3FYXA

The structure of ompf porin with a synthetic dibenzo-18-crown-6 as modulator
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGCAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the function and structure of synthetically modified porins.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transport protein
molecule keywords Outer membrane protein F
total genus 85
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3fyxA00
3SYSA 1PRNA 2ODJA 4D65A 4FOZA 8PRNA 3POUA 2J1NA 3WI5A 1GFNA 5JDPA 4FRTA 3SY7A 2ZLDA 4FRXA 3VZWX 3O0EA 1HXTA 1GFPA 1BT9A 1PHOA 3UPGA 2FGRA 5DL7A 7PRNA 2FGQX 2Y2XA 3A2SX 2Y0LA 3VZUX 3HWBA 3T0SA 5PRNA 4D64A 3WI4A 2OMFA 3SZVA 2Y0HA 3K19A 4FT6A 3HW9A 4KRAA 2J4UP 3SZDA 3VZTX 1HXUA 3FYXA 6PRNA 4C69X 4FSPA 2XE2A 3SY9A 1GFQA 2XE5A 2PRNA 2XG6A 2O4VA 2XE1A 3JTYA 3VY9X 3EMNX 4LSFA 3POQA 1OPFA 4AUIA 2Y0KA 4KR8A 2XE3A 4RJWA 3PORA 3NSGA 2K4TA 4FMSA 3UU2A 1HXXA 1OSMA 4FSOA 1MPFA 3T24A 4GCSA 4BUMX 5DL5A 2ZFGA 3SYBA 5DL6A 3T20A 1GFOA 5FVNA 1E54A 2QTKA 4JFBA 4D5UA 3PRNA 2PORA 1H6S1 4LSIA 4GCQA 4KR4A 1GFMA 5DL8A 4LSEA 3POXA 3VY8X 1BH3A 4GCPA 4RJXA 4LSHA
chains in the Genus database with same CATH superfamily
2Y7SA 2WVPA 4F4BA 4UB6O 5GTIO 3SYSA 1PRNA 2N2MA 3AA7A 2ODJA 3KZIO 2R4OA 1THQA 4RLBA 3HOLA 3A0BO 3DA4A 4D65A 3AAAB 4FOZA 4O3ZA 4PJ0O 4O4XA 8PRNA 3POUA 4Z3TA 4O3WA 2J1NA 3WI5A 4CTDA 1GFNA 3G7GA 4B61A 4FRTA 3SY7A 2ZLDA 4C00A 4FRXA 3VZWX 4AKRA 5B66O 3O0EA 1HXTA 1GFPA 4FZLA 4O4UA 1BT9A 1PHOA 2F1CX 2MHLA 4AZLA 3UPGA 2KXPB 4LSHA 5T5FA 2FGRA 5DL7A 4AYEC 7PRNA 3AA0A 4N59A 4QQ1A 5IYUA 1ZHYA 2FGQX 2Y2XA 3AAEA 5KAIO 3A2SX 2Y0LA 2XTRA 5D5DA 2YNKA 5G26A 3VZUX 4RLCA 2MNHA 4K3CA 2LFUA 3VE1A 5AFUL 3HWBA 3T0SA 1BXWA 5PRNA 3AA6A 4D64A 4E1SA 2R88A 2OMFA 3C5OA 3V8UA 3WI4A 4FZMA 4O3XB 4UB8O 5JDPA 2K0LA 5ADXK 2KXPA 2R4PA 2LHFA 3SZVA 3TZGA 3PGRA 2Y0HA 4GF4A 4XNKA 2M07A 3K19A 4FT6A 3HW9A 3PGUA 4FUVA 4AYMC 4KRAA 5AFUK 3SZDA 1IZNB 2J4UP 1MM4A 3VZTX 1HXUA 3FYXA 3AA7B 4AFKA 1T1LA 3LK3B 6PRNA 4C69X 3LK3A 3PQSA 3UAQA 2IWVA 2F1VA 1MM5A 2AXTO 1Q9FA 2XE2A 3AA6B 3LK2B 3PF1A 4FSPA 5KAFO 4C4VA 5ADXL 3AA1B 3SY9A 4U9CA 3AA1A 2R8AA 2W81C 1GFQA 2WJQA 2PRNA 2XE5A 3NJTA 4N58A 2XG6A 4O3YA 4N74A 5EE2A 3DWOX 1QJPA 1YS5A 1ZHTA 2JQYA 1QJ8A 2O4VA 4AYDC 3RBHA 1ZHZA 2IWWA 5H2FO 4FQEA 2GE4A 2XE1A 4XNLA 3JTYA 3VY9X 3JCUO 3EMNX 4LSFA 3POQA 5G38A 3AAEB 1OPFA 3BRZA 4AUIA 2Y0KA 4KR8A 5TISO 4FESA 5E79O 2XE3A 5GV0A 3LK42 4RJWA 3PORA 3VE2A 2M06A 5G3AA 1P4TA 3NSGA 2K4TA 2KZ7B 4FZNA 1ORMA 4FMSA 3DWNA 4O49A 3UU2A 2XMXA 3QRCA 1HXXA 2KC0A 3PQUA 1OSMA 3QRAA 4FSOA 1MPFA 2X9KA 4G75A 4AKMA 3T24A 4GCSA 3BS0A 2JMMA 4PR7A 5B5EO 3AA0B 2F1TA 4BUMX 3LK41 5DL5A 2ZFGA 4E1TA 1IZNA 3SYBA 3PGSA 5DL6A 3KVDD 2R89A 3T20A 3GP6A 2YPVA 2WJRA 2X27X 1GFOA 5FVNA 4AYID 1E54A 2QTKA 4GHBA 4AYNA 4JFBA 4G76A 2KZ7A 4D5UA 1G90A 3PRNA 5GTHO 3AAAA 5G39A 4C4VB 4N75A 4RL9A 2PORA 2W80C 1H6S1 4JCHA 1ZHXA 4LSIA 3WU2O 4GCQA 4K3BA 2R4NA 3BRYA 3DA3A 1S5LO 4KR4A 1GFMA 4AKRB 1T16A 1ZHWA 2N2LA 2R4LA 2KDYA 3A0HO 3POXA 4LSEA 4PUXA 2XTQA 5DL8A 3HOEA 3VY8X 1QJ9A 1Q9GA 2ERVA 1BH3A 4GCPA 3DZMA 4IL6O 4RJXA 3LK2A
chains in the Genus database with same CATH topology
2Y7SA 4F4BA 3SYSA 1PRNA 2N2MA 3AA7A 2ODJA 1THQA 4RLBA 3HOLA 3DA4A 4D65A 3AAAB 4FOZA 4O3ZA 4O4XA 8PRNA 3POUA 4Z3TA 4O3WA 2J1NA 3WI5A 1GFNA 3G7GA 4B61A 4FRTA 3SY7A 2ZLDA 5JDPA 4FRXA 3VZWX 4AKRA 3O0EA 1HXTA 1GFPA 4FZLA 4O4UA 1BT9A 1PHOA 2MHLA 4AZLA 3UPGA 2KXPB 4LSHA 5T5FA 2FGRA 5DL7A 4AYEC 7PRNA 3AA0A 4N59A 4QQ1A 5IYUA 1ZHYA 2FGQX 2Y2XA 3AAEA 3A2SX 2Y0LA 2XTRA 5D5DA 2YNKA 5G26A 3VZUX 4RLCA 2MNHA 2LFUA 3VE1A 5AFUL 3HWBA 3T0SA 1BXWA 5PRNA 3AA6A 4D64A 4E1SA 3WI4A 2OMFA 3C5OA 3V8UA 4FZMA 4O3XB 2K0LA 5ADXK 2KXPA 3SZVA 2LHFA 3TZGA 2Y0HA 4GF4A 4XNKA 2M07A 3K19A 4FT6A 3HW9A 4FUVA 4AYMC 4KRAA 5AFUK 3SZDA 1IZNB 2J4UP 1MM4A 3VZTX 1HXUA 3FYXA 3AA7B 4AFKA 3LK3B 6PRNA 4C69X 3LK3A 3PQSA 3UAQA 2F1VA 3LK2B 1MM5A 4FSPA 1Q9FA 2XE2A 3AA6B 5ADXL 3AA1B 3SY9A 4U9CA 3AA1A 2W81C 1GFQA 2XE5A 2PRNA 4N58A 2XG6A 4O3YA 5EE2A 1QJPA 1YS5A 1ZHTA 1QJ8A 2O4VA 4AYDC 3RBHA 1ZHZA 2GE4A 2XE1A 4XNLA 3JTYA 3VY9X 3EMNX 4LSFA 3POQA 3AAEB 1OPFA 4AUIA 2Y0KA 4KR8A 4FESA 2XE3A 5GV0A 3LK42 4RJWA 3PORA 3VE2A 2M06A 1P4TA 3NSGA 2K4TA 2KZ7B 4FZNA 1ORMA 4FMSA 4O49A 3UU2A 2XMXA 3QRCA 1HXXA 2KC0A 3PQUA 1OSMA 3QRAA 4FSOA 1MPFA 4G75A 4AKMA 3T24A 4GCSA 2JMMA 3AA0B 2F1TA 4BUMX 3LK41 5DL5A 2ZFGA 4E1TA 1IZNA 3SYBA 5DL6A 3KVDD 3T20A 3GP6A 2YPVA 4AYID 2X27X 1GFOA 5FVNA 1E54A 2QTKA 4GHBA 4AYNA 4JFBA 4G76A 2KZ7A 4D5UA 1G90A 3PRNA 3AAAA 4RL9A 2PORA 2W80C 1H6S1 4JCHA 1ZHXA 4LSIA 4GCQA 3DA3A 4KR4A 1GFMA 4AKRB 1ZHWA 2N2LA 5DL8A 2KDYA 4LSEA 3POXA 4PUXA 2XTQA 3HOEA 3VY8X 1QJ9A 1Q9GA 2ERVA 1BH3A 4GCPA 4RJXA 3LK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYS A;  1PRN A;  2ODJ A;  4D65 A;  4FOZ A;  8PRN A;  3POU A;  2J1N A;  3WI5 A;  1GFN A;  5JDP A;  4FRT A;  3SY7 A;  2ZLD A;  4FRX A;  3VZW X;  3O0E A;  1HXT A;  1GFP A;  1BT9 A;  1PHO A;  3UPG A;  2FGR A;  5DL7 A;  7PRN A;  2FGQ X;  2Y2X A;  3A2S X;  2Y0L A;  3VZU X;  3HWB A;  3T0S A;  5PRN A;  4D64 A;  3WI4 A;  2OMF A;  3SZV A;  2Y0H A;  3K19 A;  4FT6 A;  3HW9 A;  4KRA A;  2J4U P;  3SZD A;  3VZT X;  1HXU A;  3FYX A;  6PRN A;  4C69 X;  4FSP A;  2XE2 A;  3SY9 A;  1GFQ A;  2XE5 A;  2PRN A;  2XG6 A;  2O4V A;  2XE1 A;  3JTY A;  3VY9 X;  3EMN X;  4LSF A;  3POQ A;  1OPF A;  4AUI A;  2Y0K A;  4KR8 A;  2XE3 A;  4RJW A;  3POR A;  3NSG A;  2K4T A;  4FMS A;  3UU2 A;  1HXX A;  1OSM A;  4FSO A;  1MPF A;  3T24 A;  4GCS A;  4BUM X;  5DL5 A;  2ZFG A;  3SYB A;  5DL6 A;  3T20 A;  1GFO A;  5FVN A;  1E54 A;  2QTK A;  4JFB A;  4D5U A;  3PRN A;  2POR A;  1H6S 1;  4LSI A;  4GCQ A;  4KR4 A;  1GFM A;  5DL8 A;  4LSE A;  3POX A;  3VY8 X;  1BH3 A;  4GCP A;  4RJX A;  4LSH A; 
#chains in the Genus database with same CATH topology
 2Y7S A;  2WVP A;  4F4B A;  4UB6 O;  5GTI O;  3SYS A;  1PRN A;  2N2M A;  3AA7 A;  2ODJ A;  3KZI O;  2R4O A;  1THQ A;  4RLB A;  3HOL A;  3A0B O;  3DA4 A;  4D65 A;  3AAA B;  4FOZ A;  4O3Z A;  4PJ0 O;  4O4X A;  8PRN A;  3POU A;  4Z3T A;  4O3W A;  2J1N A;  3WI5 A;  4CTD A;  1GFN A;  3G7G A;  4B61 A;  4FRT A;  3SY7 A;  2ZLD A;  4C00 A;  4FRX A;  3VZW X;  4AKR A;  5B66 O;  3O0E A;  1HXT A;  1GFP A;  4FZL A;  4O4U A;  1BT9 A;  1PHO A;  2F1C X;  2MHL A;  4AZL A;  3UPG A;  2KXP B;  4LSH A;  5T5F A;  2FGR A;  5DL7 A;  4AYE C;  7PRN A;  3AA0 A;  4N59 A;  4QQ1 A;  5IYU A;  1ZHY A;  2FGQ X;  2Y2X A;  3AAE A;  5KAI O;  3A2S X;  2Y0L A;  2XTR A;  5D5D A;  2YNK A;  5G26 A;  3VZU X;  4RLC A;  2MNH A;  4K3C A;  2LFU A;  3VE1 A;  5AFU L;  3HWB A;  3T0S A;  1BXW A;  5PRN A;  3AA6 A;  4D64 A;  4E1S A;  2R88 A;  2OMF A;  3C5O A;  3V8U A;  3WI4 A;  4FZM A;  4O3X B;  4UB8 O;  5JDP A;  2K0L A;  5ADX K;  2KXP A;  2R4P A;  2LHF A;  3SZV A;  3TZG A;  3PGR A;  2Y0H A;  4GF4 A;  4XNK A;  2M07 A;  3K19 A;  4FT6 A;  3HW9 A;  3PGU A;  4FUV A;  4AYM C;  4KRA A;  5AFU K;  3SZD A;  1IZN B;  2J4U P;  1MM4 A;  3VZT X;  1HXU A;  3FYX A;  3AA7 B;  4AFK A;  1T1L A;  3LK3 B;  6PRN A;  4C69 X;  3LK3 A;  3PQS A;  3UAQ A;  2IWV A;  2F1V A;  1MM5 A;  2AXT O;  1Q9F A;  2XE2 A;  3AA6 B;  3LK2 B;  3PF1 A;  4FSP A;  5KAF O;  4C4V A;  5ADX L;  3AA1 B;  3SY9 A;  4U9C A;  3AA1 A;  2R8A A;  2W81 C;  1GFQ A;  2WJQ A;  2PRN A;  2XE5 A;  3NJT A;  4N58 A;  2XG6 A;  4O3Y A;  4N74 A;  5EE2 A;  3DWO X;  1QJP A;  1YS5 A;  1ZHT A;  2JQY A;  1QJ8 A;  2O4V A;  4AYD C;  3RBH A;  1ZHZ A;  2IWW A;  5H2F O;  4FQE A;  2GE4 A;  2XE1 A;  4XNL A;  3JTY A;  3VY9 X;  3JCU O;  3EMN X;  4LSF A;  3POQ A;  5G38 A;  3AAE B;  1OPF A;  3BRZ A;  4AUI A;  2Y0K A;  4KR8 A;  5TIS O;  4FES A;  5E79 O;  2XE3 A;  5GV0 A;  3LK4 2;  4RJW A;  3POR A;  3VE2 A;  2M06 A;  5G3A A;  1P4T A;  3NSG A;  2K4T A;  2KZ7 B;  4FZN A;  1ORM A;  4FMS A;  3DWN A;  4O49 A;  3UU2 A;  2XMX A;  3QRC A;  1HXX A;  2KC0 A;  3PQU A;  1OSM A;  3QRA A;  4FSO A;  1MPF A;  2X9K A;  4G75 A;  4AKM A;  3T24 A;  4GCS A;  3BS0 A;  2JMM A;  4PR7 A;  5B5E O;  3AA0 B;  2F1T A;  4BUM X;  3LK4 1;  5DL5 A;  2ZFG A;  4E1T A;  1IZN A;  3SYB A;  3PGS A;  5DL6 A;  3KVD D;  2R89 A;  3T20 A;  3GP6 A;  2YPV A;  2WJR A;  2X27 X;  1GFO A;  5FVN A;  4AYI D;  1E54 A;  2QTK A;  4GHB A;  4AYN A;  4JFB A;  4G76 A;  2KZ7 A;  4D5U A;  1G90 A;  3PRN A;  5GTH O;  3AAA A;  5G39 A;  4C4V B;  4N75 A;  4RL9 A;  2POR A;  2W80 C;  1H6S 1;  4JCH A;  1ZHX A;  4LSI A;  3WU2 O;  4GCQ A;  4K3B A;  2R4N A;  3BRY A;  3DA3 A;  1S5L O;  4KR4 A;  1GFM A;  4AKR B;  1T16 A;  1ZHW A;  2N2L A;  2R4L A;  2KDY A;  3A0H O;  3POX A;  4LSE A;  4PUX A;  2XTQ A;  5DL8 A;  3HOE A;  3VY8 X;  1QJ9 A;  1Q9G A;  2ERV A;  1BH3 A;  4GCP A;  3DZM A;  4IL6 O;  4RJX A;  3LK2 A; 
#chains in the Genus database with same CATH homology
 2Y7S A;  4F4B A;  3SYS A;  1PRN A;  2N2M A;  3AA7 A;  2ODJ A;  1THQ A;  4RLB A;  3HOL A;  3DA4 A;  4D65 A;  3AAA B;  4FOZ A;  4O3Z A;  4O4X A;  8PRN A;  3POU A;  4Z3T A;  4O3W A;  2J1N A;  3WI5 A;  1GFN A;  3G7G A;  4B61 A;  4FRT A;  3SY7 A;  2ZLD A;  5JDP A;  4FRX A;  3VZW X;  4AKR A;  3O0E A;  1HXT A;  1GFP A;  4FZL A;  4O4U A;  1BT9 A;  1PHO A;  2MHL A;  4AZL A;  3UPG A;  2KXP B;  4LSH A;  5T5F A;  2FGR A;  5DL7 A;  4AYE C;  7PRN A;  3AA0 A;  4N59 A;  4QQ1 A;  5IYU A;  1ZHY A;  2FGQ X;  2Y2X A;  3AAE A;  3A2S X;  2Y0L A;  2XTR A;  5D5D A;  2YNK A;  5G26 A;  3VZU X;  4RLC A;  2MNH A;  2LFU A;  3VE1 A;  5AFU L;  3HWB A;  3T0S A;  1BXW A;  5PRN A;  3AA6 A;  4D64 A;  4E1S A;  3WI4 A;  2OMF A;  3C5O A;  3V8U A;  4FZM A;  4O3X B;  2K0L A;  5ADX K;  2KXP A;  3SZV A;  2LHF A;  3TZG A;  2Y0H A;  4GF4 A;  4XNK A;  2M07 A;  3K19 A;  4FT6 A;  3HW9 A;  4FUV A;  4AYM C;  4KRA A;  5AFU K;  3SZD A;  1IZN B;  2J4U P;  1MM4 A;  3VZT X;  1HXU A;  3FYX A;  3AA7 B;  4AFK A;  3LK3 B;  6PRN A;  4C69 X;  3LK3 A;  3PQS A;  3UAQ A;  2F1V A;  3LK2 B;  1MM5 A;  4FSP A;  1Q9F A;  2XE2 A;  3AA6 B;  5ADX L;  3AA1 B;  3SY9 A;  4U9C A;  3AA1 A;  2W81 C;  1GFQ A;  2XE5 A;  2PRN A;  4N58 A;  2XG6 A;  4O3Y A;  5EE2 A;  1QJP A;  1YS5 A;  1ZHT A;  1QJ8 A;  2O4V A;  4AYD C;  3RBH A;  1ZHZ A;  2GE4 A;  2XE1 A;  4XNL A;  3JTY A;  3VY9 X;  3EMN X;  4LSF A;  3POQ A;  3AAE B;  1OPF A;  4AUI A;  2Y0K A;  4KR8 A;  4FES A;  2XE3 A;  5GV0 A;  3LK4 2;  4RJW A;  3POR A;  3VE2 A;  2M06 A;  1P4T A;  3NSG A;  2K4T A;  2KZ7 B;  4FZN A;  1ORM A;  4FMS A;  4O49 A;  3UU2 A;  2XMX A;  3QRC A;  1HXX A;  2KC0 A;  3PQU A;  1OSM A;  3QRA A;  4FSO A;  1MPF A;  4G75 A;  4AKM A;  3T24 A;  4GCS A;  2JMM A;  3AA0 B;  2F1T A;  4BUM X;  3LK4 1;  5DL5 A;  2ZFG A;  4E1T A;  1IZN A;  3SYB A;  5DL6 A;  3KVD D;  3T20 A;  3GP6 A;  2YPV A;  4AYI D;  2X27 X;  1GFO A;  5FVN A;  1E54 A;  2QTK A;  4GHB A;  4AYN A;  4JFB A;  4G76 A;  2KZ7 A;  4D5U A;  1G90 A;  3PRN A;  3AAA A;  4RL9 A;  2POR A;  2W80 C;  1H6S 1;  4JCH A;  1ZHX A;  4LSI A;  4GCQ A;  3DA3 A;  4KR4 A;  1GFM A;  4AKR B;  1ZHW A;  2N2L A;  5DL8 A;  2KDY A;  4LSE A;  3POX A;  4PUX A;  2XTQ A;  3HOE A;  3VY8 X;  1QJ9 A;  1Q9G A;  2ERV A;  1BH3 A;  4GCP A;  4RJX A;  3LK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...