3FZ9A

Crystal structure of poplar glutaredoxin s12 in complex with glutathione
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
GSRLEDAVKKTVAENPVVVYSKTWCSYSSEVKSLFKRLNVDPLVVELDELGAQGPQIQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEANAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin
publication title Structure-function relationship of the chloroplastic glutaredoxin S12 with an atypical WCSYS active site.
pubmed doi rcsb
source organism Populus tremula x populus tremuloides
molecule tags Oxidoreductase
total genus 34
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fz9A00
3UBKA 2WGRA 4NWYA 3OR5A 3FRCA 3FY7A 1USBA 5IMFA 1WIKA 2ALBA 3BJ5A 2B1LA 2GQKA 4MMMA 5KN1A 1ON4A 2AHEA 4NPBA 3UJ1A 2FWGA 2F8FA 4V1Ag 3G7IA 2HSHA 2I4AA 1GLPA 3IE3A 3E3EA 3CTFA 1B4QA 2WCIA 2VO4A 1SJZA 1V9WA 3NIVA 4FYCA 4YQVA 1GNWA 2X8HA 4IW9A 2JZRA 3GL5A 1GH2A 4PQ1A 4ML1A 3F3QA 1M2DA 3EU3A 1GUHA 2RM5A 4EDYA 1GUMA 3BBYA 4XTSA 4EC0A 3ZIJA 4FIWA 1AW9A 4GSSA 4HQZA 3GSSA 6GSYA 3L4NA 2JSZA 2VLVA 1T00A 3TJBA 4OO4A 2Z9SA 5DAKB 5D9XA 1QGVA 5IQYA 5J9CA 1SENA 2YWMA 2FNOA 4L8EA 1VF4A 6GSWA 3F9UA 3DRNA 2FWFA 2GGTA 2CZ2A 2R37A 3C8EA 3EE2A 4F0CA 1XPVA 4DSSA 2C1YA 4TVEA 1H4OA 3CRUA 3RHCA 5B8BA 3GUSA 3VI7A 5F0GA 5F05A 1K0MA 1XW5A 4F03A 1SKWB 1ZGNA 2PWJA 1XIYA 3KIJA 4HDEA 3HZ4A 3M9KA 4TR4A 5ELGA 3GURA 6GSVA 3GN3A 3APOA 3H79A 2L4CA 3W6GA 3CSJA 2B7KA 1ST9A 4NHWA 1CQHA 3Q19A 1SD9A 3TUEA 2B6MA 2R6KA 4O32A 1LBKA 1J0FA 7GSSA 4CHSA 5IMCA 2BJXA 1Z7PA 1F6MC 1BQ7A 4K8MA 4POLA 3NZNA 2B5XA 4KCEA 22GSA 1G7EA 1K0CA 2J9HA 1U3AA 1PL1A 4E8HA 1U3IA 4K2DA 3H8QA 2HRFA 5DVBA 3FZAA 4J57E 4N0VA 2VCZA 4AJ7A 4BVYA 5HQPA 1K3LA 4O92A 1BX9A 2P0GA 2VLTA 4ZXGA 1DE1A 4FH8A 5AN1A 5IPGA 4KNDA 2OADA 1JHBA 4MDCA 3UAPA 3LXZA 2TRXA 2VM2A 5J4UA 2E7PA 3GA4A 4BWSA 1GLQA 1Z3EA 2DJ2A 4XS4B 4V2NA 5ECMB 4IELA 4K7NA 5CRWA 3BD2A 2GLRA 5ID2B 1GRXA 5G1KA 1NM3A 3DGQA 4OO5A 2VUPA 2VCVA 2IMDA 2ON5A 5IMVA 2HFDA 3F0IA 1F37A 5DCHA 1VGLA 3GX8A 1FG4A 13GSA 2YOIA 9GSSA 5EPFA 1M2BA 1I9DA 4HU9A 3RHBA 3RPNA 3KP8A 2MMNA 2RUEA 2VL2C 3DD3A 3QD9A 3ZTLA 3QFAC 3N9JA 3KM6A 4KE3A 2KOKA 2B5YA 1ZYEA 2GTUA 3GSTA 3TOTA 3QOUA 2H6XA 3VI5A 1SK2A 3FKFA 1QMVA 1EWXA 1K0OA 2CZ3A 1HNAA 5G5FA 1AQXA 2CVBA 4N30A 3C73A 3O76A 4KH7A 1Z6NA 4GLTA 3IR4A 2GSSA 3P8WA 1MD4A 5KN0A 1J9BA 3A2WA 4MJEA 4HZ4A 2MYGA 2L57A 2E2MA 4K1FA 1B4PA 2VLUA 4G19A 3IHQA 1SL2B 2V6KA 2H70A 1K0DA 2CVKA 2C0GA 5DALB 2X8CA 4GWRA 3KJYA 3APQA 2IFQA 3KH7A 1TK0B 4I97A 3MWHA 3TRQA 5CYYA 2C0DA 4TR1A 4IN0A 2IMKA 5CNWA 3UEMA 4AJ6A 1R5PA 3HXSA 1TDIA 4TOPA 3TKQA 3VWWA 2NPBA 4KGIA 2MZCA 1GSQA 3C1RA 3P2AA 4IJ3A 2H75A 2GZYA 2NBSA 1GWCA 2FUG2 5ECRB 1XWBA 1JLWA 5G2ZA 4WBRD 3TRXA 3MNGA 5DCGA 1ZL9A 1JFUA 5D9VA 1A8LA 3ZREA 3QR6A 3ZLPA 4KDYA 4TXVA 2HE3A 5D93A 2VAFA 2DBCA 2AYTA 1OC8A 3WGXA 4MA9A 3QAVA 1B9XC 3IK7A 4D73B 1F2EA 5DBQA 5F06A 2MBTA 2CAQA 4KW6A 5HFIA 2B3SA 3F4RA 3UARA 2PPTA 1XVWA 4I2TA 3HJPA 3IRAA 4F0BA 1VRSD 2PUKC 1JZOA 5CP1A 3EYTA 1XFLA 2KP1A 4N0ZA 1EGRA 5B6NA 5CRGA 2HI7A 4N11A 1GTIA 1DE2A 3W8JA 4ID0A 1G6WA 1F3AA 4OCEA 3L9SA 1BG5A 1ERVA 4GXZA 5J41A 1FHEA 1MDJA 3ED3A 5EY6A 1SJ6A 3F63A 4MCUA 5C00A 3ZYWA 2XC2A 1XZOA 3D22A 4KSMA 2LQQA 4MLYA 3F4SA 4DEJA 2PU9C 2I3YA 3J7Yk 3TJKA 2KUCA 4N10A 1YF0A 1W4VA 4GTUA 3I43A 3GX0A 4G10A 2PGTA 3LJRA 1XOAA 3N5OA 5ECHB 2WULA 2H6YA 3ISOA 3KXOA 1GSEA 4LMVA 4ZB9A 4ZL9A 3F6DA 1K0NA 3FW2A 1GSFA 1GTUA 5AGYA 2WS2A 1XCCA 5ENUA 2HXKA 3M1GA 1TRSA 2H66A 2ZCTA 5A4WA 4K9ZA 4X0XA 4I5QA 5JWRB 2IMEA 4OCFA 4XCSA 4MK3A 4ZBAA 2E2GA 4XHMA 5AISA 5EVOA 1I5GA 5IO0A 1EV4A 4JBBA 1LJRA 3UVTA 4JRRA 2KLXA 1S3AA 1M2AA 3EC3A 1X5CA 1UN2A 3H4KA 3IDVA 2L5LA 3HA9A 5CAXA 2VOCA 5GSTA 2HZFA 1SKRB 3WT2A 1A0FA 3M9JA 2CAIA 4WR4A 4AGSA 2WZ9A 3JCML 4X43A 1B9YC 2I9HA 3HVXA 2H71A 2P5QA 3BCKA 4WKWA 1B8XA 3SWLA 2V6OA 5KN3A 2CV4A 4PQIA 5DAKA 2L6DA 4MJBA 2NVLA 3AY8A 3DIEA 3E0UA 5GAND 1Z9HA 4TXOA 3NOFA 3RBTA 4WF4A 2H01A 1Y6EA 3UIWA 2BMXA 2H1GA 1YKCA 4KSOA 1BAYA 2CX4A 4K0GA 2LQOA 3C71A 4EXJA 4J2FA 3A5WA 5JCUA 3GKMA 4MF7A 4QL7A 1GTAA 4ZBDA 2A4VA 2KP2A 1K0AA 1A2JA 5HR1A 3U6VA 1FW1A 1OVNA 3V1WA 4KCAA 3LWAA 3DMLA 1T4YA 1O7UA 2H6ZA 2LNTA 2H19A 5ECPB 2DC5A 3UOMA 4OWYA 4DSRA 4ZL8A 2JZTA 4LLRA 1Y25A 4BA7A 3HDCA 5B8AA 1ZOFA 1F9MA 3BOAA 2GZPA 4MZWA 2H1AA 4L0WA 4O7HA 5ELAA 4Q5NA 5IO2A 4XRAA 4WR5A 4JZQA 3WYWA 2R4VA 1NW2A 4TW5A 2RUFA 3R2QA 5FHIA 3D0ZA 1O85A 3ZZXA 2WDUA 2XBIA 2OKAA 3S9FA 3PGTA 3IXRA 2YNXA 3LGCA 1IYHA 2ON7A 12GSA 4JE1A 4NMUA 5D8IA 2EC4A 2FHEA 2F9SA 1EP8A 4GCIA 1S3CA 1GSUA 1WOUA 2V41A 2H72A 2FWEA 2FA4A 2H0HA 4MZCA 2YWOA 1O8WA 4ZB6A 4XS4A 5KN2A 5IM9A 5JWQB 5IIZA 4TN8A 2HZEB 2ZNMA 5ID2A 4XRDA 4Z7XA 2EIRA 3FR9A 3GL3A 1XBSA 2O7KA 3FR3A 1GUKA 1M0UA 2CA8A 1QQ2A 2J23A 3KH9A 2GSRA 1A2MA 2AAWA 2XPEA 2ES7A 1UA5A 2IIYA 3APSA 4EUYA 1W89A 4KA0A 1OC9B 2H73A 3TJFA 1QFNA 5E4WA 1FAAA 3Q74A 1WRYA 5LCZA 3ME8A 3FK8A 3U5RE 1C72A 4MP4A 4EVMA 1DSBA 3DVXA 1TKDB 3BCIA 1EV9A 5H5RA 1O73A 4GF0A 4ZB8A 1BJXA 1HD2A 3TKSE 4ZIJA 3EWLA 3WT1A 4QL9A 4G2EA 1MDIA 3TOUA 5B6MA 1H75A 1K0BA 2DJJA 4PNGA 1YKAA 4EKZA 1LU4A 4IHUA 2HSYA 1ILOA 4J56E 1PX6A 2B7JA 3TB2A 2JSYA 1WPIA 3UL3A 3LORA 1RW1A 3FZ5A 5IOWA 1E2YA 2VCXA 4H86A 1XWKA 2VL2A 2H1DA 1SL0B 4POKA 2MBSA 6GSUA 2CX3A 4XS6A 3D6IA 2G2QA 2YP6A 1R4WA 3EINA 2F8AA 1ZMAA 2YJHA 1WP0A 3UVHA 1V57A 1TRVA 3GYKA 3KP9A 1CQGA 2I1UA 5DALA 2K18A 1PD21 5EL8A 2O87A 3F4TA 2PVQA 3MAKA 3GHAA 2AJQB 4ECIA 1T8EB 3LXTA 1KNGA 4JR6A 3VURA 4IP6A 1S3DA 1V40A 1A23A 1KEBA 5ECIB 5D73A 3IK9A 1TP9A 2DJ0A 3DXBA 3O3TA 3LEFA 3L9UA 1A0RP 1Q98A 2YN1A 2PMTA 3TKSA 3M0FA 5ECSA 2YWIA 5J3RA 1VF1A 2X99A 4IBPA 4HI7A 1BYEA 2R5GA 1TK5B 3TKRA 2YJ7A 4Q5RA 4IVFA 2LV3A 1WMJA 2H8LA 3IC4A 4WEYA 5COHA 1XWAA 4D73A 4IS0A 1YJ6A 4Q5QA 2A2SA 2FLSA 3FZ9A 1YEPA 1G6YA 1MDKA 2H30A 2YWNA 3IPZA 3RPPA 1FB6A 1GSSA 3QAGA 2DIZA 1ZCPA 4ISDA 5H5SA 3K8NA 3CMIA 5INYA 3GTUB 4NAXA 2IN3A 2YPMA 4K7IA 1TW9A 2C3TA 2GS3A 3EVIA 6GSSA 2WFCA 4OFTA 4WF5A 3RAZA 3D21A 3A2VA 2GT5A 1U88A 4ZL7A 1IYIA 4PQHA 3ZITA 1TI1A 5D9WA 3ZIVA 2DJ3A 3EURA 5FWGA 2OACA 1KTEA 1ACVA 1OAZA 3HVSA 8GSSA 5FT3A 1PGTA 2IPAA 2GVPA 2CT6A 1SU9A 2K8SA 4KX4A 10GSA 4JU5A 4HU7A 3I69A 2C8UA 3GKXA 2VCTA 3QPMA 1T4ZA 2V32A 1R7HA 4FO5A 2VM1A 3ZVJD 1AUCA 3F6FA 1YZXA 1BEDA 4IQ1A 1EOGA 4L5LA 6GSXA 4EDZA 4KAEA 5ECQB 3VK9A 4JEDA 5ECKB 2QGVA 3HJMA 4MZBA 5IMAA 4AF2A 1QXHA 3TKPA 4YQMA 4L5OA 5IOXA 2DJ1A 3WGDA 4HEA2 3ZMKA 1MD3A 3GNJA 2IMFA 1F3BA 3VLNA 3HZ8A 2VCQA 3DEXA 4X1UA 4GRFA 2L5OA 2C3QA 4F9ZA 1M9AA 1T1VA 4HZ2A 2FA8A 3WD6A 5D96A 1SK1A 3O6TA 3HCZA 2P5RA 4LL1B 1FO5A 1AC1A 5GZZB 3VFIA 2YV9A 2GQLA 3D4MA 4I6XA 4K7OA 3HYPA 1PL2A 3QCPA 3TCOA 2IJYA 1PSQA 1SKSB 5C04A 1XXUA 2OA7A 3IV4A 2LEGA 1GULA 2C0FA 2PVOC 3F8UA 2K6VA 1PKZA 5J9BA 1URMA 2MMAA 3GRXA 2K9FA 1THXA 4V2LA 1MEKA 4HOJA 3L0HA 2B1KA 5L71A 1NHOA 4POMA 2LJKA 3CRTA 4TR0A 4IQAA 2HNLA 2PN8A 4MPFA 1FVKA 1VF3A 2DMMA 3EU4A 6GSTA 3HD5A 1GP1A 3PINA 1FOVA 11GSA 3TDGA 2FGXA 3H1NA 3E9JB 5DDLA 1Z6MA 1PKWA 3GH6A 2IWTA 2O85A 3P90A 1SD8A 1GSDA 1Q4JA 3ERGA 4PURA 1WE0A 3CXGA 1V98A 3D5JA 4FYUA 17GSA 2M72A 1XW6A 5GAPD 4I2UA 2X64A 1A24A 4RI7A 2C3NA 3DKSA 2L4QA 1GSYA 3WGEA 3ME7A 1U87A 3GKKA 4ECJA 1N2AA 1YF1A 1X0RA 1HNCA 2H0GA 2GSQA 4GSTA 4HUAA 2R2JA 2JACA 5AIXA 5G5EA 1TJDA 4E8EA 1UVZA 3KTBA 5ECLB 3I6AA 3KEBA 4MJAA 4FYBA 2QSIA 1O6JA 2YZHA 2HZEA 3HY2A 1X9SB 4BL7A 2IMIA 3CSIA 1O8XA 5LNKe 4MPGA 3VPTA 4EF0A 5DQSA 1OE7A 4TXOB 3ZL5A 4RQRA 2HYXA 2OE0A 1Z5YE 2O8VB 3KMNA 5H5QA 2TRCP 2RIIA 3IA1A 1PA3A 3ERFA 3ZFBA 1OC9A 5KEJA 4YH2A 1SYRA 3L78A 1XWCA 3PH9A 2DJKA 2HRNA 1HNBA 3C7MA 2F3MA 3FZ4A 2AV4A 1K3YA 5JCGA 2HLSA 4TKYA 4TRXA 2JZSA 2LSTA 2V2GA 1TI3A 3FYGA 4GQFA 2REMA 4L0UA 3GKNA 3Q6OA 1M9BA 2YANA 4OMVA 4MJCA 3F3RA 1EOHA 2OBKA 5DJLA 3C1SA 4MF6A 2H76A 5G30A 1SK0A 3TRPA 3CBUA 3GV1A 4KDXA 2LJRA 3TJJA 2AUVA 2K8VA 3PR8A 2P31A 3SBCA 3LG6A 5A4VA 3TGZA 1GNEA 4G9HA 2N5AA 4DSSB 4F82A 1G7OA 2KHPA 1ZYQB 1TU7A 2LRCA 2DSAA 3KTLA 16GSA 1VF2A 3Q18A 5D9TA 2JU5A 2H74A 2VL3A 4ZILA 2N5FA 3I9V2 1QUWA 3KCMA 4MABA 2XPDA 4ULXA 2YZUA 2GDRA 3IOSA 4NV2A 3LYKA 1EGOA 2C4JA 2E0QA 2EIOA 4O5RA 1EEMA 1YY7A 2HT9A 1X9MB 2VCWA 3M8NA 3DWVA 4YAVA 5F8BA 1SJIA 4WETA 1TU8A 2QKEA 5HR3A 5E59A 3VWXA 4GQCA 5HR2A 3M3MA 2LTKA 5A4UA 1ML6A 1TOFA 1FVJA 4OFMA 5IMZA 3LYPA 1ERTA 1ABAA 1TXXA 1OC3A 3CSHA 1YEXA 2B5EA 3TJGA 5G31A 1DBYA 1XWGA 2OE1A 3VWVA 1GL8A 3IBHA 1EEJA 1ERWA 1X5EA 1WWJA 3QDNA 3LQ7A 2OJLA 2YV7A 3KMOA 5CRDA 3A3TA 3MDKA 3QMXA 4ECCA 2MMOA 4JR4A 1GTBA 19GSA 3HKRA 2M46A 3DYRA 1TTZA 2GT6A 2WB9A 1TRWA 4I8BA 3GTUA 3G7JA 1UC7A 1M99A 4QQ7A 4KDUA 1N8JA 2V1MA 4ILFA 5LD0A 3GH9A 5HR0A 2MMZA 4GSNA 1WJKA 5JCWA 1V58A 1O81A 1U6TA 4IJIA 2CQ9A 2M80A 4HJ2A 1B48A 2PBJA 5HFKA 2LKUA 2WJUA 3TKSC 1Z7RA 2XHFA 2OE3A 4ECBA 1XOBA 2DMLA 3KZQA 4XIHA 3EMXA 1JZWA 4HQSA 4KB3A 2BTOT 5G1LA 2R3XA 1R5AA 3MSZA 3GIXA 4WBJA 2OBIA 1A8YA 2YCDA 3US3A 1EP7A 1AXDA 1X5DA 3D4TA 1ZZYA 2ZUPA 4RQXA 2JL4A 1ERUA 5DJMA 5DQYA 1PMTA 1T7PB 3ZVJA 4DSQA 3VPQA 2LRNA 1JZRA 3FEUA 4DVCA 3GFKA 1HQOA 1V2AA 2VD1A 1NHYA 4KUNA 1G0TA 3HHVA 14GSA 4Q5FA 4HS1A 5JWOB 2NDOA 20GSA 4WXTA 4XS1A 5IPHA 4K6XA 3KD0A 3QFBC 1A2LA 1E6BA 3UMAA 5ABRA 4NHZA 3LSZA 1AAZA 2AB6A 4PX1A 1JLVA 3ZMLA 3QAWA 5CREA 2GQMA 1PRXA 4TR3A 4AJ8A 2FD3A 2NTOA 2LRTA 3G9BA 3A2XA 4BWQA 4ACSA 1X9WB 4PNFA 1YQ1A 4RI6A 3G7YA 2IFQB 3FR6A 4IKHA 3UBLA 1XW9A 4TR1B 4MH2A 3GMFA 4IP1A 2I81A 4F2IA 1T3BA 1YDKA 2LJAA 4CDOA 5GSSA 4CW9A 4BPYA 2XBQA 3RDWA 2CVDA 1OKDA 4MF5A 4MH3A 5HFGA 1FB0A 1TK8B 1JZDA 1TRUA 2GSTA 4EE0A 3EMPA 4OFNA 4YQUA 2RLIA 3CYNA 4P3YB 3IAM2 2FWHA 2IL3A 5J5NA 2WRTA 3ZFLA 1EZKA 3P7XA 1XVQA 2RM6A 1RQMA 3FHKA 2VD0A 1OYJA 3ERWA 2FCHA 4PXOA 4RUVA 2C80A 4LMWA 5B7CA 3DVWA 2EIQA 4PGTA 1J08A 2JADA 2O89A 4V1Ap 2X8GA 3HVVA 1PQNA 1QK8A 1OKTA 3IAS2 5IMDA 4IGJA 5A5KA 4EL1A 1PX7A 2N5BA 5AIVA 2DIYA 1NSWA 1SYXA 2A2RA 3H93A 4YAPA 2LNSA 1MTCA 4EO3A 1DUGA 1R26A 1AQVA 2F51A 1RK4A 4K0NA 2LS5A 3CTGA 1HYUA 2LUSA 1THOA 5ECOB 2PERA 2L59A 1M7TA 4NXIA 2D2ZA 4PUFC 4OD7A 2H0IA 3VWUA 4HJMA 2GZZA 2VIMA 4LA1A 1AQWA 2DLXA 3W8SA 2QC7A 5CRHA 3ZRDA 2FY6A 3L9VA 3KGKA 4LL4B 5CO3A 3LFLA 18GSA 2H1BA 4POBA 3J7Yb 1AIUA 4NV5A 3HJOA 2C0EA 4ZBBA 1K3OA 1KBNA 2TIRA 2L6CA 2VL9A 4BVXA 4PUAA 5F07A 1SL1B 4ML6A 1OE8A 1PN9A 5ECNB 4V2MA 2G0FA
chains in the Genus database with same CATH superfamily
3UBKA 2WGRA 4NWYA 3OR5A 3FRCA 3FY7A 1USBA 5IMFA 1WIKA 2ALBA 3BJ5A 2B1LA 2GQKA 4MMMA 5KN1A 1ON4A 2AHEA 4NPBA 3UJ1A 2FWGA 2F8FA 1S3RA 4V1Ag 2HRAA 3G7IA 2HSHA 2I4AA 1GLPA 3IE3A 3E3EA 3CTFA 1B4QA 2WCIA 2VO4A 1SJZA 1V9WA 3NIVA 4FYCA 4YQVA 1GNWA 2X8HA 4IW9A 2JZRA 3GL5A 1GH2A 4PQ1A 4ML1A 3F3QA 1M2DA 3EU3A 1GUHA 2RM5A 4EDYA 1GUMA 2HRKA 1XG8A 3BBYA 4XTSA 4EC0A 3ZIJA 4FIWA 4KF9A 1AW9A 4GSSA 4EIPA 4HQZA 3GSSA 6GSYA 3L4NA 2JSZA 2VLVA 1T00A 3TJBA 4OO4A 2Z9SA 5DAKB 5D9XA 1QGVA 5IQYA 5J9CA 1SENA 2YWMA 2FNOA 4L8EA 1VF4A 6GSWA 3F9UA 3DRNA 2FWFA 5BMUA 2GGTA 2CZ2A 2R37A 3C8EA 3EE2A 4F0CA 1XPVA 4DSSA 2C1YA 4TVEA 1H4OA 3CRUA 3RHCA 5B8BA 3GUSA 3VI7A 5F0GA 4Z2UA 5F05A 1K0MA 1XW5A 4F03A 1SKWB 1ZGNA 3KIJA 2PWJA 1XIYA 2X49A 4HDEA 3HZ4A 3M9KA 4TR4A 5ELGA 3GURA 6GSVA 3GN3A 3APOA 3H79A 2L4CA 3W6GA 3CSJA 2B7KA 1ST9A 4NHWA 1CQHA 3Q19A 1SD9A 3TUEA 2B6MA 2R6KA 4O32A 1LBKA 1J0FA 7GSSA 2QA2A 4CHSA 5IMCA 2BJXA 1Z7PA 1F6MC 1BQ7A 4K8MA 4POLA 3NZNA 2B5XA 4CY8A 4KCEA 22GSA 1G7EA 1K0CA 2J9HA 1U3AA 3PPUA 1PL1A 4E8HA 1U3IA 4K2DA 3H8QA 2HRFA 5DVBA 3FZAA 4J57E 4N0VA 2VCZA 4AJ7A 4BVYA 4CY6A 5HQPA 4K5RA 1K3LA 4O92A 1BX9A 2P0GA 2VLTA 4ZXGA 1DE1A 4FH8A 5AN1A 5IPGA 4KNDA 2OADA 1JHBA 4G0KA 4MDCA 3UAPA 3LXZA 2TRXA 2VM2A 5J4UA 3GA4A 2E7PA 4BWSA 1GLQA 1Z3EA 2DJ2A 4XS4B 4V2NA 5ECMB 4IELA 4K7NA 3A5IA 5CRWA 3BD2A 2GLRA 5ID2B 1GRXA 5G1KA 1NM3A 3DGQA 4OO5A 2VUPA 2VCVA 2IMDA 2ON5A 5IMVA 2HFDA 3F0IA 1F37A 5DCHA 1VGLA 3GX8A 1FG4A 13GSA 2YOIA 9GSSA 5EPFA 1M2BA 1I9DA 4HU9A 3RHBA 3RPNA 3KP8A 2MMNA 2RUEA 2VL2C 3DD3A 3QD9A 3ZTLA 3QFAC 3N9JA 3KM6A 4KE3A 2KOKA 2B5YA 1ZYEA 2GTUA 3GSTA 3TOTA 3QOUA 2H6XA 3VI5A 1SK2A 3FKFA 1QMVA 1EWXA 1K0OA 2CZ3A 1HNAA 5G5FA 1AQXA 2CVBA 4N30A 3C73A 3O76A 4KH7A 1Z6NA 4GLTA 3IR4A 2GSSA 3P8WA 1MD4A 5KN0A 1J9BA 3A2WA 4MJEA 4HZ4A 2MYGA 2L57A 2E2MA 4K1FA 1B4PA 2VLUA 4G19A 3IHQA 1SL2B 2V6KA 2H70A 1K0DA 2CVKA 2C0GA 5DALB 2X8CA 4GWRA 3KJYA 3APQA 2IFQA 3KH7A 1TK0B 4I97A 3MWHA 3TRQA 5CYYA 2C0DA 4TR1A 4IN0A 2IMKA 5CNWA 3UEMA 4AJ6A 1R5PA 3HXSA 1TDIA 4TOPA 3TKQA 3VWWA 2NPBA 4KGIA 2MZCA 1GSQA 3C1RA 3P2AA 4IJ3A 2H75A 2GZYA 2NBSA 1GWCA 2FUG2 5ECRB 1XWBA 1JLWA 5G2ZA 4WBRD 3TRXA 3MNGA 5DCGA 1ZL9A 1JFUA 5D9VA 1A8LA 3ZREA 3QR6A 3ZLPA 4KDYA 4TXVA 2HE3A 2VAFA 5D93A 2DBCA 2AYTA 1OC8A 3WGXA 4MA9A 3QAVA 1B9XC 3IK7A 4D73B 1F2EA 5DBQA 5F06A 2MBTA 2CAQA 4KW6A 5HFIA 2B3SA 3F4RA 3UARA 2PPTA 1XVWA 4I2TA 2DKIA 3HJPA 3IRAA 4F0BA 1VRSD 2PUKC 1JZOA 5CP1A 3EYTA 1XFLA 2KP1A 4N0ZA 1EGRA 5B6NA 5CRGA 2R0GA 2HI7A 4N11A 1GTIA 1DE2A 2HSMA 3W8JA 4ID0A 1G6WA 1F3AA 4OCEA 3L9SA 1BG5A 1ERVA 4GXZA 5J41A 1FHEA 1MDJA 3ED3A 5EY6A 3HVNA 4K5SA 1SJ6A 3F63A 4MCUA 5C00A 3ZYWA 2XC2A 1XZOA 3D22A 4KSMA 2LQQA 4MLYA 3F4SA 4DEJA 2PU9C 2I3YA 3J7Yk 3TJKA 2KUCA 4N10A 1YF0A 1W4VA 4GTUA 3I43A 3GX0A 4G10A 2PGTA 3LJRA 1XOAA 3N5OA 5ECHB 2WULA 2H6YA 3ISOA 3KXOA 1GSEA 4LMVA 4ZB9A 4ZL9A 3F6DA 1K0NA 3FW2A 1GSFA 1GTUA 5AGYA 2WS2A 1XCCA 5ENUA 2HXKA 3M1GA 1TRSA 2H66A 2ZCTA 5A4WA 4K9ZA 4X0XA 2R0PA 4I5QA 5JWRB 2IMEA 4OCFA 3R3EA 4XCSA 4MK3A 4ZBAA 2E2GA 4XHMA 5AISA 5EVOA 1I5GA 5IO0A 1EV4A 4JBBA 1LJRA 3UVTA 4JRRA 2KLXA 1S3AA 1M2AA 3EC3A 1X5CA 1UN2A 3H4KA 3IDVA 2L5LA 3HA9A 5CAXA 2VOCA 5GSTA 2HZFA 1SKRB 3WT2A 1A0FA 3M9JA 2CAIA 4WR4A 4AGSA 2WZ9A 3JCML 4X43A 1B9YC 2I9HA 3HVXA 2H71A 2P5QA 3BCKA 4WKWA 1B8XA 3SWLA 2V6OA 5KN3A 2CV4A 4PQIA 5DAKA 2L6DA 4MJBA 2NVLA 3AY8A 3DIEA 3E0UA 5GAND 1Z9HA 4TXOA 3NOFA 3RBTA 4WF4A 2H01A 1Y6EA 3UIWA 2BMXA 2H1GA 1YKCA 4KSOA 1BAYA 2CX4A 4K0GA 2LQOA 2A2PA 3C71A 4EXJA 4J2FA 3A5WA 5JCUA 3GKMA 4MF7A 4QL7A 1GTAA 4ZBDA 2A4VA 2KP2A 1K0AA 1A2JA 5HR1A 3U6VA 1FW1A 1OVNA 3V1WA 4KCAA 3LWAA 3DMLA 1T4YA 1O7UA 2H6ZA 2LNTA 2H19A 5ECPB 2DC5A 3UOMA 4OWYA 4DSRA 4ZL8A 2JZTA 4LLRA 1Y25A 4BA7A 3HDCA 5B8AA 1ZOFA 1F9MA 3BOAA 2GZPA 4MZWA 4A5PA 2H1AA 4L0WA 4O7HA 5ELAA 4Q5NA 5IO2A 4XRAA 4WR5A 4JZQA 3WYWA 2R4VA 1NW2A 4TW5A 2RUFA 4O5UA 3R2QA 5FHIA 3D0ZA 1O85A 3ZZXA 2WDUA 2XBIA 2OKAA 3S9FA 3PGTA 3IXRA 2YNXA 3LGCA 1IYHA 2ON7A 12GSA 4JE1A 4NMUA 5D8IA 2EC4A 2FHEA 2F9SA 1EP8A 4GCIA 1S3CA 1GSUA 1WOUA 2V41A 2H72A 2FWEA 2FA4A 2H0HA 4MZCA 2YWOA 1O8WA 4ZB6A 4XS4A 5KN2A 5IM9A 5JWQB 5IIZA 4TN8A 2HZEB 2ZNMA 5ID2A 4YKGA 4XRDA 4Z7XA 2EIRA 3FR9A 3GL3A 4BL7B 1XBSA 2O7KA 3FR3A 1GUKA 1M0UA 2CA8A 1QQ2A 2J23A 3KH9A 2GSRA 1A2MA 2AAWA 2XPEA 2ES7A 1UA5A 2IIYA 3APSA 4EUYA 1W89A 4KA0A 1OC9B 2H73A 3TJFA 1QFNA 5E4WA 1FAAA 3Q74A 1WRYA 5LCZA 3ME8A 3FK8A 3U5RE 1C72A 4MP4A 4EVMA 1DSBA 3DVXA 1TKDB 3BCIA 1EV9A 5H5RA 1O73A 4GF0A 4ZB8A 1BJXA 1HD2A 3TKSE 4ZIJA 3EWLA 3WT1A 4QL9A 4G2EA 1MDIA 3TOUA 5B6MA 1H75A 1K0BA 2DJJA 4PNGA 1YKAA 4EKZA 1LU4A 4IHUA 1ZYNA 2HSYA 1ILOA 4J56E 1PX6A 2B7JA 3TB2A 2JSYA 1WPIA 3UL3A 3LORA 3EPTA 1RW1A 3FZ5A 5IOWA 1E2YA 2VCXA 4H86A 1XWKA 2VL2A 2H1DA 1SL0B 4POKA 2MBSA 6GSUA 2CX3A 4XS6A 3D6IA 2G2QA 2YP6A 1R4WA 3EINA 2F8AA 1ZMAA 2YJHA 1WP0A 3UVHA 1V57A 1TRVA 3GYKA 3KP9A 1CQGA 2I1UA 5DALA 2K18A 1PD21 5EL8A 2O87A 3F4TA 2PVQA 3MAKA 3GHAA 2AJQB 4ECIA 1T8EB 3LXTA 1KNGA 4JR6A 3VURA 4IP6A 1S3DA 1V40A 4K2XA 1A23A 1KEBA 5ECIB 5D73A 3IK9A 1TP9A 2DJ0A 3DXBA 3O3TA 3LEFA 3L9UA 4G0LA 1A0RP 1Q98A 2YN1A 2PMTA 3TKSA 3M0FA 5ECSA 2YWIA 5J3RA 1VF1A 2X99A 4IBPA 4HI7A 1BYEA 2R5GA 4USSA 4BIKA 1TK5B 3TKRA 2YJ7A 4Q5RA 4IVFA 2LV3A 1WMJA 2H8LA 3IC4A 4WEYA 5COHA 1XWAA 4D73A 4IS0A 1YJ6A 4Q5QA 2A2SA 1ZYPA 4MNNA 2FLSA 3FZ9A 1YEPA 1G6YA 1MDKA 2H30A 2YWNA 3IPZA 3RPPA 1FB6A 1GSSA 3QAGA 2DIZA 1ZCPA 4ISDA 5H5SA 3K8NA 3CMIA 1FOHA 5INYA 3GTUB 4NAXA 2IN3A 2DKHA 2YPMA 4K7IA 1TW9A 2C3TA 2GS3A 3EVIA 6GSSA 2WFCA 4OFTA 4WF5A 3RAZA 3D21A 3A2VA 2GT5A 1U88A 4ZL7A 1IYIA 4PQHA 3ZITA 1TI1A 5D9WA 3ZIVA 2DJ3A 3EURA 4O5QA 5FWGA 2OACA 1KTEA 1ACVA 1OAZA 3HVSA 8GSSA 5FT3A 1PGTA 2IPAA 2GVPA 2CT6A 1SU9A 2K8SA 4KX4A 10GSA 4JU5A 4HU7A 3I69A 2C8UA 3GKXA 2VCTA 3QPMA 1T4ZA 2V32A 1R7HA 4FO5A 2VM1A 3ZVJD 1AUCA 3F6FA 1YZXA 1BEDA 4IQ1A 1EOGA 4L5LA 6GSXA 4EDZA 4KAEA 5ECQB 3VK9A 4JEDA 5ECKB 2QGVA 3HJMA 4MZBA 5IMAA 4AF2A 1QXHA 3TKPA 4YQMA 4L5OA 5IOXA 2DJ1A 3WGDA 2QA1A 4HEA2 3ZMKA 1MD3A 3IC8A 3GNJA 2IMFA 4YKFA 1F3BA 3VLNA 3HZ8A 2VCQA 3DEXA 4X1UA 4GRFA 2L5OA 2A4HA 2C3QA 4F9ZA 1M9AA 1T1VA 4HZ2A 2FA8A 3WD6A 5D96A 1SK1A 1PN0A 3O6TA 3HCZA 2P5RA 4LL1B 1FO5A 1AC1A 5GZZB 3VFIA 2YV9A 2GQLA 3D4MA 4I6XA 4K7OA 3HYPA 1PL2A 3QCPA 3TCOA 2IJYA 1PSQA 1SKSB 5C04A 1XXUA 2OA7A 3IV4A 2LEGA 1GULA 2C0FA 2PVOC 3F8UA 2K6VA 1PKZA 5J9BA 1URMA 2MMAA 3GRXA 2K9FA 1THXA 4V2LA 1MEKA 4HOJA 3L0HA 2B1KA 5L71A 1NHOA 4POMA 2LJKA 3CRTA 4TR0A 4IQAA 2HNLA 2PN8A 4MPFA 1FVKA 1VF3A 2DMMA 3EU4A 6GSTA 3HD5A 1GP1A 3PINA 1FOVA 11GSA 3TDGA 2FGXA 3H1NA 3E9JB 1M3IA 5DDLA 1Z6MA 1PKWA 3GH6A 2IWTA 2O85A 3P90A 1SD8A 1GSDA 1Q4JA 3ERGA 4PURA 1WE0A 3CXGA 1V98A 3D5JA 4FYUA 17GSA 2M72A 1XW6A 5GAPD 4I2UA 2X64A 1A24A 4RI7A 2C3NA 3DKSA 2L4QA 1GSYA 3WGEA 3ME7A 1U87A 3GKKA 4ECJA 1N2AA 1YF1A 1X0RA 1HNCA 2H0GA 2GSQA 4GSTA 4HUAA 2R2JA 2JACA 5AIXA 5G5EA 1TJDA 4E8EA 1UVZA 3KTBA 5ECLB 3I6AA 3KEBA 3LW9A 4MJAA 4BVXB 4FYBA 2QSIA 1O6JA 2YZHA 2HZEA 3HY2A 1X9SB 4BL7A 2IMIA 3CSIA 1O8XA 5LNKe 4MPGA 3VPTA 4EF0A 5DQSA 1OE7A 4TXOB 3ZL5A 4RQRA 2HYXA 2OE0A 1Z5YE 2O8VB 3KMNA 5H5QA 2TRCP 2RIIA 3IA1A 1PA3A 3ERFA 4EIQA 3ZFBA 1OC9A 4PTSA 5KEJA 4YH2A 1SYRA 3L78A 3PH9A 1XWCA 2DJKA 1PFOA 2HRNA 2UZ8A 1HNBA 3C7MA 4Z2TA 2F3MA 3FZ4A 2AV4A 1K3YA 5JCGA 2HLSA 4TKYA 4TRXA 2JZSA 2LSTA 2V2GA 1TI3A 3FYGA 4GQFA 2REMA 4L0UA 3GKNA 3Q6OA 5BRTA 1M9BA 2YANA 4OMVA 4MJCA 3F3RA 1EOHA 2OBKA 5DJLA 3C1SA 4MF6A 2H76A 5G30A 1SK0A 3TRPA 3CBUA 3GV1A 4KDXA 2LJRA 3TJJA 2AUVA 2K8VA 3PR8A 2P31A 3SBCA 3LG6A 5A4VA 3TGZA 1GNEA 4G9HA 2N5AA 4DSSB 4F82A 4FQUA 1G7OA 2KHPA 1ZYQB 1TU7A 2LRCA 2DSAA 3KTLA 16GSA 1VF2A 3Q18A 5D9TA 2JU5A 2H74A 2VL3A 4ZILA 2N5FA 3I9V2 1QUWA 3KCMA 4MABA 4V2MA 2XPDA 4ULXA 2YZUA 2GDRA 3IOSA 4NV2A 3LYKA 1EGOA 2C4JA 2E0QA 2EIOA 4O5RA 1EEMA 1YY7A 2HT9A 1X9MB 2VCWA 3M8NA 3DWVA 4YAVA 5F8BA 1SJIA 4WETA 1TU8A 4Z2RA 2QKEA 5HR3A 5E59A 3VWXA 4GQCA 5HR2A 3M3MA 2LTKA 5A4UA 1ML6A 1TOFA 1FVJA 4OFMA 5IMZA 1M3JA 3LYPA 1ERTA 1ABAA 1TXXA 1OC3A 3CSHA 1YEXA 2B5EA 3TJGA 5G31A 3MIXA 1DBYA 1XWGA 2OE1A 4HSCX 3VWVA 1GL8A 3IBHA 1EEJA 1ERWA 1X5EA 4BVYB 1WWJA 3MYDA 3QDNA 3LQ7A 2OJLA 2YV7A 3KMOA 5CRDA 3A3TA 3MDKA 2R0CA 3QMXA 4ECCA 2MMOA 4JR4A 1GTBA 19GSA 3HKRA 2M46A 3DYRA 1TTZA 2GT6A 2WB9A 1TRWA 4I8BA 3GTUA 3G7JA 1UC7A 1M99A 4QQ7A 4KDUA 1N8JA 2V1MA 4ILFA 5LD0A 3GH9A 5HR0A 2MMZA 4GSNA 1WJKA 5JCWA 1V58A 1O81A 1U6TA 4IJIA 2CQ9A 2M80A 4HJ2A 1B48A 2PBJA 5HFKA 2LKUA 2WJUA 3TKSC 1Z7RA 2XHFA 2OE3A 4ECBA 1XOBA 2DMLA 3FMWA 3KZQA 4XIHA 3EMXA 1JZWA 4HQSA 4KB3A 3IHGA 2BTOT 5G1LA 2R3XA 1R5AA 3MSZA 3GIXA 4WBJA 2OBIA 1A8YA 2YCDA 3US3A 1EP7A 1AXDA 1X5DA 3D4TA 1ZZYA 2ZUPA 4RQXA 2JL4A 1ERUA 5DJMA 5DQYA 1PMTA 1T7PB 3ZVJA 4DSQA 3VPQA 2LRNA 1JZRA 3FEUA 4DVCA 3GFKA 1HQOA 1V2AA 2VD1A 1NHYA 4KUNA 1G0TA 3HHVA 14GSA 4Q5FA 4HS1A 5JWOB 2NDOA 5KOWA 20GSA 4WXTA 4XS1A 3CQFA 5IPHA 4K6XA 4ICYA 3KD0A 2X4AA 3QFBC 1A2LA 1E6BA 3UMAA 5ABRA 4NHZA 3LSZA 1AAZA 2AB6A 4PX1A 1JLVA 3ZMLA 3QAWA 5CREA 2GQMA 1PRXA 4TR3A 4AJ8A 2FD3A 2NTOA 2LRTA 3G9BA 3A2XA 4BWQA 4ACSA 1X9WB 4PNFA 1YQ1A 4RI6A 3G7YA 2IFQB 3FR6A 4IKHA 3UBLA 1XW9A 4TR1B 4MH2A 5KOXA 3GMFA 4IP1A 2I81A 4G0IA 4F2IA 1T3BA 1YDKA 2LJAA 4CDOA 5GSSA 4CW9A 4BPYA 2XBQA 3RDWA 2CVDA 1OKDA 4MF5A 4MH3A 5HFGA 1FB0A 1TK8B 1JZDA 1TRUA 2GSTA 4EE0A 3EMPA 4OFNA 4YQUA 2RLIA 3CYNA 4P3YB 3IAM2 2FWHA 2IL3A 5J5NA 2WRTA 3ZFLA 1EZKA 3P7XA 1XVQA 2RM6A 1RQMA 3FHKA 2VD0A 1OYJA 3ERWA 2FCHA 4PXOA 4RUVA 2C80A 4LMWA 5B7CA 3DVWA 2EIQA 4PGTA 1J08A 2JADA 2O89A 4V1Ap 2X8GA 3HVVA 1PQNA 1QK8A 1OKTA 3IAS2 5IMDA 4IGJA 5A5KA 4EL1A 1PX7A 2N5BA 5AIVA 2DIYA 1NSWA 1SYXA 2A2RA 3H93A 4YAPA 2LNSA 1MTCA 4EO3A 1DUGA 1R26A 1AQVA 2F51A 1RK4A 4K0NA 2LS5A 3CTGA 1HYUA 2LUSA 1THOA 5ECOB 2PERA 2L59A 1M7TA 4NXIA 2D2ZA 4PUFC 4OD7A 2H0IA 3VWUA 4HJMA 2GZZA 2VIMA 4LA1A 1AQWA 2DLXA 3W8SA 2QC7A 5CRHA 3ZRDA 2FY6A 3L9VA 3KGKA 4LL4B 5CO3A 3LFLA 18GSA 2H1BA 4POBA 3J7Yb 1AIUA 4NV5A 3HJOA 2C0EA 4ZBBA 1K3OA 1KBNA 2TIRA 2L6CA 2VL9A 4BVXA 4PUAA 5F07A 1SL1B 4ML6A 1OE8A 1PN9A 5ECNB 4X4JA 2G0FA
chains in the Genus database with same CATH topology
3UBKA 2WGRA 4NWYA 3OR5A 3FRCA 3FY7A 1USBA 5IMFA 1WIKA 2ALBA 3BJ5A 2B1LA 2GQKA 4MMMA 5KN1A 1ON4A 2AHEA 4NPBA 3UJ1A 2FWGA 2F8FA 4V1Ag 2HRAA 3G7IA 2HSHA 2I4AA 1GLPA 3IE3A 3E3EA 3CTFA 1B4QA 2WCIA 2VO4A 1SJZA 1V9WA 3NIVA 4FYCA 4YQVA 1GNWA 2X8HA 4IW9A 2JZRA 3GL5A 1GH2A 4PQ1A 4ML1A 3F3QA 1M2DA 3EU3A 1GUHA 2RM5A 4EDYA 1GUMA 2HRKA 3BBYA 4XTSA 4EC0A 3ZIJA 4FIWA 4KF9A 1AW9A 4GSSA 4EIPA 4HQZA 3GSSA 6GSYA 3L4NA 2JSZA 2VLVA 1T00A 3TJBA 4OO4A 2Z9SA 5DAKB 5D9XA 1QGVA 5IQYA 5J9CA 1SENA 2YWMA 2FNOA 4L8EA 1VF4A 6GSWA 3F9UA 3DRNA 2FWFA 5BMUA 2GGTA 2CZ2A 2R37A 3C8EA 3EE2A 4F0CA 1XPVA 4DSSA 2C1YA 4TVEA 1H4OA 3CRUA 3RHCA 5B8BA 3GUSA 3VI7A 5F0GA 4Z2UA 5F05A 1K0MA 1XW5A 4F03A 1SKWB 1ZGNA 3KIJA 2PWJA 1XIYA 2X49A 4HDEA 3HZ4A 3M9KA 4TR4A 5ELGA 3GURA 6GSVA 3GN3A 3APOA 3H79A 2L4CA 3W6GA 3CSJA 2B7KA 1ST9A 4NHWA 1CQHA 3Q19A 1SD9A 3TUEA 2B6MA 2R6KA 4O32A 1LBKA 1J0FA 7GSSA 2QA2A 4CHSA 5IMCA 2BJXA 1Z7PA 1F6MC 1BQ7A 4K8MA 4POLA 3NZNA 2B5XA 4CY8A 4KCEA 22GSA 1G7EA 1K0CA 2J9HA 1U3AA 3PPUA 1PL1A 4E8HA 1U3IA 4K2DA 3H8QA 2HRFA 5DVBA 3FZAA 4J57E 4N0VA 2VCZA 4AJ7A 4BVYA 4CY6A 5HQPA 4K5RA 1K3LA 4O92A 1BX9A 2P0GA 2VLTA 4ZXGA 1DE1A 4FH8A 5AN1A 5IPGA 4KNDA 2OADA 1JHBA 4G0KA 4MDCA 3UAPA 3LXZA 2TRXA 2VM2A 5J4UA 3GA4A 2E7PA 4BWSA 1GLQA 1Z3EA 2DJ2A 4XS4B 4V2NA 5ECMB 4IELA 4K7NA 3A5IA 5CRWA 3BD2A 2GLRA 5ID2B 1GRXA 5G1KA 1NM3A 3DGQA 4OO5A 2VUPA 2VCVA 2IMDA 2ON5A 5IMVA 2HFDA 3F0IA 1F37A 5DCHA 1VGLA 3GX8A 1FG4A 13GSA 2YOIA 9GSSA 5EPFA 1M2BA 1I9DA 4HU9A 3RHBA 3RPNA 3KP8A 2MMNA 2RUEA 2VL2C 3DD3A 3QD9A 3ZTLA 3QFAC 3N9JA 3KM6A 4KE3A 2KOKA 2B5YA 1ZYEA 2GTUA 3GSTA 3TOTA 3QOUA 2H6XA 3VI5A 1SK2A 3FKFA 1QMVA 1EWXA 1K0OA 2CZ3A 1HNAA 5G5FA 1AQXA 2CVBA 4N30A 3C73A 3O76A 4KH7A 1Z6NA 4GLTA 3IR4A 2GSSA 3P8WA 1MD4A 5KN0A 1J9BA 3A2WA 4MJEA 4HZ4A 2MYGA 2L57A 2E2MA 4K1FA 1B4PA 2VLUA 4G19A 3IHQA 1SL2B 2V6KA 2H70A 1K0DA 2CVKA 2C0GA 5DALB 2X8CA 4GWRA 3KJYA 3APQA 2IFQA 3KH7A 1TK0B 4I97A 3MWHA 3TRQA 5CYYA 2C0DA 4TR1A 4IN0A 2IMKA 5CNWA 3UEMA 4AJ6A 1R5PA 3HXSA 1TDIA 4TOPA 3TKQA 3VWWA 2NPBA 4KGIA 2MZCA 1GSQA 3C1RA 3P2AA 4IJ3A 2H75A 2GZYA 2NBSA 1GWCA 2FUG2 5ECRB 1XWBA 1JLWA 5G2ZA 4WBRD 3TRXA 3MNGA 5DCGA 1ZL9A 1JFUA 5D9VA 1A8LA 3ZREA 3QR6A 3ZLPA 4KDYA 4TXVA 2HE3A 2VAFA 5D93A 2DBCA 2AYTA 1OC8A 3WGXA 4MA9A 3QAVA 1B9XC 3IK7A 4D73B 1F2EA 5DBQA 5F06A 2MBTA 2CAQA 4KW6A 5HFIA 2B3SA 3F4RA 3UARA 2PPTA 1XVWA 4I2TA 2DKIA 3HJPA 3IRAA 4F0BA 1VRSD 2PUKC 1JZOA 5CP1A 3EYTA 1XFLA 2KP1A 4N0ZA 1EGRA 5B6NA 5CRGA 2R0GA 2HI7A 4N11A 1GTIA 1DE2A 2HSMA 3W8JA 4ID0A 1G6WA 1F3AA 4OCEA 3L9SA 1BG5A 1ERVA 4GXZA 5J41A 1FHEA 1MDJA 3ED3A 5EY6A 4K5SA 1SJ6A 3F63A 4MCUA 5C00A 3ZYWA 2XC2A 1XZOA 3D22A 4KSMA 2LQQA 4MLYA 3F4SA 4DEJA 2PU9C 2I3YA 3J7Yk 3TJKA 2KUCA 4N10A 1YF0A 1W4VA 4GTUA 3I43A 3GX0A 4G10A 2PGTA 3LJRA 1XOAA 3N5OA 5ECHB 2WULA 2H6YA 3ISOA 3KXOA 1GSEA 4LMVA 4ZB9A 4ZL9A 3F6DA 1K0NA 3FW2A 1GSFA 1GTUA 5AGYA 2WS2A 1XCCA 5ENUA 2HXKA 3M1GA 1TRSA 2H66A 2ZCTA 5A4WA 4K9ZA 4X0XA 2R0PA 4I5QA 5JWRB 2IMEA 4OCFA 3R3EA 4XCSA 4MK3A 4ZBAA 2E2GA 4XHMA 5AISA 5EVOA 1I5GA 5IO0A 1EV4A 4JBBA 1LJRA 3UVTA 4JRRA 2KLXA 1S3AA 1M2AA 3EC3A 1X5CA 1UN2A 3H4KA 3IDVA 2L5LA 3HA9A 5CAXA 2VOCA 5GSTA 2HZFA 1SKRB 3WT2A 1A0FA 3M9JA 2CAIA 4WR4A 4AGSA 2WZ9A 3JCML 4X43A 1B9YC 2I9HA 3HVXA 2H71A 2P5QA 3BCKA 4WKWA 1B8XA 3SWLA 2V6OA 5KN3A 2CV4A 4PQIA 5DAKA 2L6DA 4MJBA 2NVLA 3AY8A 3DIEA 3E0UA 5GAND 1Z9HA 4TXOA 3NOFA 3RBTA 4WF4A 2H01A 1Y6EA 3UIWA 2BMXA 2H1GA 1YKCA 4KSOA 1BAYA 2CX4A 4K0GA 2LQOA 2A2PA 3C71A 4EXJA 4J2FA 3A5WA 5JCUA 3GKMA 4MF7A 4QL7A 1GTAA 4ZBDA 2A4VA 2KP2A 1K0AA 1A2JA 5HR1A 3U6VA 1FW1A 1OVNA 3V1WA 4KCAA 3LWAA 3DMLA 1T4YA 1O7UA 2H6ZA 2LNTA 2H19A 5ECPB 2DC5A 3UOMA 4OWYA 4DSRA 4ZL8A 2JZTA 4LLRA 1Y25A 4BA7A 3HDCA 5B8AA 1ZOFA 1F9MA 3BOAA 2GZPA 4MZWA 4A5PA 2H1AA 4L0WA 4O7HA 5ELAA 4Q5NA 5IO2A 4XRAA 4WR5A 4JZQA 3WYWA 2R4VA 1NW2A 4TW5A 2RUFA 4O5UA 3R2QA 5FHIA 3D0ZA 1O85A 3ZZXA 2WDUA 2XBIA 2OKAA 3S9FA 3PGTA 3IXRA 2YNXA 3LGCA 1IYHA 2ON7A 12GSA 4JE1A 4NMUA 5D8IA 2EC4A 2FHEA 2F9SA 1EP8A 4GCIA 1S3CA 1GSUA 1WOUA 2V41A 2H72A 2FWEA 2FA4A 2H0HA 4MZCA 2YWOA 1O8WA 4ZB6A 4XS4A 5KN2A 5IM9A 5JWQB 5IIZA 4TN8A 2HZEB 2ZNMA 5ID2A 4YKGA 4XRDA 4Z7XA 2EIRA 3FR9A 3GL3A 4BL7B 1XBSA 2O7KA 3FR3A 1GUKA 1M0UA 2CA8A 1QQ2A 2J23A 3KH9A 2GSRA 1A2MA 2AAWA 2XPEA 2ES7A 1UA5A 2IIYA 3APSA 4EUYA 1W89A 4KA0A 1OC9B 2H73A 3TJFA 1QFNA 5E4WA 1FAAA 3Q74A 1WRYA 5LCZA 3ME8A 3FK8A 3U5RE 1C72A 4MP4A 4EVMA 1DSBA 3DVXA 1TKDB 3BCIA 1EV9A 5H5RA 1O73A 4GF0A 4ZB8A 1BJXA 1HD2A 3TKSE 4ZIJA 3EWLA 3WT1A 4QL9A 4G2EA 1MDIA 3TOUA 5B6MA 1H75A 1K0BA 2DJJA 4PNGA 1YKAA 4EKZA 1LU4A 4IHUA 1ZYNA 2HSYA 1ILOA 4J56E 1PX6A 2B7JA 3TB2A 2JSYA 1WPIA 3UL3A 3LORA 3EPTA 1RW1A 3FZ5A 5IOWA 1E2YA 2VCXA 4H86A 1XWKA 2VL2A 2H1DA 1SL0B 4POKA 2MBSA 6GSUA 2CX3A 4XS6A 3D6IA 2G2QA 2YP6A 1R4WA 3EINA 2F8AA 1ZMAA 2YJHA 1WP0A 3UVHA 1V57A 1TRVA 3GYKA 3KP9A 1CQGA 2I1UA 5DALA 2K18A 1PD21 5EL8A 2O87A 3F4TA 2PVQA 3MAKA 3GHAA 2AJQB 4ECIA 1T8EB 3LXTA 1KNGA 4JR6A 3VURA 4IP6A 1S3DA 1V40A 4K2XA 1A23A 1KEBA 5ECIB 5D73A 3IK9A 1TP9A 2DJ0A 3DXBA 3O3TA 3LEFA 3L9UA 4G0LA 1A0RP 1Q98A 2YN1A 2PMTA 3TKSA 3M0FA 5ECSA 2YWIA 5J3RA 1VF1A 2X99A 4IBPA 4HI7A 1BYEA 2R5GA 4USSA 1TK5B 3TKRA 2YJ7A 4Q5RA 4IVFA 2LV3A 1WMJA 2H8LA 3IC4A 4WEYA 5COHA 1XWAA 4D73A 4IS0A 1YJ6A 4Q5QA 2A2SA 1ZYPA 4MNNA 2FLSA 3FZ9A 1YEPA 1G6YA 1MDKA 2H30A 2YWNA 3IPZA 3RPPA 1FB6A 1GSSA 3QAGA 2DIZA 1ZCPA 4ISDA 5H5SA 3K8NA 3CMIA 1FOHA 5INYA 3GTUB 4NAXA 2IN3A 2DKHA 2YPMA 4K7IA 1TW9A 2C3TA 2GS3A 3EVIA 6GSSA 2WFCA 4OFTA 4WF5A 3RAZA 3D21A 3A2VA 2GT5A 1U88A 4ZL7A 1IYIA 4PQHA 3ZITA 1TI1A 5D9WA 3ZIVA 2DJ3A 3EURA 4O5QA 5FWGA 2OACA 1KTEA 1ACVA 1OAZA 3HVSA 8GSSA 5FT3A 1PGTA 2IPAA 2GVPA 2CT6A 1SU9A 2K8SA 4KX4A 10GSA 4JU5A 4HU7A 3I69A 2C8UA 3GKXA 2VCTA 3QPMA 1T4ZA 2V32A 1R7HA 4FO5A 2VM1A 3ZVJD 1AUCA 3F6FA 1YZXA 1BEDA 4IQ1A 1EOGA 4L5LA 6GSXA 4EDZA 4KAEA 5ECQB 3VK9A 4JEDA 5ECKB 2QGVA 3HJMA 4MZBA 5IMAA 4AF2A 1QXHA 3TKPA 4YQMA 4L5OA 5IOXA 2DJ1A 3WGDA 2QA1A 4HEA2 3ZMKA 1MD3A 3IC8A 3GNJA 2IMFA 4YKFA 1F3BA 3VLNA 3HZ8A 2VCQA 3DEXA 4X1UA 4GRFA 2L5OA 2A4HA 2C3QA 4F9ZA 1M9AA 1T1VA 4HZ2A 2FA8A 3WD6A 5D96A 1SK1A 1PN0A 3O6TA 3HCZA 2P5RA 4LL1B 1FO5A 1AC1A 5GZZB 3VFIA 2YV9A 2GQLA 3D4MA 4I6XA 4K7OA 3HYPA 1PL2A 3QCPA 3TCOA 2IJYA 1PSQA 1SKSB 5C04A 1XXUA 2OA7A 3IV4A 2LEGA 1GULA 2C0FA 2PVOC 3F8UA 2K6VA 1PKZA 5J9BA 1URMA 2MMAA 3GRXA 2K9FA 1THXA 4V2LA 1MEKA 4HOJA 3L0HA 2B1KA 5L71A 1NHOA 4POMA 2LJKA 3CRTA 4TR0A 4IQAA 2HNLA 2PN8A 4MPFA 1FVKA 1VF3A 2DMMA 3EU4A 6GSTA 3HD5A 1GP1A 3PINA 1FOVA 11GSA 3TDGA 2FGXA 3H1NA 3E9JB 5DDLA 1Z6MA 1PKWA 3GH6A 2IWTA 2O85A 3P90A 1SD8A 1GSDA 1Q4JA 3ERGA 4PURA 1WE0A 3CXGA 1V98A 3D5JA 4FYUA 17GSA 2M72A 1XW6A 5GAPD 4I2UA 2X64A 1A24A 4RI7A 2C3NA 3DKSA 2L4QA 1GSYA 3WGEA 3ME7A 1U87A 3GKKA 4ECJA 1N2AA 1YF1A 1X0RA 1HNCA 2H0GA 2GSQA 4GSTA 4HUAA 2R2JA 2JACA 5AIXA 5G5EA 1TJDA 4E8EA 1UVZA 3KTBA 5ECLB 3I6AA 3KEBA 3LW9A 4MJAA 4BVXB 4FYBA 2QSIA 1O6JA 2YZHA 2HZEA 3HY2A 1X9SB 4BL7A 2IMIA 3CSIA 1O8XA 5LNKe 4MPGA 3VPTA 4EF0A 5DQSA 1OE7A 4TXOB 3ZL5A 4RQRA 2HYXA 2OE0A 1Z5YE 2O8VB 3KMNA 5H5QA 2TRCP 2RIIA 3IA1A 1PA3A 3ERFA 4EIQA 3ZFBA 1OC9A 4PTSA 5KEJA 4YH2A 1SYRA 3L78A 1XWCA 3PH9A 2DJKA 2HRNA 2UZ8A 1HNBA 3C7MA 4Z2TA 2F3MA 3FZ4A 2AV4A 1K3YA 5JCGA 2HLSA 4TKYA 4TRXA 2JZSA 2LSTA 2V2GA 1TI3A 3FYGA 4GQFA 2REMA 4L0UA 3GKNA 3Q6OA 5BRTA 1M9BA 2YANA 4OMVA 4MJCA 3F3RA 1EOHA 2OBKA 5DJLA 3C1SA 4MF6A 2H76A 5G30A 1SK0A 3TRPA 3CBUA 3GV1A 4KDXA 2LJRA 3TJJA 2AUVA 2K8VA 3PR8A 2P31A 3SBCA 3LG6A 5A4VA 3TGZA 1GNEA 4G9HA 2N5AA 4DSSB 4F82A 4FQUA 1G7OA 2KHPA 1ZYQB 1TU7A 2LRCA 2DSAA 3KTLA 16GSA 1VF2A 3Q18A 5D9TA 2JU5A 2H74A 2VL3A 4ZILA 2N5FA 3I9V2 1QUWA 3KCMA 4MABA 4V2MA 2XPDA 4ULXA 2YZUA 2GDRA 3IOSA 4NV2A 3LYKA 1EGOA 2C4JA 2E0QA 2EIOA 4O5RA 1EEMA 1YY7A 2HT9A 1X9MB 2VCWA 3M8NA 3DWVA 4YAVA 5F8BA 1SJIA 4WETA 1TU8A 4Z2RA 2QKEA 5HR3A 5E59A 3VWXA 4GQCA 5HR2A 3M3MA 2LTKA 5A4UA 1ML6A 1TOFA 1FVJA 4OFMA 5IMZA 3LYPA 1ERTA 1ABAA 1TXXA 1OC3A 3CSHA 1YEXA 2B5EA 3TJGA 5G31A 3MIXA 1DBYA 1XWGA 2OE1A 3VWVA 1GL8A 3IBHA 1EEJA 1ERWA 1X5EA 4BVYB 1WWJA 3MYDA 3QDNA 3LQ7A 2OJLA 2YV7A 3KMOA 5CRDA 3A3TA 3MDKA 2R0CA 3QMXA 4ECCA 2MMOA 4JR4A 1GTBA 19GSA 3HKRA 2M46A 3DYRA 1TTZA 2GT6A 2WB9A 1TRWA 4I8BA 3GTUA 3G7JA 1UC7A 1M99A 4QQ7A 4KDUA 1N8JA 2V1MA 4ILFA 5LD0A 3GH9A 5HR0A 2MMZA 4GSNA 1WJKA 5JCWA 1V58A 1O81A 1U6TA 4IJIA 2CQ9A 2M80A 4HJ2A 1B48A 2PBJA 5HFKA 2LKUA 2WJUA 3TKSC 1Z7RA 2XHFA 2OE3A 4ECBA 1XOBA 2DMLA 3FMWA 3KZQA 4XIHA 3EMXA 1JZWA 4HQSA 4KB3A 3IHGA 2BTOT 5G1LA 2R3XA 1R5AA 3MSZA 3GIXA 4WBJA 2OBIA 1A8YA 2YCDA 3US3A 1EP7A 1AXDA 1X5DA 3D4TA 1ZZYA 2ZUPA 4RQXA 2JL4A 1ERUA 5DJMA 5DQYA 1PMTA 1T7PB 3ZVJA 4DSQA 3VPQA 2LRNA 1JZRA 3FEUA 4DVCA 3GFKA 1HQOA 1V2AA 2VD1A 1NHYA 4KUNA 1G0TA 3HHVA 14GSA 4Q5FA 4HS1A 5JWOB 2NDOA 5KOWA 20GSA 4WXTA 4XS1A 5IPHA 4K6XA 4ICYA 3KD0A 2X4AA 3QFBC 1A2LA 1E6BA 3UMAA 5ABRA 4NHZA 3LSZA 1AAZA 2AB6A 4PX1A 1JLVA 3ZMLA 3QAWA 5CREA 2GQMA 1PRXA 4TR3A 4AJ8A 2FD3A 2NTOA 2LRTA 3G9BA 3A2XA 4BWQA 4ACSA 1X9WB 4PNFA 1YQ1A 4RI6A 3G7YA 2IFQB 3FR6A 4IKHA 3UBLA 1XW9A 4TR1B 4MH2A 5KOXA 3GMFA 4IP1A 2I81A 4G0IA 4F2IA 1T3BA 1YDKA 2LJAA 4CDOA 5GSSA 4CW9A 4BPYA 2XBQA 3RDWA 2CVDA 1OKDA 4MF5A 4MH3A 5HFGA 1FB0A 1TK8B 1JZDA 1TRUA 2GSTA 4EE0A 3EMPA 4OFNA 4YQUA 2RLIA 3CYNA 4P3YB 3IAM2 2FWHA 2IL3A 5J5NA 2WRTA 3ZFLA 1EZKA 3P7XA 1XVQA 2RM6A 1RQMA 3FHKA 2VD0A 1OYJA 3ERWA 2FCHA 4PXOA 4RUVA 2C80A 4LMWA 5B7CA 3DVWA 2EIQA 4PGTA 1J08A 2JADA 2O89A 4V1Ap 2X8GA 3HVVA 1PQNA 1QK8A 1OKTA 3IAS2 5IMDA 4IGJA 5A5KA 4EL1A 1PX7A 2N5BA 5AIVA 2DIYA 1NSWA 1SYXA 2A2RA 3H93A 4YAPA 2LNSA 1MTCA 4EO3A 1DUGA 1R26A 1AQVA 2F51A 1RK4A 4K0NA 2LS5A 3CTGA 1HYUA 2LUSA 1THOA 5ECOB 2PERA 2L59A 1M7TA 4NXIA 2D2ZA 4PUFC 4OD7A 2H0IA 3VWUA 4HJMA 2GZZA 2VIMA 4LA1A 1AQWA 2DLXA 3W8SA 2QC7A 5CRHA 3ZRDA 2FY6A 3L9VA 3KGKA 4LL4B 5CO3A 3LFLA 18GSA 2H1BA 4POBA 3J7Yb 1AIUA 4NV5A 3HJOA 2C0EA 4ZBBA 1K3OA 1KBNA 2TIRA 2L6CA 2VL9A 4BVXA 4PUAA 5F07A 1SL1B 4ML6A 1OE8A 1PN9A 5ECNB 4X4JA 2G0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UBK A;  2WGR A;  4NWY A;  3OR5 A;  3FRC A;  3FY7 A;  1USB A;  5IMF A;  1WIK A;  2ALB A;  3BJ5 A;  2B1L A;  2GQK A;  4MMM A;  5KN1 A;  1ON4 A;  2AHE A;  4NPB A;  3UJ1 A;  2FWG A;  2F8F A;  4V1A g;  3G7I A;  2HSH A;  2I4A A;  1GLP A;  3IE3 A;  3E3E A;  3CTF A;  1B4Q A;  2WCI A;  2VO4 A;  1SJZ A;  1V9W A;  3NIV A;  4FYC A;  4YQV A;  1GNW A;  2X8H A;  4IW9 A;  2JZR A;  3GL5 A;  1GH2 A;  4PQ1 A;  4ML1 A;  3F3Q A;  1M2D A;  3EU3 A;  1GUH A;  2RM5 A;  4EDY A;  1GUM A;  3BBY A;  4XTS A;  4EC0 A;  3ZIJ A;  4FIW A;  1AW9 A;  4GSS A;  4HQZ A;  3GSS A;  6GSY A;  3L4N A;  2JSZ A;  2VLV A;  1T00 A;  3TJB A;  4OO4 A;  2Z9S A;  5DAK B;  5D9X A;  1QGV A;  5IQY A;  5J9C A;  1SEN A;  2YWM A;  2FNO A;  4L8E A;  1VF4 A;  6GSW A;  3F9U A;  3DRN A;  2FWF A;  2GGT A;  2CZ2 A;  2R37 A;  3C8E A;  3EE2 A;  4F0C A;  1XPV A;  4DSS A;  2C1Y A;  4TVE A;  1H4O A;  3CRU A;  3RHC A;  5B8B A;  3GUS A;  3VI7 A;  5F0G A;  5F05 A;  1K0M A;  1XW5 A;  4F03 A;  1SKW B;  1ZGN A;  2PWJ A;  1XIY A;  3KIJ A;  4HDE A;  3HZ4 A;  3M9K A;  4TR4 A;  5ELG A;  3GUR A;  6GSV A;  3GN3 A;  3APO A;  3H79 A;  2L4C A;  3W6G A;  3CSJ A;  2B7K A;  1ST9 A;  4NHW A;  1CQH A;  3Q19 A;  1SD9 A;  3TUE A;  2B6M A;  2R6K A;  4O32 A;  1LBK A;  1J0F A;  7GSS A;  4CHS A;  5IMC A;  2BJX A;  1Z7P A;  1F6M C;  1BQ7 A;  4K8M A;  4POL A;  3NZN A;  2B5X A;  4KCE A;  22GS A;  1G7E A;  1K0C A;  2J9H A;  1U3A A;  1PL1 A;  4E8H A;  1U3I A;  4K2D A;  3H8Q A;  2HRF A;  5DVB A;  3FZA A;  4J57 E;  4N0V A;  2VCZ A;  4AJ7 A;  4BVY A;  5HQP A;  1K3L A;  4O92 A;  1BX9 A;  2P0G A;  2VLT A;  4ZXG A;  1DE1 A;  4FH8 A;  5AN1 A;  5IPG A;  4KND A;  2OAD A;  1JHB A;  4MDC A;  3UAP A;  3LXZ A;  2TRX A;  2VM2 A;  5J4U A;  2E7P A;  3GA4 A;  4BWS A;  1GLQ A;  1Z3E A;  2DJ2 A;  4XS4 B;  4V2N A;  5ECM B;  4IEL A;  4K7N A;  5CRW A;  3BD2 A;  2GLR A;  5ID2 B;  1GRX A;  5G1K A;  1NM3 A;  3DGQ A;  4OO5 A;  2VUP A;  2VCV A;  2IMD A;  2ON5 A;  5IMV A;  2HFD A;  3F0I A;  1F37 A;  5DCH A;  1VGL A;  3GX8 A;  1FG4 A;  13GS A;  2YOI A;  9GSS A;  5EPF A;  1M2B A;  1I9D A;  4HU9 A;  3RHB A;  3RPN A;  3KP8 A;  2MMN A;  2RUE A;  2VL2 C;  3DD3 A;  3QD9 A;  3ZTL A;  3QFA C;  3N9J A;  3KM6 A;  4KE3 A;  2KOK A;  2B5Y A;  1ZYE A;  2GTU A;  3GST A;  3TOT A;  3QOU A;  2H6X A;  3VI5 A;  1SK2 A;  3FKF A;  1QMV A;  1EWX A;  1K0O A;  2CZ3 A;  1HNA A;  5G5F A;  1AQX A;  2CVB A;  4N30 A;  3C73 A;  3O76 A;  4KH7 A;  1Z6N A;  4GLT A;  3IR4 A;  2GSS A;  3P8W A;  1MD4 A;  5KN0 A;  1J9B A;  3A2W A;  4MJE A;  4HZ4 A;  2MYG A;  2L57 A;  2E2M A;  4K1F A;  1B4P A;  2VLU A;  4G19 A;  3IHQ A;  1SL2 B;  2V6K A;  2H70 A;  1K0D A;  2CVK A;  2C0G A;  5DAL B;  2X8C A;  4GWR A;  3KJY A;  3APQ A;  2IFQ A;  3KH7 A;  1TK0 B;  4I97 A;  3MWH A;  3TRQ A;  5CYY A;  2C0D A;  4TR1 A;  4IN0 A;  2IMK A;  5CNW A;  3UEM A;  4AJ6 A;  1R5P A;  3HXS A;  1TDI A;  4TOP A;  3TKQ A;  3VWW A;  2NPB A;  4KGI A;  2MZC A;  1GSQ A;  3C1R A;  3P2A A;  4IJ3 A;  2H75 A;  2GZY A;  2NBS A;  1GWC A;  2FUG 2;  5ECR B;  1XWB A;  1JLW A;  5G2Z A;  4WBR D;  3TRX A;  3MNG A;  5DCG A;  1ZL9 A;  1JFU A;  5D9V A;  1A8L A;  3ZRE A;  3QR6 A;  3ZLP A;  4KDY A;  4TXV A;  2HE3 A;  5D93 A;  2VAF A;  2DBC A;  2AYT A;  1OC8 A;  3WGX A;  4MA9 A;  3QAV A;  1B9X C;  3IK7 A;  4D73 B;  1F2E A;  5DBQ A;  5F06 A;  2MBT A;  2CAQ A;  4KW6 A;  5HFI A;  2B3S A;  3F4R A;  3UAR A;  2PPT A;  1XVW A;  4I2T A;  3HJP A;  3IRA A;  4F0B A;  1VRS D;  2PUK C;  1JZO A;  5CP1 A;  3EYT A;  1XFL A;  2KP1 A;  4N0Z A;  1EGR A;  5B6N A;  5CRG A;  2HI7 A;  4N11 A;  1GTI A;  1DE2 A;  3W8J A;  4ID0 A;  1G6W A;  1F3A A;  4OCE A;  3L9S A;  1BG5 A;  1ERV A;  4GXZ A;  5J41 A;  1FHE A;  1MDJ A;  3ED3 A;  5EY6 A;  1SJ6 A;  3F63 A;  4MCU A;  5C00 A;  3ZYW A;  2XC2 A;  1XZO A;  3D22 A;  4KSM A;  2LQQ A;  4MLY A;  3F4S A;  4DEJ A;  2PU9 C;  2I3Y A;  3J7Y k;  3TJK A;  2KUC A;  4N10 A;  1YF0 A;  1W4V A;  4GTU A;  3I43 A;  3GX0 A;  4G10 A;  2PGT A;  3LJR A;  1XOA A;  3N5O A;  5ECH B;  2WUL A;  2H6Y A;  3ISO A;  3KXO A;  1GSE A;  4LMV A;  4ZB9 A;  4ZL9 A;  3F6D A;  1K0N A;  3FW2 A;  1GSF A;  1GTU A;  5AGY A;  2WS2 A;  1XCC A;  5ENU A;  2HXK A;  3M1G A;  1TRS A;  2H66 A;  2ZCT A;  5A4W A;  4K9Z A;  4X0X A;  4I5Q A;  5JWR B;  2IME A;  4OCF A;  4XCS A;  4MK3 A;  4ZBA A;  2E2G A;  4XHM A;  5AIS A;  5EVO A;  1I5G A;  5IO0 A;  1EV4 A;  4JBB A;  1LJR A;  3UVT A;  4JRR A;  2KLX A;  1S3A A;  1M2A A;  3EC3 A;  1X5C A;  1UN2 A;  3H4K A;  3IDV A;  2L5L A;  3HA9 A;  5CAX A;  2VOC A;  5GST A;  2HZF A;  1SKR B;  3WT2 A;  1A0F A;  3M9J A;  2CAI A;  4WR4 A;  4AGS A;  2WZ9 A;  3JCM L;  4X43 A;  1B9Y C;  2I9H A;  3HVX A;  2H71 A;  2P5Q A;  3BCK A;  4WKW A;  1B8X A;  3SWL A;  2V6O A;  5KN3 A;  2CV4 A;  4PQI A;  5DAK A;  2L6D A;  4MJB A;  2NVL A;  3AY8 A;  3DIE A;  3E0U A;  5GAN D;  1Z9H A;  4TXO A;  3NOF A;  3RBT A;  4WF4 A;  2H01 A;  1Y6E A;  3UIW A;  2BMX A;  2H1G A;  1YKC A;  4KSO A;  1BAY A;  2CX4 A;  4K0G A;  2LQO A;  3C71 A;  4EXJ A;  4J2F A;  3A5W A;  5JCU A;  3GKM A;  4MF7 A;  4QL7 A;  1GTA A;  4ZBD A;  2A4V A;  2KP2 A;  1K0A A;  1A2J A;  5HR1 A;  3U6V A;  1FW1 A;  1OVN A;  3V1W A;  4KCA A;  3LWA A;  3DML A;  1T4Y A;  1O7U A;  2H6Z A;  2LNT A;  2H19 A;  5ECP B;  2DC5 A;  3UOM A;  4OWY A;  4DSR A;  4ZL8 A;  2JZT A;  4LLR A;  1Y25 A;  4BA7 A;  3HDC A;  5B8A A;  1ZOF A;  1F9M A;  3BOA A;  2GZP A;  4MZW A;  2H1A A;  4L0W A;  4O7H A;  5ELA A;  4Q5N A;  5IO2 A;  4XRA A;  4WR5 A;  4JZQ A;  3WYW A;  2R4V A;  1NW2 A;  4TW5 A;  2RUF A;  3R2Q A;  5FHI A;  3D0Z A;  1O85 A;  3ZZX A;  2WDU A;  2XBI A;  2OKA A;  3S9F A;  3PGT A;  3IXR A;  2YNX A;  3LGC A;  1IYH A;  2ON7 A;  12GS A;  4JE1 A;  4NMU A;  5D8I A;  2EC4 A;  2FHE A;  2F9S A;  1EP8 A;  4GCI A;  1S3C A;  1GSU A;  1WOU A;  2V41 A;  2H72 A;  2FWE A;  2FA4 A;  2H0H A;  4MZC A;  2YWO A;  1O8W A;  4ZB6 A;  4XS4 A;  5KN2 A;  5IM9 A;  5JWQ B;  5IIZ A;  4TN8 A;  2HZE B;  2ZNM A;  5ID2 A;  4XRD A;  4Z7X A;  2EIR A;  3FR9 A;  3GL3 A;  1XBS A;  2O7K A;  3FR3 A;  1GUK A;  1M0U A;  2CA8 A;  1QQ2 A;  2J23 A;  3KH9 A;  2GSR A;  1A2M A;  2AAW A;  2XPE A;  2ES7 A;  1UA5 A;  2IIY A;  3APS A;  4EUY A;  1W89 A;  4KA0 A;  1OC9 B;  2H73 A;  3TJF A;  1QFN A;  5E4W A;  1FAA A;  3Q74 A;  1WRY A;  5LCZ A;  3ME8 A;  3FK8 A;  3U5R E;  1C72 A;  4MP4 A;  4EVM A;  1DSB A;  3DVX A;  1TKD B;  3BCI A;  1EV9 A;  5H5R A;  1O73 A;  4GF0 A;  4ZB8 A;  1BJX A;  1HD2 A;  3TKS E;  4ZIJ A;  3EWL A;  3WT1 A;  4QL9 A;  4G2E A;  1MDI A;  3TOU A;  5B6M A;  1H75 A;  1K0B A;  2DJJ A;  4PNG A;  1YKA A;  4EKZ A;  1LU4 A;  4IHU A;  2HSY A;  1ILO A;  4J56 E;  1PX6 A;  2B7J A;  3TB2 A;  2JSY A;  1WPI A;  3UL3 A;  3LOR A;  1RW1 A;  3FZ5 A;  5IOW A;  1E2Y A;  2VCX A;  4H86 A;  1XWK A;  2VL2 A;  2H1D A;  1SL0 B;  4POK A;  2MBS A;  6GSU A;  2CX3 A;  4XS6 A;  3D6I A;  2G2Q A;  2YP6 A;  1R4W A;  3EIN A;  2F8A A;  1ZMA A;  2YJH A;  1WP0 A;  3UVH A;  1V57 A;  1TRV A;  3GYK A;  3KP9 A;  1CQG A;  2I1U A;  5DAL A;  2K18 A;  1PD2 1;  5EL8 A;  2O87 A;  3F4T A;  2PVQ A;  3MAK A;  3GHA A;  2AJQ B;  4ECI A;  1T8E B;  3LXT A;  1KNG A;  4JR6 A;  3VUR A;  4IP6 A;  1S3D A;  1V40 A;  1A23 A;  1KEB A;  5ECI B;  5D73 A;  3IK9 A;  1TP9 A;  2DJ0 A;  3DXB A;  3O3T A;  3LEF A;  3L9U A;  1A0R P;  1Q98 A;  2YN1 A;  2PMT A;  3TKS A;  3M0F A;  5ECS A;  2YWI A;  5J3R A;  1VF1 A;  2X99 A;  4IBP A;  4HI7 A;  1BYE A;  2R5G A;  1TK5 B;  3TKR A;  2YJ7 A;  4Q5R A;  4IVF A;  2LV3 A;  1WMJ A;  2H8L A;  3IC4 A;  4WEY A;  5COH A;  1XWA A;  4D73 A;  4IS0 A;  1YJ6 A;  4Q5Q A;  2A2S A;  2FLS A;  3FZ9 A;  1YEP A;  1G6Y A;  1MDK A;  2H30 A;  2YWN A;  3IPZ A;  3RPP A;  1FB6 A;  1GSS A;  3QAG A;  2DIZ A;  1ZCP A;  4ISD A;  5H5S A;  3K8N A;  3CMI A;  5INY A;  3GTU B;  4NAX A;  2IN3 A;  2YPM A;  4K7I A;  1TW9 A;  2C3T A;  2GS3 A;  3EVI A;  6GSS A;  2WFC A;  4OFT A;  4WF5 A;  3RAZ A;  3D21 A;  3A2V A;  2GT5 A;  1U88 A;  4ZL7 A;  1IYI A;  4PQH A;  3ZIT A;  1TI1 A;  5D9W A;  3ZIV A;  2DJ3 A;  3EUR A;  5FWG A;  2OAC A;  1KTE A;  1ACV A;  1OAZ A;  3HVS A;  8GSS A;  5FT3 A;  1PGT A;  2IPA A;  2GVP A;  2CT6 A;  1SU9 A;  2K8S A;  4KX4 A;  10GS A;  4JU5 A;  4HU7 A;  3I69 A;  2C8U A;  3GKX A;  2VCT A;  3QPM A;  1T4Z A;  2V32 A;  1R7H A;  4FO5 A;  2VM1 A;  3ZVJ D;  1AUC A;  3F6F A;  1YZX A;  1BED A;  4IQ1 A;  1EOG A;  4L5L A;  6GSX A;  4EDZ A;  4KAE A;  5ECQ B;  3VK9 A;  4JED A;  5ECK B;  2QGV A;  3HJM A;  4MZB A;  5IMA A;  4AF2 A;  1QXH A;  3TKP A;  4YQM A;  4L5O A;  5IOX A;  2DJ1 A;  3WGD A;  4HEA 2;  3ZMK A;  1MD3 A;  3GNJ A;  2IMF A;  1F3B A;  3VLN A;  3HZ8 A;  2VCQ A;  3DEX A;  4X1U A;  4GRF A;  2L5O A;  2C3Q A;  4F9Z A;  1M9A A;  1T1V A;  4HZ2 A;  2FA8 A;  3WD6 A;  5D96 A;  1SK1 A;  3O6T A;  3HCZ A;  2P5R A;  4LL1 B;  1FO5 A;  1AC1 A;  5GZZ B;  3VFI A;  2YV9 A;  2GQL A;  3D4M A;  4I6X A;  4K7O A;  3HYP A;  1PL2 A;  3QCP A;  3TCO A;  2IJY A;  1PSQ A;  1SKS B;  5C04 A;  1XXU A;  2OA7 A;  3IV4 A;  2LEG A;  1GUL A;  2C0F A;  2PVO C;  3F8U A;  2K6V A;  1PKZ A;  5J9B A;  1URM A;  2MMA A;  3GRX A;  2K9F A;  1THX A;  4V2L A;  1MEK A;  4HOJ A;  3L0H A;  2B1K A;  5L71 A;  1NHO A;  4POM A;  2LJK A;  3CRT A;  4TR0 A;  4IQA A;  2HNL A;  2PN8 A;  4MPF A;  1FVK A;  1VF3 A;  2DMM A;  3EU4 A;  6GST A;  3HD5 A;  1GP1 A;  3PIN A;  1FOV A;  11GS A;  3TDG A;  2FGX A;  3H1N A;  3E9J B;  5DDL A;  1Z6M A;  1PKW A;  3GH6 A;  2IWT A;  2O85 A;  3P90 A;  1SD8 A;  1GSD A;  1Q4J A;  3ERG A;  4PUR A;  1WE0 A;  3CXG A;  1V98 A;  3D5J A;  4FYU A;  17GS A;  2M72 A;  1XW6 A;  5GAP D;  4I2U A;  2X64 A;  1A24 A;  4RI7 A;  2C3N A;  3DKS A;  2L4Q A;  1GSY A;  3WGE A;  3ME7 A;  1U87 A;  3GKK A;  4ECJ A;  1N2A A;  1YF1 A;  1X0R A;  1HNC A;  2H0G A;  2GSQ A;  4GST A;  4HUA A;  2R2J A;  2JAC A;  5AIX A;  5G5E A;  1TJD A;  4E8E A;  1UVZ A;  3KTB A;  5ECL B;  3I6A A;  3KEB A;  4MJA A;  4FYB A;  2QSI A;  1O6J A;  2YZH A;  2HZE A;  3HY2 A;  1X9S B;  4BL7 A;  2IMI A;  3CSI A;  1O8X A;  5LNK e;  4MPG A;  3VPT A;  4EF0 A;  5DQS A;  1OE7 A;  4TXO B;  3ZL5 A;  4RQR A;  2HYX A;  2OE0 A;  1Z5Y E;  2O8V B;  3KMN A;  5H5Q A;  2TRC P;  2RII A;  3IA1 A;  1PA3 A;  3ERF A;  3ZFB A;  1OC9 A;  5KEJ A;  4YH2 A;  1SYR A;  3L78 A;  1XWC A;  3PH9 A;  2DJK A;  2HRN A;  1HNB A;  3C7M A;  2F3M A;  3FZ4 A;  2AV4 A;  1K3Y A;  5JCG A;  2HLS A;  4TKY A;  4TRX A;  2JZS A;  2LST A;  2V2G A;  1TI3 A;  3FYG A;  4GQF A;  2REM A;  4L0U A;  3GKN A;  3Q6O A;  1M9B A;  2YAN A;  4OMV A;  4MJC A;  3F3R A;  1EOH A;  2OBK A;  5DJL A;  3C1S A;  4MF6 A;  2H76 A;  5G30 A;  1SK0 A;  3TRP A;  3CBU A;  3GV1 A;  4KDX A;  2LJR A;  3TJJ A;  2AUV A;  2K8V A;  3PR8 A;  2P31 A;  3SBC A;  3LG6 A;  5A4V A;  3TGZ A;  1GNE A;  4G9H A;  2N5A A;  4DSS B;  4F82 A;  1G7O A;  2KHP A;  1ZYQ B;  1TU7 A;  2LRC A;  2DSA A;  3KTL A;  16GS A;  1VF2 A;  3Q18 A;  5D9T A;  2JU5 A;  2H74 A;  2VL3 A;  4ZIL A;  2N5F A;  3I9V 2;  1QUW A;  3KCM A;  4MAB A;  2XPD A;  4ULX A;  2YZU A;  2GDR A;  3IOS A;  4NV2 A;  3LYK A;  1EGO A;  2C4J A;  2E0Q A;  2EIO A;  4O5R A;  1EEM A;  1YY7 A;  2HT9 A;  1X9M B;  2VCW A;  3M8N A;  3DWV A;  4YAV A;  5F8B A;  1SJI A;  4WET A;  1TU8 A;  2QKE A;  5HR3 A;  5E59 A;  3VWX A;  4GQC A;  5HR2 A;  3M3M A;  2LTK A;  5A4U A;  1ML6 A;  1TOF A;  1FVJ A;  4OFM A;  5IMZ A;  3LYP A;  1ERT A;  1ABA A;  1TXX A;  1OC3 A;  3CSH A;  1YEX A;  2B5E A;  3TJG A;  5G31 A;  1DBY A;  1XWG A;  2OE1 A;  3VWV A;  1GL8 A;  3IBH A;  1EEJ A;  1ERW A;  1X5E A;  1WWJ A;  3QDN A;  3LQ7 A;  2OJL A;  2YV7 A;  3KMO A;  5CRD A;  3A3T A;  3MDK A;  3QMX A;  4ECC A;  2MMO A;  4JR4 A;  1GTB A;  19GS A;  3HKR A;  2M46 A;  3DYR A;  1TTZ A;  2GT6 A;  2WB9 A;  1TRW A;  4I8B A;  3GTU A;  3G7J A;  1UC7 A;  1M99 A;  4QQ7 A;  4KDU A;  1N8J A;  2V1M A;  4ILF A;  5LD0 A;  3GH9 A;  5HR0 A;  2MMZ A;  4GSN A;  1WJK A;  5JCW A;  1V58 A;  1O81 A;  1U6T A;  4IJI A;  2CQ9 A;  2M80 A;  4HJ2 A;  1B48 A;  2PBJ A;  5HFK A;  2LKU A;  2WJU A;  3TKS C;  1Z7R A;  2XHF A;  2OE3 A;  4ECB A;  1XOB A;  2DML A;  3KZQ A;  4XIH A;  3EMX A;  1JZW A;  4HQS A;  4KB3 A;  2BTO T;  5G1L A;  2R3X A;  1R5A A;  3MSZ A;  3GIX A;  4WBJ A;  2OBI A;  1A8Y A;  2YCD A;  3US3 A;  1EP7 A;  1AXD A;  1X5D A;  3D4T A;  1ZZY A;  2ZUP A;  4RQX A;  2JL4 A;  1ERU A;  5DJM A;  5DQY A;  1PMT A;  1T7P B;  3ZVJ A;  4DSQ A;  3VPQ A;  2LRN A;  1JZR A;  3FEU A;  4DVC A;  3GFK A;  1HQO A;  1V2A A;  2VD1 A;  1NHY A;  4KUN A;  1G0T A;  3HHV A;  14GS A;  4Q5F A;  4HS1 A;  5JWO B;  2NDO A;  20GS A;  4WXT A;  4XS1 A;  5IPH A;  4K6X A;  3KD0 A;  3QFB C;  1A2L A;  1E6B A;  3UMA A;  5ABR A;  4NHZ A;  3LSZ A;  1AAZ A;  2AB6 A;  4PX1 A;  1JLV A;  3ZML A;  3QAW A;  5CRE A;  2GQM A;  1PRX A;  4TR3 A;  4AJ8 A;  2FD3 A;  2NTO A;  2LRT A;  3G9B A;  3A2X A;  4BWQ A;  4ACS A;  1X9W B;  4PNF A;  1YQ1 A;  4RI6 A;  3G7Y A;  2IFQ B;  3FR6 A;  4IKH A;  3UBL A;  1XW9 A;  4TR1 B;  4MH2 A;  3GMF A;  4IP1 A;  2I81 A;  4F2I A;  1T3B A;  1YDK A;  2LJA A;  4CDO A;  5GSS A;  4CW9 A;  4BPY A;  2XBQ A;  3RDW A;  2CVD A;  1OKD A;  4MF5 A;  4MH3 A;  5HFG A;  1FB0 A;  1TK8 B;  1JZD A;  1TRU A;  2GST A;  4EE0 A;  3EMP A;  4OFN A;  4YQU A;  2RLI A;  3CYN A;  4P3Y B;  3IAM 2;  2FWH A;  2IL3 A;  5J5N A;  2WRT A;  3ZFL A;  1EZK A;  3P7X A;  1XVQ A;  2RM6 A;  1RQM A;  3FHK A;  2VD0 A;  1OYJ A;  3ERW A;  2FCH A;  4PXO A;  4RUV A;  2C80 A;  4LMW A;  5B7C A;  3DVW A;  2EIQ A;  4PGT A;  1J08 A;  2JAD A;  2O89 A;  4V1A p;  2X8G A;  3HVV A;  1PQN A;  1QK8 A;  1OKT A;  3IAS 2;  5IMD A;  4IGJ A;  5A5K A;  4EL1 A;  1PX7 A;  2N5B A;  5AIV A;  2DIY A;  1NSW A;  1SYX A;  2A2R A;  3H93 A;  4YAP A;  2LNS A;  1MTC A;  4EO3 A;  1DUG A;  1R26 A;  1AQV A;  2F51 A;  1RK4 A;  4K0N A;  2LS5 A;  3CTG A;  1HYU A;  2LUS A;  1THO A;  5ECO B;  2PER A;  2L59 A;  1M7T A;  4NXI A;  2D2Z A;  4PUF C;  4OD7 A;  2H0I A;  3VWU A;  4HJM A;  2GZZ A;  2VIM A;  4LA1 A;  1AQW A;  2DLX A;  3W8S A;  2QC7 A;  5CRH A;  3ZRD A;  2FY6 A;  3L9V A;  3KGK A;  4LL4 B;  5CO3 A;  3LFL A;  18GS A;  2H1B A;  4POB A;  3J7Y b;  1AIU A;  4NV5 A;  3HJO A;  2C0E A;  4ZBB A;  1K3O A;  1KBN A;  2TIR A;  2L6C A;  2VL9 A;  4BVX A;  4PUA A;  5F07 A;  1SL1 B;  4ML6 A;  1OE8 A;  1PN9 A;  5ECN B;  4V2M A;  2G0F A; 
#chains in the Genus database with same CATH topology
 3UBK A;  2WGR A;  4NWY A;  3OR5 A;  3FRC A;  3FY7 A;  1USB A;  5IMF A;  1WIK A;  2ALB A;  3BJ5 A;  2B1L A;  2GQK A;  4MMM A;  5KN1 A;  1ON4 A;  2AHE A;  4NPB A;  3UJ1 A;  2FWG A;  2F8F A;  1S3R A;  4V1A g;  2HRA A;  3G7I A;  2HSH A;  2I4A A;  1GLP A;  3IE3 A;  3E3E A;  3CTF A;  1B4Q A;  2WCI A;  2VO4 A;  1SJZ A;  1V9W A;  3NIV A;  4FYC A;  4YQV A;  1GNW A;  2X8H A;  4IW9 A;  2JZR A;  3GL5 A;  1GH2 A;  4PQ1 A;  4ML1 A;  3F3Q A;  1M2D A;  3EU3 A;  1GUH A;  2RM5 A;  4EDY A;  1GUM A;  2HRK A;  1XG8 A;  3BBY A;  4XTS A;  4EC0 A;  3ZIJ A;  4FIW A;  4KF9 A;  1AW9 A;  4GSS A;  4EIP A;  4HQZ A;  3GSS A;  6GSY A;  3L4N A;  2JSZ A;  2VLV A;  1T00 A;  3TJB A;  4OO4 A;  2Z9S A;  5DAK B;  5D9X A;  1QGV A;  5IQY A;  5J9C A;  1SEN A;  2YWM A;  2FNO A;  4L8E A;  1VF4 A;  6GSW A;  3F9U A;  3DRN A;  2FWF A;  5BMU A;  2GGT A;  2CZ2 A;  2R37 A;  3C8E A;  3EE2 A;  4F0C A;  1XPV A;  4DSS A;  2C1Y A;  4TVE A;  1H4O A;  3CRU A;  3RHC A;  5B8B A;  3GUS A;  3VI7 A;  5F0G A;  4Z2U A;  5F05 A;  1K0M A;  1XW5 A;  4F03 A;  1SKW B;  1ZGN A;  3KIJ A;  2PWJ A;  1XIY A;  2X49 A;  4HDE A;  3HZ4 A;  3M9K A;  4TR4 A;  5ELG A;  3GUR A;  6GSV A;  3GN3 A;  3APO A;  3H79 A;  2L4C A;  3W6G A;  3CSJ A;  2B7K A;  1ST9 A;  4NHW A;  1CQH A;  3Q19 A;  1SD9 A;  3TUE A;  2B6M A;  2R6K A;  4O32 A;  1LBK A;  1J0F A;  7GSS A;  2QA2 A;  4CHS A;  5IMC A;  2BJX A;  1Z7P A;  1F6M C;  1BQ7 A;  4K8M A;  4POL A;  3NZN A;  2B5X A;  4CY8 A;  4KCE A;  22GS A;  1G7E A;  1K0C A;  2J9H A;  1U3A A;  3PPU A;  1PL1 A;  4E8H A;  1U3I A;  4K2D A;  3H8Q A;  2HRF A;  5DVB A;  3FZA A;  4J57 E;  4N0V A;  2VCZ A;  4AJ7 A;  4BVY A;  4CY6 A;  5HQP A;  4K5R A;  1K3L A;  4O92 A;  1BX9 A;  2P0G A;  2VLT A;  4ZXG A;  1DE1 A;  4FH8 A;  5AN1 A;  5IPG A;  4KND A;  2OAD A;  1JHB A;  4G0K A;  4MDC A;  3UAP A;  3LXZ A;  2TRX A;  2VM2 A;  5J4U A;  3GA4 A;  2E7P A;  4BWS A;  1GLQ A;  1Z3E A;  2DJ2 A;  4XS4 B;  4V2N A;  5ECM B;  4IEL A;  4K7N A;  3A5I A;  5CRW A;  3BD2 A;  2GLR A;  5ID2 B;  1GRX A;  5G1K A;  1NM3 A;  3DGQ A;  4OO5 A;  2VUP A;  2VCV A;  2IMD A;  2ON5 A;  5IMV A;  2HFD A;  3F0I A;  1F37 A;  5DCH A;  1VGL A;  3GX8 A;  1FG4 A;  13GS A;  2YOI A;  9GSS A;  5EPF A;  1M2B A;  1I9D A;  4HU9 A;  3RHB A;  3RPN A;  3KP8 A;  2MMN A;  2RUE A;  2VL2 C;  3DD3 A;  3QD9 A;  3ZTL A;  3QFA C;  3N9J A;  3KM6 A;  4KE3 A;  2KOK A;  2B5Y A;  1ZYE A;  2GTU A;  3GST A;  3TOT A;  3QOU A;  2H6X A;  3VI5 A;  1SK2 A;  3FKF A;  1QMV A;  1EWX A;  1K0O A;  2CZ3 A;  1HNA A;  5G5F A;  1AQX A;  2CVB A;  4N30 A;  3C73 A;  3O76 A;  4KH7 A;  1Z6N A;  4GLT A;  3IR4 A;  2GSS A;  3P8W A;  1MD4 A;  5KN0 A;  1J9B A;  3A2W A;  4MJE A;  4HZ4 A;  2MYG A;  2L57 A;  2E2M A;  4K1F A;  1B4P A;  2VLU A;  4G19 A;  3IHQ A;  1SL2 B;  2V6K A;  2H70 A;  1K0D A;  2CVK A;  2C0G A;  5DAL B;  2X8C A;  4GWR A;  3KJY A;  3APQ A;  2IFQ A;  3KH7 A;  1TK0 B;  4I97 A;  3MWH A;  3TRQ A;  5CYY A;  2C0D A;  4TR1 A;  4IN0 A;  2IMK A;  5CNW A;  3UEM A;  4AJ6 A;  1R5P A;  3HXS A;  1TDI A;  4TOP A;  3TKQ A;  3VWW A;  2NPB A;  4KGI A;  2MZC A;  1GSQ A;  3C1R A;  3P2A A;  4IJ3 A;  2H75 A;  2GZY A;  2NBS A;  1GWC A;  2FUG 2;  5ECR B;  1XWB A;  1JLW A;  5G2Z A;  4WBR D;  3TRX A;  3MNG A;  5DCG A;  1ZL9 A;  1JFU A;  5D9V A;  1A8L A;  3ZRE A;  3QR6 A;  3ZLP A;  4KDY A;  4TXV A;  2HE3 A;  2VAF A;  5D93 A;  2DBC A;  2AYT A;  1OC8 A;  3WGX A;  4MA9 A;  3QAV A;  1B9X C;  3IK7 A;  4D73 B;  1F2E A;  5DBQ A;  5F06 A;  2MBT A;  2CAQ A;  4KW6 A;  5HFI A;  2B3S A;  3F4R A;  3UAR A;  2PPT A;  1XVW A;  4I2T A;  2DKI A;  3HJP A;  3IRA A;  4F0B A;  1VRS D;  2PUK C;  1JZO A;  5CP1 A;  3EYT A;  1XFL A;  2KP1 A;  4N0Z A;  1EGR A;  5B6N A;  5CRG A;  2R0G A;  2HI7 A;  4N11 A;  1GTI A;  1DE2 A;  2HSM A;  3W8J A;  4ID0 A;  1G6W A;  1F3A A;  4OCE A;  3L9S A;  1BG5 A;  1ERV A;  4GXZ A;  5J41 A;  1FHE A;  1MDJ A;  3ED3 A;  5EY6 A;  3HVN A;  4K5S A;  1SJ6 A;  3F63 A;  4MCU A;  5C00 A;  3ZYW A;  2XC2 A;  1XZO A;  3D22 A;  4KSM A;  2LQQ A;  4MLY A;  3F4S A;  4DEJ A;  2PU9 C;  2I3Y A;  3J7Y k;  3TJK A;  2KUC A;  4N10 A;  1YF0 A;  1W4V A;  4GTU A;  3I43 A;  3GX0 A;  4G10 A;  2PGT A;  3LJR A;  1XOA A;  3N5O A;  5ECH B;  2WUL A;  2H6Y A;  3ISO A;  3KXO A;  1GSE A;  4LMV A;  4ZB9 A;  4ZL9 A;  3F6D A;  1K0N A;  3FW2 A;  1GSF A;  1GTU A;  5AGY A;  2WS2 A;  1XCC A;  5ENU A;  2HXK A;  3M1G A;  1TRS A;  2H66 A;  2ZCT A;  5A4W A;  4K9Z A;  4X0X A;  2R0P A;  4I5Q A;  5JWR B;  2IME A;  4OCF A;  3R3E A;  4XCS A;  4MK3 A;  4ZBA A;  2E2G A;  4XHM A;  5AIS A;  5EVO A;  1I5G A;  5IO0 A;  1EV4 A;  4JBB A;  1LJR A;  3UVT A;  4JRR A;  2KLX A;  1S3A A;  1M2A A;  3EC3 A;  1X5C A;  1UN2 A;  3H4K A;  3IDV A;  2L5L A;  3HA9 A;  5CAX A;  2VOC A;  5GST A;  2HZF A;  1SKR B;  3WT2 A;  1A0F A;  3M9J A;  2CAI A;  4WR4 A;  4AGS A;  2WZ9 A;  3JCM L;  4X43 A;  1B9Y C;  2I9H A;  3HVX A;  2H71 A;  2P5Q A;  3BCK A;  4WKW A;  1B8X A;  3SWL A;  2V6O A;  5KN3 A;  2CV4 A;  4PQI A;  5DAK A;  2L6D A;  4MJB A;  2NVL A;  3AY8 A;  3DIE A;  3E0U A;  5GAN D;  1Z9H A;  4TXO A;  3NOF A;  3RBT A;  4WF4 A;  2H01 A;  1Y6E A;  3UIW A;  2BMX A;  2H1G A;  1YKC A;  4KSO A;  1BAY A;  2CX4 A;  4K0G A;  2LQO A;  2A2P A;  3C71 A;  4EXJ A;  4J2F A;  3A5W A;  5JCU A;  3GKM A;  4MF7 A;  4QL7 A;  1GTA A;  4ZBD A;  2A4V A;  2KP2 A;  1K0A A;  1A2J A;  5HR1 A;  3U6V A;  1FW1 A;  1OVN A;  3V1W A;  4KCA A;  3LWA A;  3DML A;  1T4Y A;  1O7U A;  2H6Z A;  2LNT A;  2H19 A;  5ECP B;  2DC5 A;  3UOM A;  4OWY A;  4DSR A;  4ZL8 A;  2JZT A;  4LLR A;  1Y25 A;  4BA7 A;  3HDC A;  5B8A A;  1ZOF A;  1F9M A;  3BOA A;  2GZP A;  4MZW A;  4A5P A;  2H1A A;  4L0W A;  4O7H A;  5ELA A;  4Q5N A;  5IO2 A;  4XRA A;  4WR5 A;  4JZQ A;  3WYW A;  2R4V A;  1NW2 A;  4TW5 A;  2RUF A;  4O5U A;  3R2Q A;  5FHI A;  3D0Z A;  1O85 A;  3ZZX A;  2WDU A;  2XBI A;  2OKA A;  3S9F A;  3PGT A;  3IXR A;  2YNX A;  3LGC A;  1IYH A;  2ON7 A;  12GS A;  4JE1 A;  4NMU A;  5D8I A;  2EC4 A;  2FHE A;  2F9S A;  1EP8 A;  4GCI A;  1S3C A;  1GSU A;  1WOU A;  2V41 A;  2H72 A;  2FWE A;  2FA4 A;  2H0H A;  4MZC A;  2YWO A;  1O8W A;  4ZB6 A;  4XS4 A;  5KN2 A;  5IM9 A;  5JWQ B;  5IIZ A;  4TN8 A;  2HZE B;  2ZNM A;  5ID2 A;  4YKG A;  4XRD A;  4Z7X A;  2EIR A;  3FR9 A;  3GL3 A;  4BL7 B;  1XBS A;  2O7K A;  3FR3 A;  1GUK A;  1M0U A;  2CA8 A;  1QQ2 A;  2J23 A;  3KH9 A;  2GSR A;  1A2M A;  2AAW A;  2XPE A;  2ES7 A;  1UA5 A;  2IIY A;  3APS A;  4EUY A;  1W89 A;  4KA0 A;  1OC9 B;  2H73 A;  3TJF A;  1QFN A;  5E4W A;  1FAA A;  3Q74 A;  1WRY A;  5LCZ A;  3ME8 A;  3FK8 A;  3U5R E;  1C72 A;  4MP4 A;  4EVM A;  1DSB A;  3DVX A;  1TKD B;  3BCI A;  1EV9 A;  5H5R A;  1O73 A;  4GF0 A;  4ZB8 A;  1BJX A;  1HD2 A;  3TKS E;  4ZIJ A;  3EWL A;  3WT1 A;  4QL9 A;  4G2E A;  1MDI A;  3TOU A;  5B6M A;  1H75 A;  1K0B A;  2DJJ A;  4PNG A;  1YKA A;  4EKZ A;  1LU4 A;  4IHU A;  1ZYN A;  2HSY A;  1ILO A;  4J56 E;  1PX6 A;  2B7J A;  3TB2 A;  2JSY A;  1WPI A;  3UL3 A;  3LOR A;  3EPT A;  1RW1 A;  3FZ5 A;  5IOW A;  1E2Y A;  2VCX A;  4H86 A;  1XWK A;  2VL2 A;  2H1D A;  1SL0 B;  4POK A;  2MBS A;  6GSU A;  2CX3 A;  4XS6 A;  3D6I A;  2G2Q A;  2YP6 A;  1R4W A;  3EIN A;  2F8A A;  1ZMA A;  2YJH A;  1WP0 A;  3UVH A;  1V57 A;  1TRV A;  3GYK A;  3KP9 A;  1CQG A;  2I1U A;  5DAL A;  2K18 A;  1PD2 1;  5EL8 A;  2O87 A;  3F4T A;  2PVQ A;  3MAK A;  3GHA A;  2AJQ B;  4ECI A;  1T8E B;  3LXT A;  1KNG A;  4JR6 A;  3VUR A;  4IP6 A;  1S3D A;  1V40 A;  4K2X A;  1A23 A;  1KEB A;  5ECI B;  5D73 A;  3IK9 A;  1TP9 A;  2DJ0 A;  3DXB A;  3O3T A;  3LEF A;  3L9U A;  4G0L A;  1A0R P;  1Q98 A;  2YN1 A;  2PMT A;  3TKS A;  3M0F A;  5ECS A;  2YWI A;  5J3R A;  1VF1 A;  2X99 A;  4IBP A;  4HI7 A;  1BYE A;  2R5G A;  4USS A;  4BIK A;  1TK5 B;  3TKR A;  2YJ7 A;  4Q5R A;  4IVF A;  2LV3 A;  1WMJ A;  2H8L A;  3IC4 A;  4WEY A;  5COH A;  1XWA A;  4D73 A;  4IS0 A;  1YJ6 A;  4Q5Q A;  2A2S A;  1ZYP A;  4MNN A;  2FLS A;  3FZ9 A;  1YEP A;  1G6Y A;  1MDK A;  2H30 A;  2YWN A;  3IPZ A;  3RPP A;  1FB6 A;  1GSS A;  3QAG A;  2DIZ A;  1ZCP A;  4ISD A;  5H5S A;  3K8N A;  3CMI A;  1FOH A;  5INY A;  3GTU B;  4NAX A;  2IN3 A;  2DKH A;  2YPM A;  4K7I A;  1TW9 A;  2C3T A;  2GS3 A;  3EVI A;  6GSS A;  2WFC A;  4OFT A;  4WF5 A;  3RAZ A;  3D21 A;  3A2V A;  2GT5 A;  1U88 A;  4ZL7 A;  1IYI A;  4PQH A;  3ZIT A;  1TI1 A;  5D9W A;  3ZIV A;  2DJ3 A;  3EUR A;  4O5Q A;  5FWG A;  2OAC A;  1KTE A;  1ACV A;  1OAZ A;  3HVS A;  8GSS A;  5FT3 A;  1PGT A;  2IPA A;  2GVP A;  2CT6 A;  1SU9 A;  2K8S A;  4KX4 A;  10GS A;  4JU5 A;  4HU7 A;  3I69 A;  2C8U A;  3GKX A;  2VCT A;  3QPM A;  1T4Z A;  2V32 A;  1R7H A;  4FO5 A;  2VM1 A;  3ZVJ D;  1AUC A;  3F6F A;  1YZX A;  1BED A;  4IQ1 A;  1EOG A;  4L5L A;  6GSX A;  4EDZ A;  4KAE A;  5ECQ B;  3VK9 A;  4JED A;  5ECK B;  2QGV A;  3HJM A;  4MZB A;  5IMA A;  4AF2 A;  1QXH A;  3TKP A;  4YQM A;  4L5O A;  5IOX A;  2DJ1 A;  3WGD A;  2QA1 A;  4HEA 2;  3ZMK A;  1MD3 A;  3IC8 A;  3GNJ A;  2IMF A;  4YKF A;  1F3B A;  3VLN A;  3HZ8 A;  2VCQ A;  3DEX A;  4X1U A;  4GRF A;  2L5O A;  2A4H A;  2C3Q A;  4F9Z A;  1M9A A;  1T1V A;  4HZ2 A;  2FA8 A;  3WD6 A;  5D96 A;  1SK1 A;  1PN0 A;  3O6T A;  3HCZ A;  2P5R A;  4LL1 B;  1FO5 A;  1AC1 A;  5GZZ B;  3VFI A;  2YV9 A;  2GQL A;  3D4M A;  4I6X A;  4K7O A;  3HYP A;  1PL2 A;  3QCP A;  3TCO A;  2IJY A;  1PSQ A;  1SKS B;  5C04 A;  1XXU A;  2OA7 A;  3IV4 A;  2LEG A;  1GUL A;  2C0F A;  2PVO C;  3F8U A;  2K6V A;  1PKZ A;  5J9B A;  1URM A;  2MMA A;  3GRX A;  2K9F A;  1THX A;  4V2L A;  1MEK A;  4HOJ A;  3L0H A;  2B1K A;  5L71 A;  1NHO A;  4POM A;  2LJK A;  3CRT A;  4TR0 A;  4IQA A;  2HNL A;  2PN8 A;  4MPF A;  1FVK A;  1VF3 A;  2DMM A;  3EU4 A;  6GST A;  3HD5 A;  1GP1 A;  3PIN A;  1FOV A;  11GS A;  3TDG A;  2FGX A;  3H1N A;  3E9J B;  1M3I A;  5DDL A;  1Z6M A;  1PKW A;  3GH6 A;  2IWT A;  2O85 A;  3P90 A;  1SD8 A;  1GSD A;  1Q4J A;  3ERG A;  4PUR A;  1WE0 A;  3CXG A;  1V98 A;  3D5J A;  4FYU A;  17GS A;  2M72 A;  1XW6 A;  5GAP D;  4I2U A;  2X64 A;  1A24 A;  4RI7 A;  2C3N A;  3DKS A;  2L4Q A;  1GSY A;  3WGE A;  3ME7 A;  1U87 A;  3GKK A;  4ECJ A;  1N2A A;  1YF1 A;  1X0R A;  1HNC A;  2H0G A;  2GSQ A;  4GST A;  4HUA A;  2R2J A;  2JAC A;  5AIX A;  5G5E A;  1TJD A;  4E8E A;  1UVZ A;  3KTB A;  5ECL B;  3I6A A;  3KEB A;  3LW9 A;  4MJA A;  4BVX B;  4FYB A;  2QSI A;  1O6J A;  2YZH A;  2HZE A;  3HY2 A;  1X9S B;  4BL7 A;  2IMI A;  3CSI A;  1O8X A;  5LNK e;  4MPG A;  3VPT A;  4EF0 A;  5DQS A;  1OE7 A;  4TXO B;  3ZL5 A;  4RQR A;  2HYX A;  2OE0 A;  1Z5Y E;  2O8V B;  3KMN A;  5H5Q A;  2TRC P;  2RII A;  3IA1 A;  1PA3 A;  3ERF A;  4EIQ A;  3ZFB A;  1OC9 A;  4PTS A;  5KEJ A;  4YH2 A;  1SYR A;  3L78 A;  3PH9 A;  1XWC A;  2DJK A;  1PFO A;  2HRN A;  2UZ8 A;  1HNB A;  3C7M A;  4Z2T A;  2F3M A;  3FZ4 A;  2AV4 A;  1K3Y A;  5JCG A;  2HLS A;  4TKY A;  4TRX A;  2JZS A;  2LST A;  2V2G A;  1TI3 A;  3FYG A;  4GQF A;  2REM A;  4L0U A;  3GKN A;  3Q6O A;  5BRT A;  1M9B A;  2YAN A;  4OMV A;  4MJC A;  3F3R A;  1EOH A;  2OBK A;  5DJL A;  3C1S A;  4MF6 A;  2H76 A;  5G30 A;  1SK0 A;  3TRP A;  3CBU A;  3GV1 A;  4KDX A;  2LJR A;  3TJJ A;  2AUV A;  2K8V A;  3PR8 A;  2P31 A;  3SBC A;  3LG6 A;  5A4V A;  3TGZ A;  1GNE A;  4G9H A;  2N5A A;  4DSS B;  4F82 A;  4FQU A;  1G7O A;  2KHP A;  1ZYQ B;  1TU7 A;  2LRC A;  2DSA A;  3KTL A;  16GS A;  1VF2 A;  3Q18 A;  5D9T A;  2JU5 A;  2H74 A;  2VL3 A;  4ZIL A;  2N5F A;  3I9V 2;  1QUW A;  3KCM A;  4MAB A;  4V2M A;  2XPD A;  4ULX A;  2YZU A;  2GDR A;  3IOS A;  4NV2 A;  3LYK A;  1EGO A;  2C4J A;  2E0Q A;  2EIO A;  4O5R A;  1EEM A;  1YY7 A;  2HT9 A;  1X9M B;  2VCW A;  3M8N A;  3DWV A;  4YAV A;  5F8B A;  1SJI A;  4WET A;  1TU8 A;  4Z2R A;  2QKE A;  5HR3 A;  5E59 A;  3VWX A;  4GQC A;  5HR2 A;  3M3M A;  2LTK A;  5A4U A;  1ML6 A;  1TOF A;  1FVJ A;  4OFM A;  5IMZ A;  1M3J A;  3LYP A;  1ERT A;  1ABA A;  1TXX A;  1OC3 A;  3CSH A;  1YEX A;  2B5E A;  3TJG A;  5G31 A;  3MIX A;  1DBY A;  1XWG A;  2OE1 A;  4HSC X;  3VWV A;  1GL8 A;  3IBH A;  1EEJ A;  1ERW A;  1X5E A;  4BVY B;  1WWJ A;  3MYD A;  3QDN A;  3LQ7 A;  2OJL A;  2YV7 A;  3KMO A;  5CRD A;  3A3T A;  3MDK A;  2R0C A;  3QMX A;  4ECC A;  2MMO A;  4JR4 A;  1GTB A;  19GS A;  3HKR A;  2M46 A;  3DYR A;  1TTZ A;  2GT6 A;  2WB9 A;  1TRW A;  4I8B A;  3GTU A;  3G7J A;  1UC7 A;  1M99 A;  4QQ7 A;  4KDU A;  1N8J A;  2V1M A;  4ILF A;  5LD0 A;  3GH9 A;  5HR0 A;  2MMZ A;  4GSN A;  1WJK A;  5JCW A;  1V58 A;  1O81 A;  1U6T A;  4IJI A;  2CQ9 A;  2M80 A;  4HJ2 A;  1B48 A;  2PBJ A;  5HFK A;  2LKU A;  2WJU A;  3TKS C;  1Z7R A;  2XHF A;  2OE3 A;  4ECB A;  1XOB A;  2DML A;  3FMW A;  3KZQ A;  4XIH A;  3EMX A;  1JZW A;  4HQS A;  4KB3 A;  3IHG A;  2BTO T;  5G1L A;  2R3X A;  1R5A A;  3MSZ A;  3GIX A;  4WBJ A;  2OBI A;  1A8Y A;  2YCD A;  3US3 A;  1EP7 A;  1AXD A;  1X5D A;  3D4T A;  1ZZY A;  2ZUP A;  4RQX A;  2JL4 A;  1ERU A;  5DJM A;  5DQY A;  1PMT A;  1T7P B;  3ZVJ A;  4DSQ A;  3VPQ A;  2LRN A;  1JZR A;  3FEU A;  4DVC A;  3GFK A;  1HQO A;  1V2A A;  2VD1 A;  1NHY A;  4KUN A;  1G0T A;  3HHV A;  14GS A;  4Q5F A;  4HS1 A;  5JWO B;  2NDO A;  5KOW A;  20GS A;  4WXT A;  4XS1 A;  3CQF A;  5IPH A;  4K6X A;  4ICY A;  3KD0 A;  2X4A A;  3QFB C;  1A2L A;  1E6B A;  3UMA A;  5ABR A;  4NHZ A;  3LSZ A;  1AAZ A;  2AB6 A;  4PX1 A;  1JLV A;  3ZML A;  3QAW A;  5CRE A;  2GQM A;  1PRX A;  4TR3 A;  4AJ8 A;  2FD3 A;  2NTO A;  2LRT A;  3G9B A;  3A2X A;  4BWQ A;  4ACS A;  1X9W B;  4PNF A;  1YQ1 A;  4RI6 A;  3G7Y A;  2IFQ B;  3FR6 A;  4IKH A;  3UBL A;  1XW9 A;  4TR1 B;  4MH2 A;  5KOX A;  3GMF A;  4IP1 A;  2I81 A;  4G0I A;  4F2I A;  1T3B A;  1YDK A;  2LJA A;  4CDO A;  5GSS A;  4CW9 A;  4BPY A;  2XBQ A;  3RDW A;  2CVD A;  1OKD A;  4MF5 A;  4MH3 A;  5HFG A;  1FB0 A;  1TK8 B;  1JZD A;  1TRU A;  2GST A;  4EE0 A;  3EMP A;  4OFN A;  4YQU A;  2RLI A;  3CYN A;  4P3Y B;  3IAM 2;  2FWH A;  2IL3 A;  5J5N A;  2WRT A;  3ZFL A;  1EZK A;  3P7X A;  1XVQ A;  2RM6 A;  1RQM A;  3FHK A;  2VD0 A;  1OYJ A;  3ERW A;  2FCH A;  4PXO A;  4RUV A;  2C80 A;  4LMW A;  5B7C A;  3DVW A;  2EIQ A;  4PGT A;  1J08 A;  2JAD A;  2O89 A;  4V1A p;  2X8G A;  3HVV A;  1PQN A;  1QK8 A;  1OKT A;  3IAS 2;  5IMD A;  4IGJ A;  5A5K A;  4EL1 A;  1PX7 A;  2N5B A;  5AIV A;  2DIY A;  1NSW A;  1SYX A;  2A2R A;  3H93 A;  4YAP A;  2LNS A;  1MTC A;  4EO3 A;  1DUG A;  1R26 A;  1AQV A;  2F51 A;  1RK4 A;  4K0N A;  2LS5 A;  3CTG A;  1HYU A;  2LUS A;  1THO A;  5ECO B;  2PER A;  2L59 A;  1M7T A;  4NXI A;  2D2Z A;  4PUF C;  4OD7 A;  2H0I A;  3VWU A;  4HJM A;  2GZZ A;  2VIM A;  4LA1 A;  1AQW A;  2DLX A;  3W8S A;  2QC7 A;  5CRH A;  3ZRD A;  2FY6 A;  3L9V A;  3KGK A;  4LL4 B;  5CO3 A;  3LFL A;  18GS A;  2H1B A;  4POB A;  3J7Y b;  1AIU A;  4NV5 A;  3HJO A;  2C0E A;  4ZBB A;  1K3O A;  1KBN A;  2TIR A;  2L6C A;  2VL9 A;  4BVX A;  4PUA A;  5F07 A;  1SL1 B;  4ML6 A;  1OE8 A;  1PN9 A;  5ECN B;  4X4J A;  2G0F A; 
#chains in the Genus database with same CATH homology
 3UBK A;  2WGR A;  4NWY A;  3OR5 A;  3FRC A;  3FY7 A;  1USB A;  5IMF A;  1WIK A;  2ALB A;  3BJ5 A;  2B1L A;  2GQK A;  4MMM A;  5KN1 A;  1ON4 A;  2AHE A;  4NPB A;  3UJ1 A;  2FWG A;  2F8F A;  4V1A g;  2HRA A;  3G7I A;  2HSH A;  2I4A A;  1GLP A;  3IE3 A;  3E3E A;  3CTF A;  1B4Q A;  2WCI A;  2VO4 A;  1SJZ A;  1V9W A;  3NIV A;  4FYC A;  4YQV A;  1GNW A;  2X8H A;  4IW9 A;  2JZR A;  3GL5 A;  1GH2 A;  4PQ1 A;  4ML1 A;  3F3Q A;  1M2D A;  3EU3 A;  1GUH A;  2RM5 A;  4EDY A;  1GUM A;  2HRK A;  3BBY A;  4XTS A;  4EC0 A;  3ZIJ A;  4FIW A;  4KF9 A;  1AW9 A;  4GSS A;  4EIP A;  4HQZ A;  3GSS A;  6GSY A;  3L4N A;  2JSZ A;  2VLV A;  1T00 A;  3TJB A;  4OO4 A;  2Z9S A;  5DAK B;  5D9X A;  1QGV A;  5IQY A;  5J9C A;  1SEN A;  2YWM A;  2FNO A;  4L8E A;  1VF4 A;  6GSW A;  3F9U A;  3DRN A;  2FWF A;  5BMU A;  2GGT A;  2CZ2 A;  2R37 A;  3C8E A;  3EE2 A;  4F0C A;  1XPV A;  4DSS A;  2C1Y A;  4TVE A;  1H4O A;  3CRU A;  3RHC A;  5B8B A;  3GUS A;  3VI7 A;  5F0G A;  4Z2U A;  5F05 A;  1K0M A;  1XW5 A;  4F03 A;  1SKW B;  1ZGN A;  3KIJ A;  2PWJ A;  1XIY A;  2X49 A;  4HDE A;  3HZ4 A;  3M9K A;  4TR4 A;  5ELG A;  3GUR A;  6GSV A;  3GN3 A;  3APO A;  3H79 A;  2L4C A;  3W6G A;  3CSJ A;  2B7K A;  1ST9 A;  4NHW A;  1CQH A;  3Q19 A;  1SD9 A;  3TUE A;  2B6M A;  2R6K A;  4O32 A;  1LBK A;  1J0F A;  7GSS A;  2QA2 A;  4CHS A;  5IMC A;  2BJX A;  1Z7P A;  1F6M C;  1BQ7 A;  4K8M A;  4POL A;  3NZN A;  2B5X A;  4CY8 A;  4KCE A;  22GS A;  1G7E A;  1K0C A;  2J9H A;  1U3A A;  3PPU A;  1PL1 A;  4E8H A;  1U3I A;  4K2D A;  3H8Q A;  2HRF A;  5DVB A;  3FZA A;  4J57 E;  4N0V A;  2VCZ A;  4AJ7 A;  4BVY A;  4CY6 A;  5HQP A;  4K5R A;  1K3L A;  4O92 A;  1BX9 A;  2P0G A;  2VLT A;  4ZXG A;  1DE1 A;  4FH8 A;  5AN1 A;  5IPG A;  4KND A;  2OAD A;  1JHB A;  4G0K A;  4MDC A;  3UAP A;  3LXZ A;  2TRX A;  2VM2 A;  5J4U A;  3GA4 A;  2E7P A;  4BWS A;  1GLQ A;  1Z3E A;  2DJ2 A;  4XS4 B;  4V2N A;  5ECM B;  4IEL A;  4K7N A;  3A5I A;  5CRW A;  3BD2 A;  2GLR A;  5ID2 B;  1GRX A;  5G1K A;  1NM3 A;  3DGQ A;  4OO5 A;  2VUP A;  2VCV A;  2IMD A;  2ON5 A;  5IMV A;  2HFD A;  3F0I A;  1F37 A;  5DCH A;  1VGL A;  3GX8 A;  1FG4 A;  13GS A;  2YOI A;  9GSS A;  5EPF A;  1M2B A;  1I9D A;  4HU9 A;  3RHB A;  3RPN A;  3KP8 A;  2MMN A;  2RUE A;  2VL2 C;  3DD3 A;  3QD9 A;  3ZTL A;  3QFA C;  3N9J A;  3KM6 A;  4KE3 A;  2KOK A;  2B5Y A;  1ZYE A;  2GTU A;  3GST A;  3TOT A;  3QOU A;  2H6X A;  3VI5 A;  1SK2 A;  3FKF A;  1QMV A;  1EWX A;  1K0O A;  2CZ3 A;  1HNA A;  5G5F A;  1AQX A;  2CVB A;  4N30 A;  3C73 A;  3O76 A;  4KH7 A;  1Z6N A;  4GLT A;  3IR4 A;  2GSS A;  3P8W A;  1MD4 A;  5KN0 A;  1J9B A;  3A2W A;  4MJE A;  4HZ4 A;  2MYG A;  2L57 A;  2E2M A;  4K1F A;  1B4P A;  2VLU A;  4G19 A;  3IHQ A;  1SL2 B;  2V6K A;  2H70 A;  1K0D A;  2CVK A;  2C0G A;  5DAL B;  2X8C A;  4GWR A;  3KJY A;  3APQ A;  2IFQ A;  3KH7 A;  1TK0 B;  4I97 A;  3MWH A;  3TRQ A;  5CYY A;  2C0D A;  4TR1 A;  4IN0 A;  2IMK A;  5CNW A;  3UEM A;  4AJ6 A;  1R5P A;  3HXS A;  1TDI A;  4TOP A;  3TKQ A;  3VWW A;  2NPB A;  4KGI A;  2MZC A;  1GSQ A;  3C1R A;  3P2A A;  4IJ3 A;  2H75 A;  2GZY A;  2NBS A;  1GWC A;  2FUG 2;  5ECR B;  1XWB A;  1JLW A;  5G2Z A;  4WBR D;  3TRX A;  3MNG A;  5DCG A;  1ZL9 A;  1JFU A;  5D9V A;  1A8L A;  3ZRE A;  3QR6 A;  3ZLP A;  4KDY A;  4TXV A;  2HE3 A;  2VAF A;  5D93 A;  2DBC A;  2AYT A;  1OC8 A;  3WGX A;  4MA9 A;  3QAV A;  1B9X C;  3IK7 A;  4D73 B;  1F2E A;  5DBQ A;  5F06 A;  2MBT A;  2CAQ A;  4KW6 A;  5HFI A;  2B3S A;  3F4R A;  3UAR A;  2PPT A;  1XVW A;  4I2T A;  2DKI A;  3HJP A;  3IRA A;  4F0B A;  1VRS D;  2PUK C;  1JZO A;  5CP1 A;  3EYT A;  1XFL A;  2KP1 A;  4N0Z A;  1EGR A;  5B6N A;  5CRG A;  2R0G A;  2HI7 A;  4N11 A;  1GTI A;  1DE2 A;  2HSM A;  3W8J A;  4ID0 A;  1G6W A;  1F3A A;  4OCE A;  3L9S A;  1BG5 A;  1ERV A;  4GXZ A;  5J41 A;  1FHE A;  1MDJ A;  3ED3 A;  5EY6 A;  4K5S A;  1SJ6 A;  3F63 A;  4MCU A;  5C00 A;  3ZYW A;  2XC2 A;  1XZO A;  3D22 A;  4KSM A;  2LQQ A;  4MLY A;  3F4S A;  4DEJ A;  2PU9 C;  2I3Y A;  3J7Y k;  3TJK A;  2KUC A;  4N10 A;  1YF0 A;  1W4V A;  4GTU A;  3I43 A;  3GX0 A;  4G10 A;  2PGT A;  3LJR A;  1XOA A;  3N5O A;  5ECH B;  2WUL A;  2H6Y A;  3ISO A;  3KXO A;  1GSE A;  4LMV A;  4ZB9 A;  4ZL9 A;  3F6D A;  1K0N A;  3FW2 A;  1GSF A;  1GTU A;  5AGY A;  2WS2 A;  1XCC A;  5ENU A;  2HXK A;  3M1G A;  1TRS A;  2H66 A;  2ZCT A;  5A4W A;  4K9Z A;  4X0X A;  2R0P A;  4I5Q A;  5JWR B;  2IME A;  4OCF A;  3R3E A;  4XCS A;  4MK3 A;  4ZBA A;  2E2G A;  4XHM A;  5AIS A;  5EVO A;  1I5G A;  5IO0 A;  1EV4 A;  4JBB A;  1LJR A;  3UVT A;  4JRR A;  2KLX A;  1S3A A;  1M2A A;  3EC3 A;  1X5C A;  1UN2 A;  3H4K A;  3IDV A;  2L5L A;  3HA9 A;  5CAX A;  2VOC A;  5GST A;  2HZF A;  1SKR B;  3WT2 A;  1A0F A;  3M9J A;  2CAI A;  4WR4 A;  4AGS A;  2WZ9 A;  3JCM L;  4X43 A;  1B9Y C;  2I9H A;  3HVX A;  2H71 A;  2P5Q A;  3BCK A;  4WKW A;  1B8X A;  3SWL A;  2V6O A;  5KN3 A;  2CV4 A;  4PQI A;  5DAK A;  2L6D A;  4MJB A;  2NVL A;  3AY8 A;  3DIE A;  3E0U A;  5GAN D;  1Z9H A;  4TXO A;  3NOF A;  3RBT A;  4WF4 A;  2H01 A;  1Y6E A;  3UIW A;  2BMX A;  2H1G A;  1YKC A;  4KSO A;  1BAY A;  2CX4 A;  4K0G A;  2LQO A;  2A2P A;  3C71 A;  4EXJ A;  4J2F A;  3A5W A;  5JCU A;  3GKM A;  4MF7 A;  4QL7 A;  1GTA A;  4ZBD A;  2A4V A;  2KP2 A;  1K0A A;  1A2J A;  5HR1 A;  3U6V A;  1FW1 A;  1OVN A;  3V1W A;  4KCA A;  3LWA A;  3DML A;  1T4Y A;  1O7U A;  2H6Z A;  2LNT A;  2H19 A;  5ECP B;  2DC5 A;  3UOM A;  4OWY A;  4DSR A;  4ZL8 A;  2JZT A;  4LLR A;  1Y25 A;  4BA7 A;  3HDC A;  5B8A A;  1ZOF A;  1F9M A;  3BOA A;  2GZP A;  4MZW A;  4A5P A;  2H1A A;  4L0W A;  4O7H A;  5ELA A;  4Q5N A;  5IO2 A;  4XRA A;  4WR5 A;  4JZQ A;  3WYW A;  2R4V A;  1NW2 A;  4TW5 A;  2RUF A;  4O5U A;  3R2Q A;  5FHI A;  3D0Z A;  1O85 A;  3ZZX A;  2WDU A;  2XBI A;  2OKA A;  3S9F A;  3PGT A;  3IXR A;  2YNX A;  3LGC A;  1IYH A;  2ON7 A;  12GS A;  4JE1 A;  4NMU A;  5D8I A;  2EC4 A;  2FHE A;  2F9S A;  1EP8 A;  4GCI A;  1S3C A;  1GSU A;  1WOU A;  2V41 A;  2H72 A;  2FWE A;  2FA4 A;  2H0H A;  4MZC A;  2YWO A;  1O8W A;  4ZB6 A;  4XS4 A;  5KN2 A;  5IM9 A;  5JWQ B;  5IIZ A;  4TN8 A;  2HZE B;  2ZNM A;  5ID2 A;  4YKG A;  4XRD A;  4Z7X A;  2EIR A;  3FR9 A;  3GL3 A;  4BL7 B;  1XBS A;  2O7K A;  3FR3 A;  1GUK A;  1M0U A;  2CA8 A;  1QQ2 A;  2J23 A;  3KH9 A;  2GSR A;  1A2M A;  2AAW A;  2XPE A;  2ES7 A;  1UA5 A;  2IIY A;  3APS A;  4EUY A;  1W89 A;  4KA0 A;  1OC9 B;  2H73 A;  3TJF A;  1QFN A;  5E4W A;  1FAA A;  3Q74 A;  1WRY A;  5LCZ A;  3ME8 A;  3FK8 A;  3U5R E;  1C72 A;  4MP4 A;  4EVM A;  1DSB A;  3DVX A;  1TKD B;  3BCI A;  1EV9 A;  5H5R A;  1O73 A;  4GF0 A;  4ZB8 A;  1BJX A;  1HD2 A;  3TKS E;  4ZIJ A;  3EWL A;  3WT1 A;  4QL9 A;  4G2E A;  1MDI A;  3TOU A;  5B6M A;  1H75 A;  1K0B A;  2DJJ A;  4PNG A;  1YKA A;  4EKZ A;  1LU4 A;  4IHU A;  1ZYN A;  2HSY A;  1ILO A;  4J56 E;  1PX6 A;  2B7J A;  3TB2 A;  2JSY A;  1WPI A;  3UL3 A;  3LOR A;  3EPT A;  1RW1 A;  3FZ5 A;  5IOW A;  1E2Y A;  2VCX A;  4H86 A;  1XWK A;  2VL2 A;  2H1D A;  1SL0 B;  4POK A;  2MBS A;  6GSU A;  2CX3 A;  4XS6 A;  3D6I A;  2G2Q A;  2YP6 A;  1R4W A;  3EIN A;  2F8A A;  1ZMA A;  2YJH A;  1WP0 A;  3UVH A;  1V57 A;  1TRV A;  3GYK A;  3KP9 A;  1CQG A;  2I1U A;  5DAL A;  2K18 A;  1PD2 1;  5EL8 A;  2O87 A;  3F4T A;  2PVQ A;  3MAK A;  3GHA A;  2AJQ B;  4ECI A;  1T8E B;  3LXT A;  1KNG A;  4JR6 A;  3VUR A;  4IP6 A;  1S3D A;  1V40 A;  4K2X A;  1A23 A;  1KEB A;  5ECI B;  5D73 A;  3IK9 A;  1TP9 A;  2DJ0 A;  3DXB A;  3O3T A;  3LEF A;  3L9U A;  4G0L A;  1A0R P;  1Q98 A;  2YN1 A;  2PMT A;  3TKS A;  3M0F A;  5ECS A;  2YWI A;  5J3R A;  1VF1 A;  2X99 A;  4IBP A;  4HI7 A;  1BYE A;  2R5G A;  4USS A;  1TK5 B;  3TKR A;  2YJ7 A;  4Q5R A;  4IVF A;  2LV3 A;  1WMJ A;  2H8L A;  3IC4 A;  4WEY A;  5COH A;  1XWA A;  4D73 A;  4IS0 A;  1YJ6 A;  4Q5Q A;  2A2S A;  1ZYP A;  4MNN A;  2FLS A;  3FZ9 A;  1YEP A;  1G6Y A;  1MDK A;  2H30 A;  2YWN A;  3IPZ A;  3RPP A;  1FB6 A;  1GSS A;  3QAG A;  2DIZ A;  1ZCP A;  4ISD A;  5H5S A;  3K8N A;  3CMI A;  1FOH A;  5INY A;  3GTU B;  4NAX A;  2IN3 A;  2DKH A;  2YPM A;  4K7I A;  1TW9 A;  2C3T A;  2GS3 A;  3EVI A;  6GSS A;  2WFC A;  4OFT A;  4WF5 A;  3RAZ A;  3D21 A;  3A2V A;  2GT5 A;  1U88 A;  4ZL7 A;  1IYI A;  4PQH A;  3ZIT A;  1TI1 A;  5D9W A;  3ZIV A;  2DJ3 A;  3EUR A;  4O5Q A;  5FWG A;  2OAC A;  1KTE A;  1ACV A;  1OAZ A;  3HVS A;  8GSS A;  5FT3 A;  1PGT A;  2IPA A;  2GVP A;  2CT6 A;  1SU9 A;  2K8S A;  4KX4 A;  10GS A;  4JU5 A;  4HU7 A;  3I69 A;  2C8U A;  3GKX A;  2VCT A;  3QPM A;  1T4Z A;  2V32 A;  1R7H A;  4FO5 A;  2VM1 A;  3ZVJ D;  1AUC A;  3F6F A;  1YZX A;  1BED A;  4IQ1 A;  1EOG A;  4L5L A;  6GSX A;  4EDZ A;  4KAE A;  5ECQ B;  3VK9 A;  4JED A;  5ECK B;  2QGV A;  3HJM A;  4MZB A;  5IMA A;  4AF2 A;  1QXH A;  3TKP A;  4YQM A;  4L5O A;  5IOX A;  2DJ1 A;  3WGD A;  2QA1 A;  4HEA 2;  3ZMK A;  1MD3 A;  3IC8 A;  3GNJ A;  2IMF A;  4YKF A;  1F3B A;  3VLN A;  3HZ8 A;  2VCQ A;  3DEX A;  4X1U A;  4GRF A;  2L5O A;  2A4H A;  2C3Q A;  4F9Z A;  1M9A A;  1T1V A;  4HZ2 A;  2FA8 A;  3WD6 A;  5D96 A;  1SK1 A;  1PN0 A;  3O6T A;  3HCZ A;  2P5R A;  4LL1 B;  1FO5 A;  1AC1 A;  5GZZ B;  3VFI A;  2YV9 A;  2GQL A;  3D4M A;  4I6X A;  4K7O A;  3HYP A;  1PL2 A;  3QCP A;  3TCO A;  2IJY A;  1PSQ A;  1SKS B;  5C04 A;  1XXU A;  2OA7 A;  3IV4 A;  2LEG A;  1GUL A;  2C0F A;  2PVO C;  3F8U A;  2K6V A;  1PKZ A;  5J9B A;  1URM A;  2MMA A;  3GRX A;  2K9F A;  1THX A;  4V2L A;  1MEK A;  4HOJ A;  3L0H A;  2B1K A;  5L71 A;  1NHO A;  4POM A;  2LJK A;  3CRT A;  4TR0 A;  4IQA A;  2HNL A;  2PN8 A;  4MPF A;  1FVK A;  1VF3 A;  2DMM A;  3EU4 A;  6GST A;  3HD5 A;  1GP1 A;  3PIN A;  1FOV A;  11GS A;  3TDG A;  2FGX A;  3H1N A;  3E9J B;  5DDL A;  1Z6M A;  1PKW A;  3GH6 A;  2IWT A;  2O85 A;  3P90 A;  1SD8 A;  1GSD A;  1Q4J A;  3ERG A;  4PUR A;  1WE0 A;  3CXG A;  1V98 A;  3D5J A;  4FYU A;  17GS A;  2M72 A;  1XW6 A;  5GAP D;  4I2U A;  2X64 A;  1A24 A;  4RI7 A;  2C3N A;  3DKS A;  2L4Q A;  1GSY A;  3WGE A;  3ME7 A;  1U87 A;  3GKK A;  4ECJ A;  1N2A A;  1YF1 A;  1X0R A;  1HNC A;  2H0G A;  2GSQ A;  4GST A;  4HUA A;  2R2J A;  2JAC A;  5AIX A;  5G5E A;  1TJD A;  4E8E A;  1UVZ A;  3KTB A;  5ECL B;  3I6A A;  3KEB A;  3LW9 A;  4MJA A;  4BVX B;  4FYB A;  2QSI A;  1O6J A;  2YZH A;  2HZE A;  3HY2 A;  1X9S B;  4BL7 A;  2IMI A;  3CSI A;  1O8X A;  5LNK e;  4MPG A;  3VPT A;  4EF0 A;  5DQS A;  1OE7 A;  4TXO B;  3ZL5 A;  4RQR A;  2HYX A;  2OE0 A;  1Z5Y E;  2O8V B;  3KMN A;  5H5Q A;  2TRC P;  2RII A;  3IA1 A;  1PA3 A;  3ERF A;  4EIQ A;  3ZFB A;  1OC9 A;  4PTS A;  5KEJ A;  4YH2 A;  1SYR A;  3L78 A;  1XWC A;  3PH9 A;  2DJK A;  2HRN A;  2UZ8 A;  1HNB A;  3C7M A;  4Z2T A;  2F3M A;  3FZ4 A;  2AV4 A;  1K3Y A;  5JCG A;  2HLS A;  4TKY A;  4TRX A;  2JZS A;  2LST A;  2V2G A;  1TI3 A;  3FYG A;  4GQF A;  2REM A;  4L0U A;  3GKN A;  3Q6O A;  5BRT A;  1M9B A;  2YAN A;  4OMV A;  4MJC A;  3F3R A;  1EOH A;  2OBK A;  5DJL A;  3C1S A;  4MF6 A;  2H76 A;  5G30 A;  1SK0 A;  3TRP A;  3CBU A;  3GV1 A;  4KDX A;  2LJR A;  3TJJ A;  2AUV A;  2K8V A;  3PR8 A;  2P31 A;  3SBC A;  3LG6 A;  5A4V A;  3TGZ A;  1GNE A;  4G9H A;  2N5A A;  4DSS B;  4F82 A;  4FQU A;  1G7O A;  2KHP A;  1ZYQ B;  1TU7 A;  2LRC A;  2DSA A;  3KTL A;  16GS A;  1VF2 A;  3Q18 A;  5D9T A;  2JU5 A;  2H74 A;  2VL3 A;  4ZIL A;  2N5F A;  3I9V 2;  1QUW A;  3KCM A;  4MAB A;  4V2M A;  2XPD A;  4ULX A;  2YZU A;  2GDR A;  3IOS A;  4NV2 A;  3LYK A;  1EGO A;  2C4J A;  2E0Q A;  2EIO A;  4O5R A;  1EEM A;  1YY7 A;  2HT9 A;  1X9M B;  2VCW A;  3M8N A;  3DWV A;  4YAV A;  5F8B A;  1SJI A;  4WET A;  1TU8 A;  4Z2R A;  2QKE A;  5HR3 A;  5E59 A;  3VWX A;  4GQC A;  5HR2 A;  3M3M A;  2LTK A;  5A4U A;  1ML6 A;  1TOF A;  1FVJ A;  4OFM A;  5IMZ A;  3LYP A;  1ERT A;  1ABA A;  1TXX A;  1OC3 A;  3CSH A;  1YEX A;  2B5E A;  3TJG A;  5G31 A;  3MIX A;  1DBY A;  1XWG A;  2OE1 A;  3VWV A;  1GL8 A;  3IBH A;  1EEJ A;  1ERW A;  1X5E A;  4BVY B;  1WWJ A;  3MYD A;  3QDN A;  3LQ7 A;  2OJL A;  2YV7 A;  3KMO A;  5CRD A;  3A3T A;  3MDK A;  2R0C A;  3QMX A;  4ECC A;  2MMO A;  4JR4 A;  1GTB A;  19GS A;  3HKR A;  2M46 A;  3DYR A;  1TTZ A;  2GT6 A;  2WB9 A;  1TRW A;  4I8B A;  3GTU A;  3G7J A;  1UC7 A;  1M99 A;  4QQ7 A;  4KDU A;  1N8J A;  2V1M A;  4ILF A;  5LD0 A;  3GH9 A;  5HR0 A;  2MMZ A;  4GSN A;  1WJK A;  5JCW A;  1V58 A;  1O81 A;  1U6T A;  4IJI A;  2CQ9 A;  2M80 A;  4HJ2 A;  1B48 A;  2PBJ A;  5HFK A;  2LKU A;  2WJU A;  3TKS C;  1Z7R A;  2XHF A;  2OE3 A;  4ECB A;  1XOB A;  2DML A;  3FMW A;  3KZQ A;  4XIH A;  3EMX A;  1JZW A;  4HQS A;  4KB3 A;  3IHG A;  2BTO T;  5G1L A;  2R3X A;  1R5A A;  3MSZ A;  3GIX A;  4WBJ A;  2OBI A;  1A8Y A;  2YCD A;  3US3 A;  1EP7 A;  1AXD A;  1X5D A;  3D4T A;  1ZZY A;  2ZUP A;  4RQX A;  2JL4 A;  1ERU A;  5DJM A;  5DQY A;  1PMT A;  1T7P B;  3ZVJ A;  4DSQ A;  3VPQ A;  2LRN A;  1JZR A;  3FEU A;  4DVC A;  3GFK A;  1HQO A;  1V2A A;  2VD1 A;  1NHY A;  4KUN A;  1G0T A;  3HHV A;  14GS A;  4Q5F A;  4HS1 A;  5JWO B;  2NDO A;  5KOW A;  20GS A;  4WXT A;  4XS1 A;  5IPH A;  4K6X A;  4ICY A;  3KD0 A;  2X4A A;  3QFB C;  1A2L A;  1E6B A;  3UMA A;  5ABR A;  4NHZ A;  3LSZ A;  1AAZ A;  2AB6 A;  4PX1 A;  1JLV A;  3ZML A;  3QAW A;  5CRE A;  2GQM A;  1PRX A;  4TR3 A;  4AJ8 A;  2FD3 A;  2NTO A;  2LRT A;  3G9B A;  3A2X A;  4BWQ A;  4ACS A;  1X9W B;  4PNF A;  1YQ1 A;  4RI6 A;  3G7Y A;  2IFQ B;  3FR6 A;  4IKH A;  3UBL A;  1XW9 A;  4TR1 B;  4MH2 A;  5KOX A;  3GMF A;  4IP1 A;  2I81 A;  4G0I A;  4F2I A;  1T3B A;  1YDK A;  2LJA A;  4CDO A;  5GSS A;  4CW9 A;  4BPY A;  2XBQ A;  3RDW A;  2CVD A;  1OKD A;  4MF5 A;  4MH3 A;  5HFG A;  1FB0 A;  1TK8 B;  1JZD A;  1TRU A;  2GST A;  4EE0 A;  3EMP A;  4OFN A;  4YQU A;  2RLI A;  3CYN A;  4P3Y B;  3IAM 2;  2FWH A;  2IL3 A;  5J5N A;  2WRT A;  3ZFL A;  1EZK A;  3P7X A;  1XVQ A;  2RM6 A;  1RQM A;  3FHK A;  2VD0 A;  1OYJ A;  3ERW A;  2FCH A;  4PXO A;  4RUV A;  2C80 A;  4LMW A;  5B7C A;  3DVW A;  2EIQ A;  4PGT A;  1J08 A;  2JAD A;  2O89 A;  4V1A p;  2X8G A;  3HVV A;  1PQN A;  1QK8 A;  1OKT A;  3IAS 2;  5IMD A;  4IGJ A;  5A5K A;  4EL1 A;  1PX7 A;  2N5B A;  5AIV A;  2DIY A;  1NSW A;  1SYX A;  2A2R A;  3H93 A;  4YAP A;  2LNS A;  1MTC A;  4EO3 A;  1DUG A;  1R26 A;  1AQV A;  2F51 A;  1RK4 A;  4K0N A;  2LS5 A;  3CTG A;  1HYU A;  2LUS A;  1THO A;  5ECO B;  2PER A;  2L59 A;  1M7T A;  4NXI A;  2D2Z A;  4PUF C;  4OD7 A;  2H0I A;  3VWU A;  4HJM A;  2GZZ A;  2VIM A;  4LA1 A;  1AQW A;  2DLX A;  3W8S A;  2QC7 A;  5CRH A;  3ZRD A;  2FY6 A;  3L9V A;  3KGK A;  4LL4 B;  5CO3 A;  3LFL A;  18GS A;  2H1B A;  4POB A;  3J7Y b;  1AIU A;  4NV5 A;  3HJO A;  2C0E A;  4ZBB A;  1K3O A;  1KBN A;  2TIR A;  2L6C A;  2VL9 A;  4BVX A;  4PUA A;  5F07 A;  1SL1 B;  4ML6 A;  1OE8 A;  1PN9 A;  5ECN B;  4X4J A;  2G0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...