3FYXA

The structure of ompf porin with a synthetic dibenzo-18-crown-6 as modulator
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGCAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the function and structure of synthetically modified porins.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transport protein
molecule keywords Outer membrane protein F
total genus 85
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3fyxA00
3EMNX 4GCSA 5FVNA 3UPGA 1GFOA 4LSEA 1PRNA 2OMFA 4JFBA 2ZFGA 3SY7A 4AUIA 3VZUX 1GFPA 4FSOA 4FRXA 3POUA 1HXTA 3POQA 1H6S1 4C69X 2XE2A 2J4UP 2K4TA 3T20A 2ODJA 5DL6A 3POXA 3A2SX 7PRNA 6PRNA 3UU2A 1BH3A 4FT6A 8PRNA 1HXXA 2XE1A 1HXUA 3PRNA 3K19A 2Y0LA 4RJXA 5JDPA 3WI5A 3T24A 4LSFA 3JTYA 2O4VA 3WI4A 4GCPA 4KR8A 2ZLDA 1GFQA 1BT9A 1MPFA 1OSMA 1E54A 4LSHA 2XE3A 3VZWX 3SZVA 3VZTX 3VY8X 4KR4A 4D64A 2Y2XA 4D5UA 4BUMX 3SYSA 4FOZA 4D65A 4RJWA 4LSIA 2J1NA 3SYBA 2XE5A 2PRNA 5PRNA 3SY9A 3SZDA 3T0SA 2Y0KA 5DL8A 3FYXA 4FMSA 5DL7A 4KRAA 3HW9A 2XG6A 1GFMA 4GCQA 2PORA 3VY9X 3NSGA 3PORA 4FSPA 1OPFA 3O0EA 2QTKA 2FGQX 1GFNA 3HWBA 4FRTA 2Y0HA 2FGRA 5DL5A 1PHOA
chains in the Genus database with same CATH superfamily
4C4VB 3EMNX 4GCSA 5D5DA 2X27X 5G3AA 2GE4A 5FVNA 3UPGA 3VE1A 1GFOA 4LSEA 1PRNA 4XNLA 1G90A 2K0LA 2OMFA 2YNKA 1QJ9A 2ZFGA 4JFBA 3SY7A 4AUIA 3WU2O 1ORMA 2F1VA 3KZIO 4FESA 4XNKA 3VZUX 4FZNA 5ADXK 1GFPA 2JMMA 4FSOA 4FRXA 4GF4A 3POUA 4N59A 3TZGA 3JCUO 3LK2B 3C5OA 4AZLA 2Y7SA 1HXTA 1P4TA 3POQA 1H6S1 3PQSA 4C69X 2R4LA 3AA0A 3DWNA 4PUXA 2XE2A 3VE2A 4AKRB 4O3XB 2J4UP 4B61A 2K4TA 3LK3A 2AXTO 3DA4A 3G7GA 3T20A 2ODJA 2KXPB 2KZ7B 5DL6A 3POXA 3AAAA 4IL6O 3UAQA 3A2SX 2R4NA 2MHLA 7PRNA 6PRNA 4GHBA 3UU2A 1BH3A 3AA7A 3AA6A 2IWWA 4FT6A 1T16A 3KVDD 4PR7A 8PRNA 4FQEA 2IWVA 3DZMA 2WJRA 4AYEC 2JQYA 1HXXA 4O4UA 2XE1A 1HXUA 3A0HO 3PRNA 3K19A 3GP6A 2Y0LA 3AA1B 3LK42 4RJXA 5JDPA 4JCHA 2R4PA 2XTQA 4K3BA 3QRAA 3WI5A 4E1TA 5AFUK 4N74A 2LFUA 5GTHO 2X9KA 3T24A 4LSFA 3PGUA 1ZHYA 2R89A 1QJ8A 2O4VA 3JTYA 3LK41 4GCPA 4KR8A 4UB6O 3AAEA 2ZLDA 1Q9FA 4PJ0O 4AYMC 5GV0A 5ADXL 2LHFA 1GFQA 1IZNA 4E1SA 4Z3TA 2N2LA 5GTIO 1BT9A 4C4VA 1S5LO 1MPFA 1QJPA 3PGRA 4N58A 4AKMA 1OSMA 1E54A 3HOLA 4LSHA 2XE3A 3VZWX 5G38A 2F1CX 3SZVA 3VZTX 1YS5A 2F1TA 5IYUA 5T5FA 1ZHTA 3VY8X 4KR4A 3V8UA 1ZHXA 4AYDC 2Y2XA 4D64A 4D5UA 1MM4A 4BUMX 3SYSA 4FOZA 4D65A 3LK2A 4RJWA 4F4BA 1MM5A 2MNHA 2YPVA 3DA3A 4FUVA 4LSIA 4U9CA 4G76A 2J1NA 3AA0B 3SYBA 4AKRA 2ERVA 1THQA 2XE5A 2PRNA 5AFUL 2W80C 2WJQA 3LK3B 4UB8O 5PRNA 3SY9A 3SZDA 3T0SA 5TISO 1ZHWA 3WI4A 2KC0A 2M06A 4G75A 4RLCA 3PF1A 2Y0KA 2KXPA 4AYNA 2KZ7A 3BRZA 4O3WA 2WVPA 5DL8A 4N75A 3AAAB 3DWOX 5B5EO 2KDYA 3FYXA 4FMSA 3PGSA 4KRAA 5DL7A 2XTRA 3HW9A 2XG6A 5E79O 1GFMA 3NJTA 2R88A 4GCQA 5G26A 2PORA 4RLBA 3VY9X 3AA7B 3AA6B 5G39A 2R4OA 3NSGA 4FZMA 4RL9A 5B66O 5H2FO 1ZHZA 3PORA 2R8AA 2XMXA 4QQ1A 3RBHA 3QRCA 4FSPA 3PQUA 2M07A 4AFKA 4O3YA 3HOEA 5KAIO 1OPFA 1Q9GA 1BXWA 3AA1A 2QTKA 2FGQX 3O0EA 4O3ZA 1GFNA 3HWBA 3BS0A 1T1LA 4FRTA 2Y0HA 3BRYA 4CTDA 2W81C 5EE2A 2FGRA 3A0BO 3AAEB 5DL5A 5KAFO 4FZLA 4C00A 1PHOA 4O4XA 1IZNB 4K3CA 2N2MA 4AYID 4O49A
chains in the Genus database with same CATH topology
3EMNX 4GCSA 5D5DA 2X27X 2GE4A 5FVNA 3UPGA 3VE1A 1GFOA 4LSEA 1PRNA 4XNLA 1G90A 2K0LA 2OMFA 2YNKA 1QJ9A 2ZFGA 4JFBA 3SY7A 4AUIA 1ORMA 2F1VA 4FESA 4XNKA 3VZUX 4FZNA 5ADXK 1GFPA 2JMMA 4FSOA 4FRXA 4GF4A 3POUA 3TZGA 3LK2B 3C5OA 4AZLA 2Y7SA 1HXTA 1P4TA 3POQA 1H6S1 3PQSA 4C69X 3AA0A 4PUXA 2XE2A 3VE2A 4AKRB 4O3XB 2J4UP 4B61A 2K4TA 3LK3A 3DA4A 3G7GA 3T20A 2ODJA 2KXPB 2KZ7B 5DL6A 3POXA 3AAAA 3UAQA 3A2SX 2MHLA 7PRNA 6PRNA 4GHBA 3UU2A 1BH3A 3AA7A 3AA6A 4FT6A 3KVDD 8PRNA 4AYEC 1HXXA 4O4UA 2XE1A 1HXUA 3PRNA 3K19A 3GP6A 2Y0LA 3AA1B 3LK42 4RJXA 5JDPA 4JCHA 2XTQA 3WI5A 3QRAA 4E1TA 5AFUK 2LFUA 3T24A 4LSFA 1ZHYA 3JTYA 1QJ8A 2O4VA 3LK41 4GCPA 4KR8A 3WI4A 4AYMC 3AAEA 2ZLDA 1Q9FA 5GV0A 5ADXL 2LHFA 1GFQA 1IZNA 4E1SA 4Z3TA 2N2LA 1BT9A 1MPFA 1QJPA 4N58A 4AKMA 1OSMA 1E54A 3HOLA 4LSHA 2XE3A 3VZWX 3SZVA 3VZTX 1YS5A 2F1TA 5IYUA 5T5FA 1ZHTA 3VY8X 4KR4A 3V8UA 1ZHXA 4AYDC 2Y2XA 4D64A 4D5UA 1MM4A 4BUMX 3SYSA 4FOZA 4D65A 3LK2A 4RJWA 4F4BA 1MM5A 2MNHA 2YPVA 3DA3A 4FUVA 4LSIA 4U9CA 4G76A 2J1NA 3AA0B 3SYBA 4AKRA 2ERVA 1THQA 2XE5A 2PRNA 5AFUL 2W80C 3LK3B 5PRNA 3SY9A 3SZDA 3T0SA 1ZHWA 2KC0A 2M06A 4G75A 4RLCA 2Y0KA 2KXPA 4AYNA 2KZ7A 4O3WA 5DL8A 3AAAB 2KDYA 3FYXA 4FMSA 4KRAA 5DL7A 2XTRA 3HW9A 2XG6A 5G26A 1GFMA 4GCQA 2PORA 4RLBA 3VY9X 3AA7B 3AA6B 4RL9A 3NSGA 4FZMA 1ZHZA 3PORA 3RBHA 2XMXA 4QQ1A 3QRCA 4FSPA 3PQUA 2M07A 4AFKA 4O3YA 3HOEA 1OPFA 1Q9GA 1BXWA 3AA1A 2QTKA 2FGQX 3O0EA 4O3ZA 1GFNA 3HWBA 4FRTA 2Y0HA 2W81C 5EE2A 2FGRA 3AAEB 5DL5A 4FZLA 1PHOA 4O4XA 1IZNB 4N59A 2N2MA 4AYID 4O49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMN X;  4GCS A;  5FVN A;  3UPG A;  1GFO A;  4LSE A;  1PRN A;  2OMF A;  4JFB A;  2ZFG A;  3SY7 A;  4AUI A;  3VZU X;  1GFP A;  4FSO A;  4FRX A;  3POU A;  1HXT A;  3POQ A;  1H6S 1;  4C69 X;  2XE2 A;  2J4U P;  2K4T A;  3T20 A;  2ODJ A;  5DL6 A;  3POX A;  3A2S X;  7PRN A;  6PRN A;  3UU2 A;  1BH3 A;  4FT6 A;  8PRN A;  1HXX A;  2XE1 A;  1HXU A;  3PRN A;  3K19 A;  2Y0L A;  4RJX A;  5JDP A;  3WI5 A;  3T24 A;  4LSF A;  3JTY A;  2O4V A;  3WI4 A;  4GCP A;  4KR8 A;  2ZLD A;  1GFQ A;  1BT9 A;  1MPF A;  1OSM A;  1E54 A;  4LSH A;  2XE3 A;  3VZW X;  3SZV A;  3VZT X;  3VY8 X;  4KR4 A;  4D64 A;  2Y2X A;  4D5U A;  4BUM X;  3SYS A;  4FOZ A;  4D65 A;  4RJW A;  4LSI A;  2J1N A;  3SYB A;  2XE5 A;  2PRN A;  5PRN A;  3SY9 A;  3SZD A;  3T0S A;  2Y0K A;  5DL8 A;  3FYX A;  4FMS A;  5DL7 A;  4KRA A;  3HW9 A;  2XG6 A;  1GFM A;  4GCQ A;  2POR A;  3VY9 X;  3NSG A;  3POR A;  4FSP A;  1OPF A;  3O0E A;  2QTK A;  2FGQ X;  1GFN A;  3HWB A;  4FRT A;  2Y0H A;  2FGR A;  5DL5 A;  1PHO A; 
#chains in the Genus database with same CATH topology
 4C4V B;  3EMN X;  4GCS A;  5D5D A;  2X27 X;  5G3A A;  2GE4 A;  5FVN A;  3UPG A;  3VE1 A;  1GFO A;  4LSE A;  1PRN A;  4XNL A;  1G90 A;  2K0L A;  2OMF A;  2YNK A;  1QJ9 A;  2ZFG A;  4JFB A;  3SY7 A;  4AUI A;  3WU2 O;  1ORM A;  2F1V A;  3KZI O;  4FES A;  4XNK A;  3VZU X;  4FZN A;  5ADX K;  1GFP A;  2JMM A;  4FSO A;  4FRX A;  4GF4 A;  3POU A;  4N59 A;  3TZG A;  3JCU O;  3LK2 B;  3C5O A;  4AZL A;  2Y7S A;  1HXT A;  1P4T A;  3POQ A;  1H6S 1;  3PQS A;  4C69 X;  2R4L A;  3AA0 A;  3DWN A;  4PUX A;  2XE2 A;  3VE2 A;  4AKR B;  4O3X B;  2J4U P;  4B61 A;  2K4T A;  3LK3 A;  2AXT O;  3DA4 A;  3G7G A;  3T20 A;  2ODJ A;  2KXP B;  2KZ7 B;  5DL6 A;  3POX A;  3AAA A;  4IL6 O;  3UAQ A;  3A2S X;  2R4N A;  2MHL A;  7PRN A;  6PRN A;  4GHB A;  3UU2 A;  1BH3 A;  3AA7 A;  3AA6 A;  2IWW A;  4FT6 A;  1T16 A;  3KVD D;  4PR7 A;  8PRN A;  4FQE A;  2IWV A;  3DZM A;  2WJR A;  4AYE C;  2JQY A;  1HXX A;  4O4U A;  2XE1 A;  1HXU A;  3A0H O;  3PRN A;  3K19 A;  3GP6 A;  2Y0L A;  3AA1 B;  3LK4 2;  4RJX A;  5JDP A;  4JCH A;  2R4P A;  2XTQ A;  4K3B A;  3QRA A;  3WI5 A;  4E1T A;  5AFU K;  4N74 A;  2LFU A;  5GTH O;  2X9K A;  3T24 A;  4LSF A;  3PGU A;  1ZHY A;  2R89 A;  1QJ8 A;  2O4V A;  3JTY A;  3LK4 1;  4GCP A;  4KR8 A;  4UB6 O;  3AAE A;  2ZLD A;  1Q9F A;  4PJ0 O;  4AYM C;  5GV0 A;  5ADX L;  2LHF A;  1GFQ A;  1IZN A;  4E1S A;  4Z3T A;  2N2L A;  5GTI O;  1BT9 A;  4C4V A;  1S5L O;  1MPF A;  1QJP A;  3PGR A;  4N58 A;  4AKM A;  1OSM A;  1E54 A;  3HOL A;  4LSH A;  2XE3 A;  3VZW X;  5G38 A;  2F1C X;  3SZV A;  3VZT X;  1YS5 A;  2F1T A;  5IYU A;  5T5F A;  1ZHT A;  3VY8 X;  4KR4 A;  3V8U A;  1ZHX A;  4AYD C;  2Y2X A;  4D64 A;  4D5U A;  1MM4 A;  4BUM X;  3SYS A;  4FOZ A;  4D65 A;  3LK2 A;  4RJW A;  4F4B A;  1MM5 A;  2MNH A;  2YPV A;  3DA3 A;  4FUV A;  4LSI A;  4U9C A;  4G76 A;  2J1N A;  3AA0 B;  3SYB A;  4AKR A;  2ERV A;  1THQ A;  2XE5 A;  2PRN A;  5AFU L;  2W80 C;  2WJQ A;  3LK3 B;  4UB8 O;  5PRN A;  3SY9 A;  3SZD A;  3T0S A;  5TIS O;  1ZHW A;  3WI4 A;  2KC0 A;  2M06 A;  4G75 A;  4RLC A;  3PF1 A;  2Y0K A;  2KXP A;  4AYN A;  2KZ7 A;  3BRZ A;  4O3W A;  2WVP A;  5DL8 A;  4N75 A;  3AAA B;  3DWO X;  5B5E O;  2KDY A;  3FYX A;  4FMS A;  3PGS A;  4KRA A;  5DL7 A;  2XTR A;  3HW9 A;  2XG6 A;  5E79 O;  1GFM A;  3NJT A;  2R88 A;  4GCQ A;  5G26 A;  2POR A;  4RLB A;  3VY9 X;  3AA7 B;  3AA6 B;  5G39 A;  2R4O A;  3NSG A;  4FZM A;  4RL9 A;  5B66 O;  5H2F O;  1ZHZ A;  3POR A;  2R8A A;  2XMX A;  4QQ1 A;  3RBH A;  3QRC A;  4FSP A;  3PQU A;  2M07 A;  4AFK A;  4O3Y A;  3HOE A;  5KAI O;  1OPF A;  1Q9G A;  1BXW A;  3AA1 A;  2QTK A;  2FGQ X;  3O0E A;  4O3Z A;  1GFN A;  3HWB A;  3BS0 A;  1T1L A;  4FRT A;  2Y0H A;  3BRY A;  4CTD A;  2W81 C;  5EE2 A;  2FGR A;  3A0B O;  3AAE B;  5DL5 A;  5KAF O;  4FZL A;  4C00 A;  1PHO A;  4O4X A;  1IZN B;  4K3C A;  2N2M A;  4AYI D;  4O49 A; 
#chains in the Genus database with same CATH homology
 3EMN X;  4GCS A;  5D5D A;  2X27 X;  2GE4 A;  5FVN A;  3UPG A;  3VE1 A;  1GFO A;  4LSE A;  1PRN A;  4XNL A;  1G90 A;  2K0L A;  2OMF A;  2YNK A;  1QJ9 A;  2ZFG A;  4JFB A;  3SY7 A;  4AUI A;  1ORM A;  2F1V A;  4FES A;  4XNK A;  3VZU X;  4FZN A;  5ADX K;  1GFP A;  2JMM A;  4FSO A;  4FRX A;  4GF4 A;  3POU A;  3TZG A;  3LK2 B;  3C5O A;  4AZL A;  2Y7S A;  1HXT A;  1P4T A;  3POQ A;  1H6S 1;  3PQS A;  4C69 X;  3AA0 A;  4PUX A;  2XE2 A;  3VE2 A;  4AKR B;  4O3X B;  2J4U P;  4B61 A;  2K4T A;  3LK3 A;  3DA4 A;  3G7G A;  3T20 A;  2ODJ A;  2KXP B;  2KZ7 B;  5DL6 A;  3POX A;  3AAA A;  3UAQ A;  3A2S X;  2MHL A;  7PRN A;  6PRN A;  4GHB A;  3UU2 A;  1BH3 A;  3AA7 A;  3AA6 A;  4FT6 A;  3KVD D;  8PRN A;  4AYE C;  1HXX A;  4O4U A;  2XE1 A;  1HXU A;  3PRN A;  3K19 A;  3GP6 A;  2Y0L A;  3AA1 B;  3LK4 2;  4RJX A;  5JDP A;  4JCH A;  2XTQ A;  3WI5 A;  3QRA A;  4E1T A;  5AFU K;  2LFU A;  3T24 A;  4LSF A;  1ZHY A;  3JTY A;  1QJ8 A;  2O4V A;  3LK4 1;  4GCP A;  4KR8 A;  3WI4 A;  4AYM C;  3AAE A;  2ZLD A;  1Q9F A;  5GV0 A;  5ADX L;  2LHF A;  1GFQ A;  1IZN A;  4E1S A;  4Z3T A;  2N2L A;  1BT9 A;  1MPF A;  1QJP A;  4N58 A;  4AKM A;  1OSM A;  1E54 A;  3HOL A;  4LSH A;  2XE3 A;  3VZW X;  3SZV A;  3VZT X;  1YS5 A;  2F1T A;  5IYU A;  5T5F A;  1ZHT A;  3VY8 X;  4KR4 A;  3V8U A;  1ZHX A;  4AYD C;  2Y2X A;  4D64 A;  4D5U A;  1MM4 A;  4BUM X;  3SYS A;  4FOZ A;  4D65 A;  3LK2 A;  4RJW A;  4F4B A;  1MM5 A;  2MNH A;  2YPV A;  3DA3 A;  4FUV A;  4LSI A;  4U9C A;  4G76 A;  2J1N A;  3AA0 B;  3SYB A;  4AKR A;  2ERV A;  1THQ A;  2XE5 A;  2PRN A;  5AFU L;  2W80 C;  3LK3 B;  5PRN A;  3SY9 A;  3SZD A;  3T0S A;  1ZHW A;  2KC0 A;  2M06 A;  4G75 A;  4RLC A;  2Y0K A;  2KXP A;  4AYN A;  2KZ7 A;  4O3W A;  5DL8 A;  3AAA B;  2KDY A;  3FYX A;  4FMS A;  4KRA A;  5DL7 A;  2XTR A;  3HW9 A;  2XG6 A;  5G26 A;  1GFM A;  4GCQ A;  2POR A;  4RLB A;  3VY9 X;  3AA7 B;  3AA6 B;  4RL9 A;  3NSG A;  4FZM A;  1ZHZ A;  3POR A;  3RBH A;  2XMX A;  4QQ1 A;  3QRC A;  4FSP A;  3PQU A;  2M07 A;  4AFK A;  4O3Y A;  3HOE A;  1OPF A;  1Q9G A;  1BXW A;  3AA1 A;  2QTK A;  2FGQ X;  3O0E A;  4O3Z A;  1GFN A;  3HWB A;  4FRT A;  2Y0H A;  2W81 C;  5EE2 A;  2FGR A;  3AAE B;  5DL5 A;  4FZL A;  1PHO A;  4O4X A;  1IZN B;  4N59 A;  2N2M A;  4AYI D;  4O49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...