3FYXA

The structure of ompf porin with a synthetic dibenzo-18-crown-6 as modulator
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
340
structure length
340
Chain Sequence
b'AEIYNKDGNKVDLYGCAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title On the function and structure of synthetically modified porins.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transport protein
total genus 85
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3fyxA00
4AUIA 2XE3A 3PRNA 2XE2A 3A2SX 5DL5A 3JTYA 3HW9A 2FGRA 3VZTX 4GCSA 2Y0KA 5JDPA 2PORA 5FVNA 3T20A 2PRNA 5DL7A 4GCQA 2OMFA 2XG6A 4D65A 3WI5A 7PRNA 4FOZA 2ODJA 2XE5A 3SZDA 2Y0HA 1OPFA 4D5UA 3UPGA 6PRNA 1GFOA 5DL8A 3SZVA 2O4VA 2FGQX 4LSFA 2ZFGA 3POUA 2Y0LA 1GFPA 4FSOA 4KR4A 1HXUA 2XE1A 3NSGA 1GFMA 2ZLDA 4LSEA 3SY7A 3SYBA 1GFQA 4D64A 1BT9A 4FRXA 4JFBA 4KRAA 3VZUX 4FMSA 1H6S1 3K19A 4FSPA 1OSMA 2Y2XA 2J4UP 1GFNA 3HWBA 4RJXA 1PHOA 3SY9A 3PORA 2K4TA 3SYSA 5DL6A 3VY8X 1E54A 3O0EA 5PRNA 3FYXA 1PRNA 3EMNX 4KR8A 2J1NA 3VY9X 1MPFA 3T0SA 4GCPA 3UU2A 1HXTA 3WI4A 4FT6A 3T24A 4BUMX 4FRTA 1BH3A 4LSHA 4C69X 3VZWX 2QTKA 1HXXA 4RJWA 8PRNA 3POXA 3POQA 4LSIA
chains in the Genus database with same CATH superfamily
2KZ7B 5E79O 4AUIA 8PRNA 3LK2B 4PR7A 1MM4A 3DZMA 3LK42 4O49A 2XE3A 5GTHO 5G38A 1QJ9A 3PRNA 1ZHTA 2XE2A 3A2SX 5DL5A 2IWWA 3DA4A 2LFUA 3JTYA 3HW9A 3PGRA 1MM5A 2R4PA 2R89A 5D5DA 1T1LA 4N59A 2FGRA 3VZTX 1ZHWA 2MHLA 4GCSA 2Y0KA 2KXPA 3DWOX 3GP6A 3G7GA 3LK41 3C5OA 5JDPA 1S5LO 2PORA 4AFKA 5FVNA 5T5FA 1P4TA 1T16A 3LK3A 4QQ1A 4O4UA 4AYMC 3T20A 2PRNA 3DWNA 5DL7A 3RBHA 3PGSA 3KZIO 2LHFA 4GCQA 4XNLA 2W81C 3UAQA 4UB6O 2OMFA 2XG6A 4AKMA 3PF1A 4AYNA 4D65A 2F1VA 1IZNB 3PQSA 5G39A 3A0HO 3WI5A 4CTDA 7PRNA 4FOZA 2ODJA 2XE5A 2XMXA 3AA7A 3SZDA 2M06A 2Y0HA 4N74A 4AYEC 2GE4A 1OPFA 4G75A 2F1TA 2IWVA 3JCUO 4E1TA 4PUXA 2KXPB 4D5UA 4AYID 3UPGA 2R4NA 3AA6B 4C00A 6PRNA 1GFOA 4O3YA 4FZLA 5DL8A 3AA6A 2O4VA 5G26A 3SZVA 5GV0A 2FGQX 4K3CA 4LSFA 4GHBA 2ZFGA 3LK3B 4IL6O 2AXTO 4G76A 3AAAA 3KVDD 3POUA 4FESA 4K3BA 3BS0A 5G3AA 2X9KA 4FZNA 2Y0LA 1GFPA 5TISO 3VE1A 4FSOA 4N75A 2Y7SA 4KR4A 1HXUA 4N58A 2XE1A 3NSGA 4C4VA 5KAIO 4GF4A 1GFMA 2ZLDA 4LSEA 4O3XB 3SY7A 5IYUA 3SYBA 2YPVA 3AA7B 5B5EO 1GFQA 4D64A 1BT9A 4FRXA 2ERVA 4UB8O 4FUVA 1BXWA 4JFBA 2WJRA 2R88A 4KRAA 4AKRB 1G90A 3TZGA 2XTQA 3VZUX 3QRCA 4FMSA 1H6S1 3A0BO 3K19A 4FSPA 4AKRA 1OSMA 4JCHA 2Y2XA 5B66O 2J4UP 4Z3TA 1Q9FA 2JQYA 1GFNA 4FQEA 1ZHXA 3HWBA 4O3WA 4RJXA 3AA1A 3AAAB 2WVPA 3HOLA 1PHOA 2R4LA 3BRZA 3QRAA 3SY9A 3PORA 4RLCA 2K4TA 2R4OA 3AA0A 4RL9A 4RLBA 3SYSA 5DL6A 3VY8X 3V8UA 4C4VB 3PGUA 4PJ0O 3HOEA 5EE2A 5GTIO 1E54A 3AAEA 1ZHZA 3O0EA 2N2MA 2YNKA 5PRNA 4O3ZA 2KZ7A 4O4XA 1ZHYA 3FYXA 3LK2A 3PQUA 4AYDC 5KAFO 5H2FO 2M07A 2WJQA 3WU2O 1THQA 5ADXL 2W80C 1PRNA 1QJPA 2R8AA 1YS5A 3EMNX 5ADXK 1QJ8A 2KC0A 4KR8A 2JMMA 4XNKA 2J1NA 4F4BA 3VY9X 1MPFA 3T0SA 2KDYA 2X27X 4GCPA 3UU2A 4U9CA 3VE2A 1HXTA 3AA1B 2N2LA 1Q9GA 5AFUL 2MNHA 5AFUK 2F1CX 3WI4A 4FT6A 3DA3A 3T24A 3AA0B 3NJTA 4FRTA 1BH3A 2XTRA 4LSHA 4BUMX 4C69X 4E1SA 4FZMA 4AZLA 3BRYA 2K0LA 3VZWX 1ORMA 1HXXA 2QTKA 3AAEB 4RJWA 3POXA 4B61A 3POQA 4LSIA 1IZNA
chains in the Genus database with same CATH topology
2KZ7B 4AUIA 8PRNA 3LK2B 1MM4A 3LK42 4O49A 2XE3A 1QJ9A 3PRNA 1ZHTA 2XE2A 3A2SX 5DL5A 3DA4A 2LFUA 3JTYA 3HW9A 1MM5A 5D5DA 4N59A 2FGRA 3VZTX 1ZHWA 2MHLA 4GCSA 2Y0KA 2KXPA 3GP6A 3G7GA 3LK41 3C5OA 5JDPA 2PORA 4AFKA 5FVNA 5T5FA 1P4TA 3LK3A 4QQ1A 4O4UA 4AYMC 3T20A 2PRNA 5DL7A 3RBHA 2LHFA 4GCQA 4XNLA 2W81C 3UAQA 2OMFA 2XG6A 4AKMA 4AYNA 4D65A 2F1VA 1IZNB 3PQSA 3WI5A 7PRNA 4FOZA 2ODJA 2XE5A 2XMXA 3AA7A 3SZDA 2M06A 2Y0HA 4AYEC 2GE4A 1OPFA 4G75A 2F1TA 4E1TA 4PUXA 2KXPB 4D5UA 4AYID 3UPGA 3AA6B 6PRNA 1GFOA 4O3YA 4FZLA 5DL8A 3AA6A 2O4VA 5G26A 3SZVA 5GV0A 2FGQX 4LSFA 4GHBA 2ZFGA 3LK3B 4Z3TA 4G76A 3AAAA 3KVDD 3POUA 4FESA 4FZNA 2Y0LA 1GFPA 3VE1A 4FSOA 2Y7SA 4KR4A 1HXUA 4N58A 2XE1A 3NSGA 4GF4A 1GFMA 2ZLDA 4LSEA 4O3XB 3SY7A 5IYUA 3SYBA 2YPVA 3AA7B 1GFQA 4D64A 1BT9A 4FRXA 2ERVA 4FUVA 1BXWA 4JFBA 4KRAA 4AKRB 1G90A 3TZGA 2XTQA 3VZUX 3QRCA 4FMSA 1H6S1 3K19A 4AKRA 4FSPA 1OSMA 4JCHA 2Y2XA 2J4UP 1Q9FA 1GFNA 1ZHXA 3HWBA 4O3WA 4RJXA 3AA1A 3AAAB 3HOLA 1PHOA 3SY9A 3QRAA 3PORA 4RLCA 2K4TA 3AA0A 4RL9A 4RLBA 3SYSA 5DL6A 3VY8X 3V8UA 3HOEA 5EE2A 1E54A 3AAEA 1ZHZA 3O0EA 2N2MA 2YNKA 5PRNA 4O3ZA 2KZ7A 4O4XA 1ZHYA 3FYXA 3LK2A 3PQUA 4AYDC 2M07A 5ADXL 1THQA 2W80C 1PRNA 1QJPA 3EMNX 1YS5A 5ADXK 1QJ8A 2KC0A 4KR8A 2JMMA 4XNKA 2J1NA 4F4BA 3VY9X 1MPFA 3T0SA 2KDYA 2X27X 4GCPA 3UU2A 4U9CA 3VE2A 1HXTA 3AA1B 2N2LA 1Q9GA 5AFUL 2MNHA 5AFUK 3WI4A 4FT6A 3DA3A 3T24A 3AA0B 4BUMX 4FRTA 1BH3A 2XTRA 4LSHA 4C69X 4E1SA 4FZMA 4AZLA 2K0LA 3VZWX 1ORMA 1HXXA 2QTKA 3AAEB 4RJWA 3POXA 4B61A 3POQA 4LSIA 1IZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AUI A;  2XE3 A;  3PRN A;  2XE2 A;  3A2S X;  5DL5 A;  3JTY A;  3HW9 A;  2FGR A;  3VZT X;  4GCS A;  2Y0K A;  5JDP A;  2POR A;  5FVN A;  3T20 A;  2PRN A;  5DL7 A;  4GCQ A;  2OMF A;  2XG6 A;  4D65 A;  3WI5 A;  7PRN A;  4FOZ A;  2ODJ A;  2XE5 A;  3SZD A;  2Y0H A;  1OPF A;  4D5U A;  3UPG A;  6PRN A;  1GFO A;  5DL8 A;  3SZV A;  2O4V A;  2FGQ X;  4LSF A;  2ZFG A;  3POU A;  2Y0L A;  1GFP A;  4FSO A;  4KR4 A;  1HXU A;  2XE1 A;  3NSG A;  1GFM A;  2ZLD A;  4LSE A;  3SY7 A;  3SYB A;  1GFQ A;  4D64 A;  1BT9 A;  4FRX A;  4JFB A;  4KRA A;  3VZU X;  4FMS A;  1H6S 1;  3K19 A;  4FSP A;  1OSM A;  2Y2X A;  2J4U P;  1GFN A;  3HWB A;  4RJX A;  1PHO A;  3SY9 A;  3POR A;  2K4T A;  3SYS A;  5DL6 A;  3VY8 X;  1E54 A;  3O0E A;  5PRN A;  3FYX A;  1PRN A;  3EMN X;  4KR8 A;  2J1N A;  3VY9 X;  1MPF A;  3T0S A;  4GCP A;  3UU2 A;  1HXT A;  3WI4 A;  4FT6 A;  3T24 A;  4BUM X;  4FRT A;  1BH3 A;  4LSH A;  4C69 X;  3VZW X;  2QTK A;  1HXX A;  4RJW A;  8PRN A;  3POX A;  3POQ A;  4LSI A; 
#chains in the Genus database with same CATH topology
 2KZ7 B;  5E79 O;  4AUI A;  8PRN A;  3LK2 B;  4PR7 A;  1MM4 A;  3DZM A;  3LK4 2;  4O49 A;  2XE3 A;  5GTH O;  5G38 A;  1QJ9 A;  3PRN A;  1ZHT A;  2XE2 A;  3A2S X;  5DL5 A;  2IWW A;  3DA4 A;  2LFU A;  3JTY A;  3HW9 A;  3PGR A;  1MM5 A;  2R4P A;  2R89 A;  5D5D A;  1T1L A;  4N59 A;  2FGR A;  3VZT X;  1ZHW A;  2MHL A;  4GCS A;  2Y0K A;  2KXP A;  3DWO X;  3GP6 A;  3G7G A;  3LK4 1;  3C5O A;  5JDP A;  1S5L O;  2POR A;  4AFK A;  5FVN A;  5T5F A;  1P4T A;  1T16 A;  3LK3 A;  4QQ1 A;  4O4U A;  4AYM C;  3T20 A;  2PRN A;  3DWN A;  5DL7 A;  3RBH A;  3PGS A;  3KZI O;  2LHF A;  4GCQ A;  4XNL A;  2W81 C;  3UAQ A;  4UB6 O;  2OMF A;  2XG6 A;  4AKM A;  3PF1 A;  4AYN A;  4D65 A;  2F1V A;  1IZN B;  3PQS A;  5G39 A;  3A0H O;  3WI5 A;  4CTD A;  7PRN A;  4FOZ A;  2ODJ A;  2XE5 A;  2XMX A;  3AA7 A;  3SZD A;  2M06 A;  2Y0H A;  4N74 A;  4AYE C;  2GE4 A;  1OPF A;  4G75 A;  2F1T A;  2IWV A;  3JCU O;  4E1T A;  4PUX A;  2KXP B;  4D5U A;  4AYI D;  3UPG A;  2R4N A;  3AA6 B;  4C00 A;  6PRN A;  1GFO A;  4O3Y A;  4FZL A;  5DL8 A;  3AA6 A;  2O4V A;  5G26 A;  3SZV A;  5GV0 A;  2FGQ X;  4K3C A;  4LSF A;  4GHB A;  2ZFG A;  3LK3 B;  4IL6 O;  2AXT O;  4G76 A;  3AAA A;  3KVD D;  3POU A;  4FES A;  4K3B A;  3BS0 A;  5G3A A;  2X9K A;  4FZN A;  2Y0L A;  1GFP A;  5TIS O;  3VE1 A;  4FSO A;  4N75 A;  2Y7S A;  4KR4 A;  1HXU A;  4N58 A;  2XE1 A;  3NSG A;  4C4V A;  5KAI O;  4GF4 A;  1GFM A;  2ZLD A;  4LSE A;  4O3X B;  3SY7 A;  5IYU A;  3SYB A;  2YPV A;  3AA7 B;  5B5E O;  1GFQ A;  4D64 A;  1BT9 A;  4FRX A;  2ERV A;  4UB8 O;  4FUV A;  1BXW A;  4JFB A;  2WJR A;  2R88 A;  4KRA A;  4AKR B;  1G90 A;  3TZG A;  2XTQ A;  3VZU X;  3QRC A;  4FMS A;  1H6S 1;  3A0B O;  3K19 A;  4FSP A;  4AKR A;  1OSM A;  4JCH A;  2Y2X A;  5B66 O;  2J4U P;  4Z3T A;  1Q9F A;  2JQY A;  1GFN A;  4FQE A;  1ZHX A;  3HWB A;  4O3W A;  4RJX A;  3AA1 A;  3AAA B;  2WVP A;  3HOL A;  1PHO A;  2R4L A;  3BRZ A;  3QRA A;  3SY9 A;  3POR A;  4RLC A;  2K4T A;  2R4O A;  3AA0 A;  4RL9 A;  4RLB A;  3SYS A;  5DL6 A;  3VY8 X;  3V8U A;  4C4V B;  3PGU A;  4PJ0 O;  3HOE A;  5EE2 A;  5GTI O;  1E54 A;  3AAE A;  1ZHZ A;  3O0E A;  2N2M A;  2YNK A;  5PRN A;  4O3Z A;  2KZ7 A;  4O4X A;  1ZHY A;  3FYX A;  3LK2 A;  3PQU A;  4AYD C;  5KAF O;  5H2F O;  2M07 A;  2WJQ A;  3WU2 O;  1THQ A;  5ADX L;  2W80 C;  1PRN A;  1QJP A;  2R8A A;  1YS5 A;  3EMN X;  5ADX K;  1QJ8 A;  2KC0 A;  4KR8 A;  2JMM A;  4XNK A;  2J1N A;  4F4B A;  3VY9 X;  1MPF A;  3T0S A;  2KDY A;  2X27 X;  4GCP A;  3UU2 A;  4U9C A;  3VE2 A;  1HXT A;  3AA1 B;  2N2L A;  1Q9G A;  5AFU L;  2MNH A;  5AFU K;  2F1C X;  3WI4 A;  4FT6 A;  3DA3 A;  3T24 A;  3AA0 B;  3NJT A;  4FRT A;  1BH3 A;  2XTR A;  4LSH A;  4BUM X;  4C69 X;  4E1S A;  4FZM A;  4AZL A;  3BRY A;  2K0L A;  3VZW X;  1ORM A;  1HXX A;  2QTK A;  3AAE B;  4RJW A;  3POX A;  4B61 A;  3POQ A;  4LSI A;  1IZN A; 
#chains in the Genus database with same CATH homology
 2KZ7 B;  4AUI A;  8PRN A;  3LK2 B;  1MM4 A;  3LK4 2;  4O49 A;  2XE3 A;  1QJ9 A;  3PRN A;  1ZHT A;  2XE2 A;  3A2S X;  5DL5 A;  3DA4 A;  2LFU A;  3JTY A;  3HW9 A;  1MM5 A;  5D5D A;  4N59 A;  2FGR A;  3VZT X;  1ZHW A;  2MHL A;  4GCS A;  2Y0K A;  2KXP A;  3GP6 A;  3G7G A;  3LK4 1;  3C5O A;  5JDP A;  2POR A;  4AFK A;  5FVN A;  5T5F A;  1P4T A;  3LK3 A;  4QQ1 A;  4O4U A;  4AYM C;  3T20 A;  2PRN A;  5DL7 A;  3RBH A;  2LHF A;  4GCQ A;  4XNL A;  2W81 C;  3UAQ A;  2OMF A;  2XG6 A;  4AKM A;  4AYN A;  4D65 A;  2F1V A;  1IZN B;  3PQS A;  3WI5 A;  7PRN A;  4FOZ A;  2ODJ A;  2XE5 A;  2XMX A;  3AA7 A;  3SZD A;  2M06 A;  2Y0H A;  4AYE C;  2GE4 A;  1OPF A;  4G75 A;  2F1T A;  4E1T A;  4PUX A;  2KXP B;  4D5U A;  4AYI D;  3UPG A;  3AA6 B;  6PRN A;  1GFO A;  4O3Y A;  4FZL A;  5DL8 A;  3AA6 A;  2O4V A;  5G26 A;  3SZV A;  5GV0 A;  2FGQ X;  4LSF A;  4GHB A;  2ZFG A;  3LK3 B;  4Z3T A;  4G76 A;  3AAA A;  3KVD D;  3POU A;  4FES A;  4FZN A;  2Y0L A;  1GFP A;  3VE1 A;  4FSO A;  2Y7S A;  4KR4 A;  1HXU A;  4N58 A;  2XE1 A;  3NSG A;  4GF4 A;  1GFM A;  2ZLD A;  4LSE A;  4O3X B;  3SY7 A;  5IYU A;  3SYB A;  2YPV A;  3AA7 B;  1GFQ A;  4D64 A;  1BT9 A;  4FRX A;  2ERV A;  4FUV A;  1BXW A;  4JFB A;  4KRA A;  4AKR B;  1G90 A;  3TZG A;  2XTQ A;  3VZU X;  3QRC A;  4FMS A;  1H6S 1;  3K19 A;  4AKR A;  4FSP A;  1OSM A;  4JCH A;  2Y2X A;  2J4U P;  1Q9F A;  1GFN A;  1ZHX A;  3HWB A;  4O3W A;  4RJX A;  3AA1 A;  3AAA B;  3HOL A;  1PHO A;  3SY9 A;  3QRA A;  3POR A;  4RLC A;  2K4T A;  3AA0 A;  4RL9 A;  4RLB A;  3SYS A;  5DL6 A;  3VY8 X;  3V8U A;  3HOE A;  5EE2 A;  1E54 A;  3AAE A;  1ZHZ A;  3O0E A;  2N2M A;  2YNK A;  5PRN A;  4O3Z A;  2KZ7 A;  4O4X A;  1ZHY A;  3FYX A;  3LK2 A;  3PQU A;  4AYD C;  2M07 A;  5ADX L;  1THQ A;  2W80 C;  1PRN A;  1QJP A;  3EMN X;  1YS5 A;  5ADX K;  1QJ8 A;  2KC0 A;  4KR8 A;  2JMM A;  4XNK A;  2J1N A;  4F4B A;  3VY9 X;  1MPF A;  3T0S A;  2KDY A;  2X27 X;  4GCP A;  3UU2 A;  4U9C A;  3VE2 A;  1HXT A;  3AA1 B;  2N2L A;  1Q9G A;  5AFU L;  2MNH A;  5AFU K;  3WI4 A;  4FT6 A;  3DA3 A;  3T24 A;  3AA0 B;  4BUM X;  4FRT A;  1BH3 A;  2XTR A;  4LSH A;  4C69 X;  4E1S A;  4FZM A;  4AZL A;  2K0L A;  3VZW X;  1ORM A;  1HXX A;  2QTK A;  3AAE B;  4RJW A;  3POX A;  4B61 A;  3POQ A;  4LSI A;  1IZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...