3FYXA

The structure of ompf porin with a synthetic dibenzo-18-crown-6 as modulator
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGCAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title On the function and structure of synthetically modified porins.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transport protein
total genus 85
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3fyxA00
3HWBA 3SYSA 6PRNA 1GFPA 3VZUX 1PHOA 4KR4A 2FGRA 3PRNA 3POUA 1GFOA 4FMSA 3T24A 7PRNA 2PRNA 1HXTA 2Y2XA 3K19A 3SYBA 3POXA 3VY9X 4FSPA 4GCPA 5PRNA 4C69X 3VZWX 4LSFA 4AUIA 1HXXA 2PORA 4RJWA 1H6S1 4KRAA 1OPFA 1PRNA 2ZLDA 3POQA 4BUMX 5DL6A 4FRXA 3O0EA 4D64A 3T20A 1OSMA 2J1NA 2Y0LA 2ODJA 1BT9A 3UPGA 1MPFA 3T0SA 3WI4A 2XG6A 3WI5A 3SZVA 1BH3A 3A2SX 2Y0HA 3VZTX 2O4VA 1E54A 4FRTA 5JDPA 4LSHA 4GCSA 1HXUA 2Y0KA 3FYXA 5DL8A 3JTYA 1GFNA 4FOZA 2XE1A 5FVNA 4KR8A 2FGQX 2XE5A 2QTKA 4D5UA 4FT6A 4FSOA 2XE2A 4LSEA 2K4TA 3SY9A 3SZDA 4D65A 3EMNX 3PORA 3UU2A 3VY8X 2OMFA 2XE3A 1GFQA 5DL5A 1GFMA 2ZFGA 4GCQA 8PRNA 3SY7A 3NSGA 4JFBA 4LSIA 3HW9A 4RJXA 5DL7A 2J4UP
chains in the Genus database with same CATH superfamily
3NJTA 3HWBA 3LK41 4RLBA 4AFKA 2KDYA 2GE4A 2R4NA 2KZ7B 3JCUO 2WJRA 5ADXL 3SYSA 3AA1A 3AA0A 2J4UP 1THQA 6PRNA 1GFPA 1ZHZA 3HW9A 2YPVA 4K3CA 3VZUX 5G26A 1PHOA 2KXPB 2Y7SA 2FGRA 4KR4A 4F4BA 2WJQA 2LFUA 5B5EO 3G7GA 3PRNA 5G3AA 4AYMC 2R8AA 2IWVA 3POUA 1GFOA 5GV0A 2WVPA 3QRAA 4FMSA 3T24A 4Z3TA 1MM4A 3PGSA 7PRNA 2PRNA 3LK42 1HXTA 4E1SA 2Y2XA 5KAIO 2M07A 4FESA 4N74A 5IYUA 3K19A 3SYBA 3LK2A 4O3WA 4C4VB 2JQYA 2KZ7A 3BS0A 3POXA 4N59A 1ZHTA 4PR7A 3VY9X 2R4OA 3KVDD 3WU2O 1Q9GA 1IZNB 4FSPA 4GCPA 4GHBA 5KAFO 5PRNA 2AXTO 2R89A 4QQ1A 5TISO 4C69X 5ADXK 2KXPA 4G76A 5B66O 3VZWX 4LSFA 4AUIA 3AAEB 1HXXA 2PORA 4RJWA 3A0BO 4AYDC 1ZHXA 1H6S1 2YNKA 4KRAA 4AKMA 3VE1A 1PRNA 3DWOX 2ZLDA 2W80C 3POQA 4AKRB 4BUMX 5DL6A 1QJ9A 1ZHYA 3TZGA 4AYNA 3AA6B 3PQSA 4FRXA 3O0EA 3A0HO 4D64A 1OSMA 2J1NA 2IWWA 2Y0LA 3T20A 2ODJA 4CTDA 3BRZA 1BT9A 1BXWA 3UPGA 1QJ8A 3C5OA 3PF1A 4C4VA 1MPFA 3T0SA 1P4TA 3DA4A 3WI4A 2XG6A 3HOLA 2W81C 4N75A 3SZVA 1BH3A 3A2SX 3HOEA 4O3XB 3WI5A 4UB8O 4O3ZA 2Y0HA 1IZNA 4FQEA 5EE2A 3UAQA 2X27X 2F1VA 4N58A 4XNLA 3QRCA 4U9CA 3LK3B 4K3BA 5G38A 1T16A 1ZHWA 4AZLA 3AAEA 3VZTX 2R4PA 2O4VA 1E54A 4FRTA 5AFUK 4JCHA 3AAAB 4LSHA 5JDPA 4GCSA 5AFUL 1HXUA 4G75A 2Y0KA 3FYXA 1Q9FA 3DA3A 4PUXA 4AKRA 5DL8A 3KZIO 3JTYA 1GFNA 3AA6A 4O4UA 5G39A 4FOZA 1S5LO 2LHFA 2N2LA 2XE1A 2ERVA 2XMXA 4KR8A 2FGQX 5D5DA 5E79O 5FVNA 4AYEC 5H2FO 3AA7B 4O3YA 2M06A 2QTKA 3BRYA 4RL9A 2R88A 4FZMA 4D5UA 3DZMA 2JMMA 4FSOA 2XE2A 4FT6A 5T5FA 4LSEA 2N2MA 2MHLA 5GTHO 2KC0A 2K4TA 3LK3A 4PJ0O 1MM5A 4UB6O 4RJXA 4O49A 4O4XA 4B61A 4FZLA 4FUVA 2F1CX 3AA1B 3AA0B 3AAAA 3SY9A 5GTIO 1G90A 3SZDA 4E1TA 4D65A 3EMNX 3GP6A 4AYID 3PGRA 3PORA 4FZNA 3UU2A 3VY8X 2OMFA 2XE3A 3V8UA 3PGUA 2X9KA 1GFQA 5DL5A 4IL6O 2R4LA 1GFMA 3DWNA 4XNKA 1ORMA 1YS5A 1QJPA 1T1LA 2XTQA 2MNHA 2ZFGA 4GCQA 4GF4A 3AA7A 3VE2A 8PRNA 3SY7A 2XTRA 3NSGA 2K0LA 4JFBA 4RLCA 3RBHA 3PQUA 4LSIA 4C00A 1OPFA 2XE5A 5DL7A 2F1TA 3LK2B
chains in the Genus database with same CATH topology
4RLBA 3HWBA 3LK41 4AFKA 2KDYA 2GE4A 2KZ7B 5ADXL 3SYSA 3AA1A 3AA0A 2J4UP 1THQA 6PRNA 1GFPA 1ZHZA 3HW9A 2YPVA 3VZUX 5G26A 1PHOA 2KXPB 2Y7SA 2FGRA 4KR4A 4F4BA 2LFUA 3G7GA 3PRNA 4AYMC 3POUA 1GFOA 5GV0A 3QRAA 4FMSA 3T24A 4Z3TA 1MM4A 7PRNA 2PRNA 3LK42 1HXTA 4E1SA 2Y2XA 2M07A 4FESA 5IYUA 3K19A 3SYBA 3LK2A 4O3WA 2KZ7A 3POXA 4N59A 1ZHTA 3VY9X 3KVDD 1Q9GA 1IZNB 4FSPA 4GCPA 4GHBA 5PRNA 5ADXK 4C69X 4QQ1A 2KXPA 4G76A 3VZWX 4LSFA 4AUIA 3AAEB 1HXXA 2PORA 4RJWA 4AYDC 1ZHXA 1H6S1 2YNKA 4KRAA 4AKMA 3VE1A 1PRNA 2ZLDA 2W80C 3POQA 4AKRB 4BUMX 5DL6A 1QJ9A 1ZHYA 3TZGA 4AYNA 3AA6B 3PQSA 4FRXA 3O0EA 4D64A 3T20A 1OSMA 2J1NA 2Y0LA 2ODJA 1BT9A 1BXWA 3UPGA 1QJ8A 3C5OA 1MPFA 3T0SA 1P4TA 3DA4A 3WI4A 2XG6A 3HOLA 2W81C 3SZVA 3WI5A 1BH3A 3A2SX 3HOEA 4O3XB 5EE2A 4O3ZA 2Y0HA 1IZNA 3UAQA 2X27X 2F1VA 4N58A 4XNLA 3QRCA 4U9CA 3LK3B 4AZLA 1ZHWA 3AAEA 3VZTX 2O4VA 1E54A 4FRTA 5AFUK 4JCHA 3AAAB 4LSHA 5JDPA 4GCSA 5AFUL 1HXUA 4G75A 2Y0KA 3FYXA 1Q9FA 3DA3A 4PUXA 4AKRA 5DL8A 3JTYA 1GFNA 3AA6A 4O4UA 4FOZA 2LHFA 2N2LA 2XE1A 2ERVA 2XMXA 4KR8A 2FGQX 5D5DA 5FVNA 4AYEC 3AA7B 4O3YA 2M06A 2QTKA 4RL9A 4FZMA 4D5UA 4FT6A 2JMMA 4FSOA 2XE2A 5T5FA 4LSEA 2N2MA 2MHLA 2KC0A 2K4TA 3LK3A 1MM5A 4RJXA 4O49A 4O4XA 4B61A 4FZLA 4FUVA 3AA1B 3AA0B 3AAAA 3SY9A 1G90A 3SZDA 4E1TA 4D65A 3EMNX 3GP6A 4AYID 3PORA 4FZNA 3UU2A 3VY8X 2OMFA 2XE3A 3V8UA 1GFQA 5DL5A 1GFMA 4XNKA 1ORMA 1YS5A 1QJPA 2XTQA 4GF4A 2MNHA 2ZFGA 4GCQA 3AA7A 3VE2A 8PRNA 3SY7A 2XTRA 3NSGA 2K0LA 4JFBA 4RLCA 3RBHA 3PQUA 4LSIA 1OPFA 2XE5A 5DL7A 2F1TA 3LK2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HWB A;  3SYS A;  6PRN A;  1GFP A;  3VZU X;  1PHO A;  4KR4 A;  2FGR A;  3PRN A;  3POU A;  1GFO A;  4FMS A;  3T24 A;  7PRN A;  2PRN A;  1HXT A;  2Y2X A;  3K19 A;  3SYB A;  3POX A;  3VY9 X;  4FSP A;  4GCP A;  5PRN A;  4C69 X;  3VZW X;  4LSF A;  4AUI A;  1HXX A;  2POR A;  4RJW A;  1H6S 1;  4KRA A;  1OPF A;  1PRN A;  2ZLD A;  3POQ A;  4BUM X;  5DL6 A;  4FRX A;  3O0E A;  4D64 A;  3T20 A;  1OSM A;  2J1N A;  2Y0L A;  2ODJ A;  1BT9 A;  3UPG A;  1MPF A;  3T0S A;  3WI4 A;  2XG6 A;  3WI5 A;  3SZV A;  1BH3 A;  3A2S X;  2Y0H A;  3VZT X;  2O4V A;  1E54 A;  4FRT A;  5JDP A;  4LSH A;  4GCS A;  1HXU A;  2Y0K A;  3FYX A;  5DL8 A;  3JTY A;  1GFN A;  4FOZ A;  2XE1 A;  5FVN A;  4KR8 A;  2FGQ X;  2XE5 A;  2QTK A;  4D5U A;  4FT6 A;  4FSO A;  2XE2 A;  4LSE A;  2K4T A;  3SY9 A;  3SZD A;  4D65 A;  3EMN X;  3POR A;  3UU2 A;  3VY8 X;  2OMF A;  2XE3 A;  1GFQ A;  5DL5 A;  1GFM A;  2ZFG A;  4GCQ A;  8PRN A;  3SY7 A;  3NSG A;  4JFB A;  4LSI A;  3HW9 A;  4RJX A;  5DL7 A;  2J4U P; 
#chains in the Genus database with same CATH topology
 3NJT A;  3HWB A;  3LK4 1;  4RLB A;  4AFK A;  2KDY A;  2GE4 A;  2R4N A;  2KZ7 B;  3JCU O;  2WJR A;  5ADX L;  3SYS A;  3AA1 A;  3AA0 A;  2J4U P;  1THQ A;  6PRN A;  1GFP A;  1ZHZ A;  3HW9 A;  2YPV A;  4K3C A;  3VZU X;  5G26 A;  1PHO A;  2KXP B;  2Y7S A;  2FGR A;  4KR4 A;  4F4B A;  2WJQ A;  2LFU A;  5B5E O;  3G7G A;  3PRN A;  5G3A A;  4AYM C;  2R8A A;  2IWV A;  3POU A;  1GFO A;  5GV0 A;  2WVP A;  3QRA A;  4FMS A;  3T24 A;  4Z3T A;  1MM4 A;  3PGS A;  7PRN A;  2PRN A;  3LK4 2;  1HXT A;  4E1S A;  2Y2X A;  5KAI O;  2M07 A;  4FES A;  4N74 A;  5IYU A;  3K19 A;  3SYB A;  3LK2 A;  4O3W A;  4C4V B;  2JQY A;  2KZ7 A;  3BS0 A;  3POX A;  4N59 A;  1ZHT A;  4PR7 A;  3VY9 X;  2R4O A;  3KVD D;  3WU2 O;  1Q9G A;  1IZN B;  4FSP A;  4GCP A;  4GHB A;  5KAF O;  5PRN A;  2AXT O;  2R89 A;  4QQ1 A;  5TIS O;  4C69 X;  5ADX K;  2KXP A;  4G76 A;  5B66 O;  3VZW X;  4LSF A;  4AUI A;  3AAE B;  1HXX A;  2POR A;  4RJW A;  3A0B O;  4AYD C;  1ZHX A;  1H6S 1;  2YNK A;  4KRA A;  4AKM A;  3VE1 A;  1PRN A;  3DWO X;  2ZLD A;  2W80 C;  3POQ A;  4AKR B;  4BUM X;  5DL6 A;  1QJ9 A;  1ZHY A;  3TZG A;  4AYN A;  3AA6 B;  3PQS A;  4FRX A;  3O0E A;  3A0H O;  4D64 A;  1OSM A;  2J1N A;  2IWW A;  2Y0L A;  3T20 A;  2ODJ A;  4CTD A;  3BRZ A;  1BT9 A;  1BXW A;  3UPG A;  1QJ8 A;  3C5O A;  3PF1 A;  4C4V A;  1MPF A;  3T0S A;  1P4T A;  3DA4 A;  3WI4 A;  2XG6 A;  3HOL A;  2W81 C;  4N75 A;  3SZV A;  1BH3 A;  3A2S X;  3HOE A;  4O3X B;  3WI5 A;  4UB8 O;  4O3Z A;  2Y0H A;  1IZN A;  4FQE A;  5EE2 A;  3UAQ A;  2X27 X;  2F1V A;  4N58 A;  4XNL A;  3QRC A;  4U9C A;  3LK3 B;  4K3B A;  5G38 A;  1T16 A;  1ZHW A;  4AZL A;  3AAE A;  3VZT X;  2R4P A;  2O4V A;  1E54 A;  4FRT A;  5AFU K;  4JCH A;  3AAA B;  4LSH A;  5JDP A;  4GCS A;  5AFU L;  1HXU A;  4G75 A;  2Y0K A;  3FYX A;  1Q9F A;  3DA3 A;  4PUX A;  4AKR A;  5DL8 A;  3KZI O;  3JTY A;  1GFN A;  3AA6 A;  4O4U A;  5G39 A;  4FOZ A;  1S5L O;  2LHF A;  2N2L A;  2XE1 A;  2ERV A;  2XMX A;  4KR8 A;  2FGQ X;  5D5D A;  5E79 O;  5FVN A;  4AYE C;  5H2F O;  3AA7 B;  4O3Y A;  2M06 A;  2QTK A;  3BRY A;  4RL9 A;  2R88 A;  4FZM A;  4D5U A;  3DZM A;  2JMM A;  4FSO A;  2XE2 A;  4FT6 A;  5T5F A;  4LSE A;  2N2M A;  2MHL A;  5GTH O;  2KC0 A;  2K4T A;  3LK3 A;  4PJ0 O;  1MM5 A;  4UB6 O;  4RJX A;  4O49 A;  4O4X A;  4B61 A;  4FZL A;  4FUV A;  2F1C X;  3AA1 B;  3AA0 B;  3AAA A;  3SY9 A;  5GTI O;  1G90 A;  3SZD A;  4E1T A;  4D65 A;  3EMN X;  3GP6 A;  4AYI D;  3PGR A;  3POR A;  4FZN A;  3UU2 A;  3VY8 X;  2OMF A;  2XE3 A;  3V8U A;  3PGU A;  2X9K A;  1GFQ A;  5DL5 A;  4IL6 O;  2R4L A;  1GFM A;  3DWN A;  4XNK A;  1ORM A;  1YS5 A;  1QJP A;  1T1L A;  2XTQ A;  2MNH A;  2ZFG A;  4GCQ A;  4GF4 A;  3AA7 A;  3VE2 A;  8PRN A;  3SY7 A;  2XTR A;  3NSG A;  2K0L A;  4JFB A;  4RLC A;  3RBH A;  3PQU A;  4LSI A;  4C00 A;  1OPF A;  2XE5 A;  5DL7 A;  2F1T A;  3LK2 B; 
#chains in the Genus database with same CATH homology
 4RLB A;  3HWB A;  3LK4 1;  4AFK A;  2KDY A;  2GE4 A;  2KZ7 B;  5ADX L;  3SYS A;  3AA1 A;  3AA0 A;  2J4U P;  1THQ A;  6PRN A;  1GFP A;  1ZHZ A;  3HW9 A;  2YPV A;  3VZU X;  5G26 A;  1PHO A;  2KXP B;  2Y7S A;  2FGR A;  4KR4 A;  4F4B A;  2LFU A;  3G7G A;  3PRN A;  4AYM C;  3POU A;  1GFO A;  5GV0 A;  3QRA A;  4FMS A;  3T24 A;  4Z3T A;  1MM4 A;  7PRN A;  2PRN A;  3LK4 2;  1HXT A;  4E1S A;  2Y2X A;  2M07 A;  4FES A;  5IYU A;  3K19 A;  3SYB A;  3LK2 A;  4O3W A;  2KZ7 A;  3POX A;  4N59 A;  1ZHT A;  3VY9 X;  3KVD D;  1Q9G A;  1IZN B;  4FSP A;  4GCP A;  4GHB A;  5PRN A;  5ADX K;  4C69 X;  4QQ1 A;  2KXP A;  4G76 A;  3VZW X;  4LSF A;  4AUI A;  3AAE B;  1HXX A;  2POR A;  4RJW A;  4AYD C;  1ZHX A;  1H6S 1;  2YNK A;  4KRA A;  4AKM A;  3VE1 A;  1PRN A;  2ZLD A;  2W80 C;  3POQ A;  4AKR B;  4BUM X;  5DL6 A;  1QJ9 A;  1ZHY A;  3TZG A;  4AYN A;  3AA6 B;  3PQS A;  4FRX A;  3O0E A;  4D64 A;  3T20 A;  1OSM A;  2J1N A;  2Y0L A;  2ODJ A;  1BT9 A;  1BXW A;  3UPG A;  1QJ8 A;  3C5O A;  1MPF A;  3T0S A;  1P4T A;  3DA4 A;  3WI4 A;  2XG6 A;  3HOL A;  2W81 C;  3SZV A;  3WI5 A;  1BH3 A;  3A2S X;  3HOE A;  4O3X B;  5EE2 A;  4O3Z A;  2Y0H A;  1IZN A;  3UAQ A;  2X27 X;  2F1V A;  4N58 A;  4XNL A;  3QRC A;  4U9C A;  3LK3 B;  4AZL A;  1ZHW A;  3AAE A;  3VZT X;  2O4V A;  1E54 A;  4FRT A;  5AFU K;  4JCH A;  3AAA B;  4LSH A;  5JDP A;  4GCS A;  5AFU L;  1HXU A;  4G75 A;  2Y0K A;  3FYX A;  1Q9F A;  3DA3 A;  4PUX A;  4AKR A;  5DL8 A;  3JTY A;  1GFN A;  3AA6 A;  4O4U A;  4FOZ A;  2LHF A;  2N2L A;  2XE1 A;  2ERV A;  2XMX A;  4KR8 A;  2FGQ X;  5D5D A;  5FVN A;  4AYE C;  3AA7 B;  4O3Y A;  2M06 A;  2QTK A;  4RL9 A;  4FZM A;  4D5U A;  4FT6 A;  2JMM A;  4FSO A;  2XE2 A;  5T5F A;  4LSE A;  2N2M A;  2MHL A;  2KC0 A;  2K4T A;  3LK3 A;  1MM5 A;  4RJX A;  4O49 A;  4O4X A;  4B61 A;  4FZL A;  4FUV A;  3AA1 B;  3AA0 B;  3AAA A;  3SY9 A;  1G90 A;  3SZD A;  4E1T A;  4D65 A;  3EMN X;  3GP6 A;  4AYI D;  3POR A;  4FZN A;  3UU2 A;  3VY8 X;  2OMF A;  2XE3 A;  3V8U A;  1GFQ A;  5DL5 A;  1GFM A;  4XNK A;  1ORM A;  1YS5 A;  1QJP A;  2XTQ A;  4GF4 A;  2MNH A;  2ZFG A;  4GCQ A;  3AA7 A;  3VE2 A;  8PRN A;  3SY7 A;  2XTR A;  3NSG A;  2K0L A;  4JFB A;  4RLC A;  3RBH A;  3PQU A;  4LSI A;  1OPF A;  2XE5 A;  5DL7 A;  2F1T A;  3LK2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...