X;  4PSS A;  4GH8 A;  3QG2 A;  4KD7 A;  4FGG A;  4X5H A;  4XT8 A;  3K74 A;  4P3Q A;  3D84 X;  5HSU A;  3FRA X;  4XT4 A;  4ELH A;  4PST A;  3FQC A;  3NXX A;  3SRW X;  4EIZ A;  1KMV A;  4ELG A;  2KGK A;  1RX1 A;  1CZ3 A;  1DR2 A;  4KYA A;  5CC9 A;  3JSU A;  4DDR A;  3F91 A;  3F8Y A;  3KY8 A;  2FZH A;  4XE6 X;  3F8Z A;  4ELE A;  1RF7 A;  3QL3 A;  3SQY X;  4NX7 A;  1M78 A;  2W9G A;  4KEB A;  3SAI A;  4ELB A;  4HA7 A;  2DRC A;  3NZ6 X;  1LY4 A;  3SR5 X;  3IA5 A;  1DAJ A;  5HSR A;  2JYB A;  1YHO A;  3NZA X;  3SA2 A;  1LY3 A;  3FRE X;  4PSY A;  4IXE D;  3CLB A;  2FZJ A;  1AI9 A;  3JVX A;  3S3V A;  1DDS A;  3FRF X;  1RX7 A;  3NZB X;  1VDR A;  5DXV A;  2W9T A;  3EEJ A;  3NZ9 X;  1DG7 A;  4KJL A;  1LUD A;  1DLR A;  3QYO A;  3FL9 A;  5HI6 A;  2W9H A;  4X5I A;  1DHI A;  5HF0 X;  1IA3 A;  4HOG A;  3FQF A;  4NX6 A;  4QJC A;  3DGA A;  3I3R A;  3KFY A;  5HQY A;  1RX5 A;  3DL5 A;  1TDR A;  3D80 A;  2HM9 A;  1HFP A;  4PDJ A;  4Q6A A;  1M79 A;  1QZF A;  3NTZ A;  3QLX A;  3SRS X;  3INV A;  1RX6 A;  4OSG A;  1RX9 A;  4KY4 A;  3SA1 A;  4H96 A;  2ITH A;  3EEL A;  4KLX A;  1DHF A;  4HOF A;  3VCO A;  4QLG A;  4KM2 A;  4X5G A;  1D1G A;  3L3R A;  1RX8 A;  3F0V X;  1S3W A;  1U72 A;  3QYL A;  3GI2 A;  1HFQ A;  1JUV A;  4IXG X;  1BOZ A;  4DPD A;  4P66 A;  1IA1 A;  3F0B X;  3QLY A;  2FZI A;  3ZPG A;  3NZD A;  3QLS A;  2L28 A;  5JG0 X;  3TQ9 A;  1CD2 A;  5HUI A;  1DF7 A;  4X5J A;  4QI9 A;  4KFJ A;  1U70 A;  3LG4 A;  1J3I A;  3KJS A;  4EJ1 A;  1RX2 A;  3DAT A;  3NZC X;  5ECX A;  2D0K A;  4XT6 A;  4I13 A;  1AO8 A;  2CD2 A;  4LAE X;  3GHW A;  3FQ0 A;  3JWC A;  5U27 A;  3GHC A;  4ECK A;  1DIS A;  3ZPC A;  4LEK X;  1DRF A;  4KY8 A;  4M6K A;  3GYF A;  3EIG A;  1RA2 A;  1S3V A;  3JWF A;  3NXY A;  4DPH A;  1DR4 A;  3K47 A;  2ANO A;  3FL8 A;  3ROA A;  5JA3 A;  3TQA A;  3NXR A;  3FY8 X;  3FYV X;  2G6V A;  3NXV A;  3FQO A;  3SRQ X;  3FQZ A;  2HQP A;  1RA9 A;  4EIG A;  2BLC A;  1BZF A;  2W3A A;  4XT7 A;  4Q0D A;  3IRN A;  3SRU X;  3NU0 A;  3FRB X;  5HPB A;  3QL0 A;  4QJZ D;  4EIL A;  2W3V A;  3DAU A;  3OAF A;  5HVB A;  3EEM A;  1DYI A;  1JOL A;  3QLZ A;  3EEK A;  3SGY A;  1JOM A;  3I8A X;  3F0S X;  4H95 A;  4P68 A;  4LAH X;  3QGT A;  4KJJ A;  2OIP A;  4M7U A;  3JWK A;  1DHJ A;  4RGC A;  5HT5 A;  4G8Z X;  6DFR A;  3EX8 A;  3NXO A;  4XEC X;  2QK8 A;  2AZN A;  5ECC A;  3JW5 A;  1DIU A;  3DFR A;  4HOE A;  2W3B A;  3HJ3 A;  4P3R A;  4KBN A;  4M6L A;  3SRR X;  5HQZ A;  3OCH A;  1U71 A;  1PD8 A;  5DFR A;  3JTW A;  4FGH A;  1HFR A;  2P4G A;  1PD9 A;  1KLK A;  2W3W A;  4XRB A;  2W3M A;  3TD8 A;  4DP3 A;  1DRH A;  3IX9 A;  3FYW X;  3FY9 X;  1DG8 A;  4LAG X;  3KJR A;  2BLB A;  2XW7 A;  3FQV A;  1RH3 A;  3UM6 A;  4XT5 A;  4KNE A;  5U26 A;  3DRC A;  4QLE A;  1MVT A;  1RC4 A;  1OHK A;  1DRE A;  2BL9 A;  4DFR A;  3GHV A;  2C2S A;  1RX4 A;  3HBB A;  4Q0E A;  2HXV A;  1E26 A;  3F0X X;  1RA1 A;  4FHB A;  4OR7 A;  3E0B A;  3JWM A;  3UM5 A;  2LF1 A;  1RA8 A;  7DFR A;  5FDA A;  2OBC A;  2ZZA A;  3TQ8 A;  2D5N A;  1M7A A;  3S9U A;  1DR5 A;  3FS6 A;  2B3Z A;  1DRA A;  3M09 A;  4M7V A;  1DG5 A;  1SEJ A;  4PTJ A;  3SH2 A;  1DR7 A;  3KGY A;  5HF2 X;  3R33 A;  1J3K A;  1DRB A;  2H2Q A;  3FRD X;  2C2T A;  3M08 A;  3QFX A;  2GD9 A;  1DLS A;  1J3J A;  3K45 A;  2O7P A;  5HVE A;  3RO9 A;  3IA4 A;  1IA4 A;  3IRO A;  2ANQ A;  1PDB A;  3UM8 A;  1ZDR A;  4H98 A;  4I1N A;  1AOE A;  1RE7 A;  4KM0 A;  1MVS A;  4G95 A;  3F0U X;  1OHJ A;  1IA2 A;  1VJ3 A;  3K2H A;  1S3U A;  3CD2 A;  4KAK A;  3QLR A;  1DDR A;  2CIG A;  3Q1H A;  1RD7 A;  2W9S A;  3F0Q X;  4X5F A;  1RB3 A;  5HT4 A;  1RG7 A;  4H97 A;  3IRM A;  2INQ A;  4G3M A;  1RA3 A;  3JW3 A;  1DYJ A;  4KL9 A;  1RB2 A;  8DFR A;  4IXF X;  3NXT A;  3CL9 A;  4Q67 A;  2DHF A;  4KJK A;  3DL6 A;  1KMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...