3FZDA

Mutation of asn28 disrupts the enzymatic activity and dimerization of sars 3clpro
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
299
structure length
296
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLAGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Mutation of Asn28 disrupts the dimerization and enzymatic activity of SARS 3CL(pro) .
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 79
structure length 296
sequence length 299
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3fzdA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fzdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fzdA02
3KQCA 1QTFA 1EP6A 2FOMB 1UTLM 5AVDA 5C5NA 3SQEE 4NA9H 2VNTA 3ZVDA 1DXWA 1W0YH 1GDNA 1P3CA 5A8ZA 2ZDKA 2O8LA 5TCCA 2Q6FA 1SC8U 4FUDA 5EG4A 1GI4A 1AFQB 3S9BA 1Y5AT 4F4OC 3EA7A 3RLYH 1CGHA 3TJUA 3UWJH 1O31A 2FTMA 2XBXA 2Z6BD 5HGGA 1OWDA 3OU0A 1T4UH 4Y8XA 3TVJB 2OQUA 2XCNA 1TGTA 2QIQA 3SI4H 1BMLA 2BLVA 1Z6JH 1XVMA 3F9FA 1T4VH 1H9LB 1Z7KA 2QXGA 1SGQE 1WSSH 2RA3A 3MH6A 3OSYA 4ISNA 2QAAA 3M7UA 1UK2A 4GCHG 2FEQH 1UHBB 3A88A 4IMQA 5E2PA 1HAYB 1DLEA 1ZPCA 1G30B 2WPJS 1C2JA 1OKXA 1GBTA 3EQ0H 2GV7A 3VXFH 2SGQE 3S9CA 1N1LA 3A81A 2AIQA 1ELGA 3RXOA 2FODA 1O2QA 3BF6H 3VXEH 5EGMA 2RG3A 3EA8A 4KGAA 5F8ZA 1LHFH 3HATH 3U1IB 3ATMA 1MTNC 4MNVA 2FIRH 4Q7ZA 9LPRA 1EAUA 1SLXB 3LGWA 3D49H 2ZTZA 3RMNH 1C2LA 3QUMP 1SHHB 5J4SA 4YZUA 1E38B 4BTTB 4CRBA 1A7SA 1PPEE 2V0BA 1MCVA 2Z3EA 1WAYB 3TITA 1MQ5A 2PSYA 3GDUA 4X2XA 1C1SA 4NSVA 1LHEH 2G4UA 5PTPA 1ETRH 1BTHH 1VITF 2TGTA 3ZZ5A 2SGFE 4A92A 4IC6A 1FV9A 4GUXA 3GOVB 1O2KA 2VIVA 1KDQB 1GJ4H 3SNDA 3RC4A 4IN2A 3UNRA 1LPKB 2FS8A 2TGPZ 3M37A 1LVBA 2EI6A 4U30A 1IHTH 1TPSA 3TJOA 3UOPA 3S7HB 1ELBA 1HAHH 1O2MA 1MU8B 3UR9A 2FOBA 1QA7A 3RXMA 1BHXF 1HAXB 5EXNA 5C3NA 2BMGB 4IMZA 4TPYA 2NU2E 1YPHE 1S83A 4Y71A 1OX1A 1OP0A 1W14U 1ZJKA 1DWEH 1F0RA 1J17T 2CV3A 1WOFA 2W5EA 1V2JT 1E35B 1O0DH 4CBNA 1AE8H 4CBOA 3ITIA 1EPTA 1RXPA 3DD2H 4CHAC 1A5IA 2BDAA 2FOFA 1DFPA 4NZLA 1P57B 4B1TA 1ELCA 2P95A 5FPSA 3AAUA 4RKJB 1GVZA 1TGNA 3TGKE 4FUJA 1AZZA 3LKWA 1PYTD 1NM6A 4ZKRU 2CMYA 3RXDA 1S5SA 1A3EH 1LHDH 2VVVA 2W3KA 1DWBH 1S81A 1TBZH 2P59A 1LQDB 2VVUA 2FLBH 3KQBA 4X6MA 3SU0A 4YM9A 3T26A 4AG2A 4H6TA 4HZHA 4TY7A 2CF8H 4UD9H 2XWAA 1DUEA 5FHTA 3K2UA 1TNLA 4QT8C 2ZQ1A 2ODPA 1EZXC 3AVZA 2CHAC 3SJ9A 4CHAB 3SJKA 3RM2H 1DANH 1JWTA 3T29A 1HAZB 5K7RA 3TH4H 1YC0A 3SORA 4YO9A 2W7UA 2O8WA 2HPQH 4XOJA 4Y11E 3Q00A 3LT3A 3MU8A 1ZTJA 4WY3A 2PWXA 2QXIA 2J95A 1EZQA 3TJNA 1A0JA 2PTNA 3JZ1B 1P04A 2BDBA 5LPFA 4FUCA 3O8BA 4XBDA 1THPB 4J1YA 1DXPA 1Y3WA 2J92A 1OWHA 2A4GA 4XBCA 1OYTH 3M5OA 4ABJA 1DX5M 1NFWA 5H4IB 1K2I1 5JYIA 3FANA 1TX8A 2G52A 3KQEA 4I8JA 4NCYA 1HIAA 5FAHA 3ZZCA 3M7TA 2BY6X 2BXUH 5F6MA 1SB1H 3RP2A 1YBWA 2PFEA 4VGCB 1DVAH 4Q7XA 1TX7A 5C1UA 1W8BH 2OUAA 2SFAA 3LPRA 1S84A 4Y79A 4B2CA 1RD3B 4BTIB 3CP7A 1XUGA 1ELFA 2QF0A 3W95A 1MH0A 4NZQA 2P94A 1ZHMA 4I33A 4ZXYH 1DY8A 2ZCLP 3A7ZA 3LDXH 1CGIE 2R0LA 2XBWA 1G3BA 4WF8A 2ZC9H 2BD8A 1EZUC 1HYLA 8GCHF 4Y7BA 4LZ1H 4ZUHA 1K1JA 1EJMA 1AY6H 1LQEA 4XSKU 1TA2A 1VGCB 3DFLA 3RXSA 3KQDA 2VIPA 1JOUB 4J2YB 5EQQA 3S9AA 1SLVB 4KTUA 2TGAA 5DPAA 4MNYA 3ZVCA 1C5XB 1O34A 1SSXA 4MVNA 2ZEBA 2WINI 2OC7A 3LJJA 5EPNA 6ESTA 1UCYK 3VB3A 1L1JA 1D4PB 3TH2H 1A46H 2H2ZA 2J4IA 4OS2A 3ZVGA 1TOCB 3I29A 4ISOA 4IW4E 1QQ4A 1P2JA 3R0FA 1A0HB 5DP6A 4D9QA 2KAIA 4JZ1A 3RMOH 2TBSA 3VB5A 1UCYH 1HDTH 1VJAU 1S85A 3SU2A 3LIWA 4WWYA 2BM2A 4FU7A 1SG8B 4AB8A 4PROA 2UWOA 1ZTLA 5I25A 4UFFH 4O3TA 1N8OC 3RC5A 2JH6D 5GJ4B 2LIZA 1NFUA 2ZPQA 4GPGA 1AVXA 4MNXA 3BEIB 3HGNA 4D9RA 1UTMA 2ZQ2A 1TGSZ 1Z8JB 5T6GA 4ZKNU 1ZZZA 3U1JB 5DKMA 3NKKA 1KYNA 4Y6DA 4UE7H 1TRMA 2FI3E 1O3JA 1UTOA 1QB1A 1TAWA 2G5NA 1WTHD 5LPEA 2HPPH 4F49A 1CQQA 2ZIQH 3VB4A 1GVLA 1XXDA 3ATKA 4AORA 1N8OB 1NTPA 1LCYA 2R2WU 2M5TA 1XUJA 1FPCH 1UTPA 3QZRA 1Z6EA 5JB9S 1ETSH 1WU1A 1LKAA 3GYMA 5C67A 2WPMS 4WMDA 3GY6A 2W26A 2P3UB 3MNXA 4M7GA 5AFZH 3RM0H 1WBGB 1DM4B 4AFUA 3LGVA 5ABWA 4KP0A 2VINA 1JBUH 3PLPA 1VR1H 3M5LA 3P6ZB 3ENSB 1AKSA 4OS7A 2F9NA 4DW2U 2DE8A 5JBAS 1TLDA 5FBEA 3E1XB 3MYWA 5T6FA 1MTVA 3C1KA 1AB9C 4JYUH 2ZCHP 1Z1IA 1TB6H 4Y7AA 4ZHLU 1FN8A 1IQNA 3RXRA 3V12A 4UDWH 1BMMH 1NT1A 3KF2A 2ZHWH 3E0NB 1C5VA 4NWKA 3H7TA 1P2QA 2YNAA 3TGJE 2NU3E 1C1TA 2OP9A 1HJAB 1UCYE 2ASUB 1P2OA 3PWCA 2IOTA 1HAOH 1HB0B 1SOTA 1TQ7B 2NU0E 3BTQE 1BCUH 2UUYA 5I46H 3SBKA 1TPAE 3L6PA 4ZH8A 4ABFA 3L3TA 4R0IA 1DWCH 2VVCA 1UVPA 1AIXH 1O3PB 1THRH 3A7VA 5A2MH 4KTCA 6GCHG 3GCHB 3SNEA 2ODQA 4D7FA 3H5CB 2A5AA 1AB9B 5TCAA 1HJ9A 1SMFE 4XDEA 2PW8H 5CHAB 4DCDA 3DT0H 5JBTA 2AEIH 4WXVA 1WYKA 3W94A 1JMOH 1YLCA 3MWIU 4MG3A 1T8LA 1F5KU 3O8RA 4A5TS 4X8TH 3MH7A 3F1SB 1ZOMA 5J4QA 1XVOA 1GI3A 3RU4E 1EJNA 1G32B 2F3CE 1V2UT 5FBIA 1C2IA 1EXFA 1BITA 3MTYA 3MNBA 1VJ9U 3ZYDA 4AGKA 4B2AA 3QLPH 3ZZ4A 4TPIZ 1PQ7A 5DJ7A 4BAOB 1OSSA 4A1TA 2QF3A 1T8MA 4THNH 1QL7A 3ZZDA 1IQFA 2AERH 3M7QA 1FAKH 3GCTG 1JXPA 1V2WT 3T2NA 3GDSA 4NSYA 1C5LH 4JCNA 1V2OT 1D9IA 1GL0E 1OWKA 1OPHB 3SUEA 1EJAA 1WV7H 3MH5A 1SGFA 2ZDNA 4BAKB 1TNJA 4K5ZA 5DP4A 1C1NA 1V2RT 3VGCB 5JDUB 2AMDA 1EPTC 2BQ6B 3Q76A 1GBEA 1INCA 1SPJA 2ILNA 1GI8B 1O5DH 2Y5GA 4H6SB 2W3IA 4Y0YE 1AVWA 1EATA 1O32A 2BD4A 3SGQE 2R9PA 1HAGE 1RTKA 4U2WA 3KNXA 4LK4A 1AN1E 5C1XA 4Y8YA 1ZR0A 2ZECA 1BHXB 1T7CA 3PMHB 4OGYA 2Q6DA 1TNHA 1L0ZA 3BSQA 3RXCA 5DP9A 1ELVA 3RXQA 3Q3KA 1A3BH 4O9VA 4AX9H 2GDEH 3PO1C 4CRCA 4INKA 5A09A 3GY5A 4ZHAA 1QB9A 2PKAA 2BVSH 1GBHA 3SJOA 2XC5A 1VITG 2OCVB 4AG1A 8ESTE 5EODA 1GVKB 1GI1A 4YT7H 4A1VA 1V2TT 2ZU3A 1JIMA 1NRPH 2HNTE 1O30A 2A4RA 3SGBE 3QZQA 2A7HA 1IQKA 3HKIB 3RXIA 1P3EA 4BAHB 2IN2A 1PYTC 3UY9A 1YYY1 2PGBB 2ALPA 1OS8A 2O8UA 3PO1B 3RXHA 3LGTA 2XTTB 3P8GA 4B76A 2RDLA 2ZGXH 3O8CA 1O2LA 1O39A 3EBNA 1HXFH 1W12U 2OLGA 3PMAB 1O2SA 1HAPH 4MPXA 1ARBA 2GCHF 1XXFA 1RTFB 2ZTYA 1V2QT 1AU8A 3V3MA 1VCPA 1YKTA 2F9BH 2R0KA 3MNSA 4JYVH 3V0XA 4NFEA 3CS0A 1ESBA 1IAUA 3GCTF 1G37A 1UO6A 1GJ6A 5C2ZA 5T6DA 3PB1E 1O2ZA 1FNIA 1ZRBA 3UUZA 4E7RG 1XMNB 2AGIX 1P2IA 2Y7XA 2BQWB 1VZQH 2CF9H 4I8HA 1OP2A 2FXRA 1FY3A 2ZGBH 1O2UA 3P70B 2BDIA 2R3YA 3GYLB 2V3OH 3T27A 7GCHF 4UFEH 1A0LA 2B7DH 2H5DA 3RDZA 1UVOA 1NRRH 2BD7A 1AO5A 1QCPA 5K0HA 3TK6A 2BD2A 4FUEA 4A1XA 1HIAB 3UNSA 3TIUA 1DE7H 1NO9H 2PLXA 1SGNE 1BRAA 2DE9A 1DDJA 2EA3A 1O37A 2P3FH 1CSOE 2J2UA 5EXMA 1EKBB 2QCYA 2XRCA 3EA9A 3SU6A 2H5CA 1TMTH 1MTUA 4Y76A 3FZZA 1IQIA 1AWFH 6LPRA 1Y8TA 3LC3A 3BN9A 3FAOA 3PTBA 1YPJH 3ZVFA 1C4V2 3QK1A 3EAJA 5DGJA 1GBFA 1GWAA 2EC9H 3EDXB 2OC8A 5C1YA 5JPMH 1SGRE 4BNRA 1UTJA 4DIHH 2C93B 2GZ7A 3GY4A 1C2KA 4GSOA 1TPPA 1CHGA 2D1JA 2WPIS 3A80A 1HPGA 1HBTH 2IPHA 1MTNB 1YM0A 4JMYA 3QX5H 3TJVA 4JZDH 2ZZUH 2JKHA 1V2ST 1V2PT 5JBBS 1Y5UT 4ABDA 1GI6A 1GHYH 1TMBH 4FUGA 1PQAA 2BD5A 3ATLA 4TWWA 1ACBE 1T8OA 2ZDMA 4K8BA 1TBRH 3BTGE 4U01A 3K6YA 3OX7U 1J8AA 1O33A 3P8OA 1Q3XA 4IC5A 1NU7B 3LJOA 2OXSA 1VITH 2AIPA 1GBIA 1SFQB 2C8WB 1F7ZA 1Z71A 2G4TA 3BTTE 3WY8A 4MQAA 4MTBA 1OP8A 1IQHA 3JZ2B 1ORFA 5DP7A 4B2BA 1LKBA 2KAIB 1H1BA 2BLWA 4K1TA 1SL3A 3T5FH 1NPMA 1C1RA 1ZJDA 4AYYB 1CE5A 3FP6E 2STAE 1YLDA 1SQTA 4GAWA 2FS9A 2UUKB 3V13A 3BV9B 2TRMA 4BAMB 2VWMA 8GCHG 1P01A 3STIA 1C1QA 1JRTA 1ZGVA 3MHWU 4DT7B 1BRBE 1ZSJA 3ESTA 4NWLA 1GCDA 1BJUA 2HWLB 1GJ8B 1P8VC 1XUKA 2GZ8A 2ZPRA 5EOKA 2G55A 4AYVB 4KELA 1DS2E 2D2DA 1UMAH 1OOKB 4INLA 2ZNKH 1TBQH 3URDA 1TFXA 2ZDLA 4A6LA 1P2NA 2GX4A 1QBVH 3N7OA 1QY6A 1P0SH 3LGYA 4H4FA 1O2JA 3FVFB 4YLQH 2AH4X 1BZXE 4FUHA 5GCHF 3AW1A 4HTCH 1CVWH 1KXCA 1T8NA 1QL8A 4NA7A 2SGEE 4YLUA 2HNTC 1MQ6A 1RS0A 1DLKB 2A45B 5ESBA 3SO3A 5L6NH 2UWLA 3BTFE 4ESTE 2G00A 1OWJA 3GCNA 2GVFA 2ZGCA 1TNKA 1PPHE 2W7SA 1D6RA 2ODYB 2ZHFH 1MCTA 1C5PA 1FMGA 2A2XH 2BVRH 4X1RU 2WYJA 4K2YA 4Y10E 1XX9A 4ABBA 4IS5A 2XBVA 2C3SA 1AKSB 1ZHPA 1MBQA 2CHAB 2ZI2H 2ZTXA 3MU5A 3RUOA 1NN6A 4CRAA 4UONA 1T32A 1GJDB 1OWEA 4YOJA 1BRCE 4B75A 2FDAA 1GGDC 2OTVA 4X8SH 1A1RA 1FUJA 3TNTA 4JZIA 2JETC 1YP9A 3K65B 3S7KB 3SI3H 4ABEA 1V2NT 2HGTH 2ZG0H 3CS7A 2ZFSA 3D62A 3U9AH 2F9OA 4FUBA 3SU1A 3STJA 3U8TH 1FZZA 2PV9B 2Z9GA 2A2QH 2Z7FE 2V3HH 1HCGA 2F9VA 4AFSA 3KEEA 2A5KA 2P3TB 3OY6U 4B73A 2GD4B 4ZROA 2FI4E 2Q6GA 1IQLA 2ZA5A 2SNWA 1P09A 1QGFA 1NFYA 7ESTE 3BEUA 3ZZ3A 2J38A 2FYRA 1Z8GA 2BDCA 1UVUH 4XBBA 4MNWA 5GPIB 1P03A 2Z9JA 1S6HA 2JETB 1W7XH 2IJOB 3ZZ6A 4FU9A 1P9SA 2HALA 1O2GH 4ISHH 2ZFQH 1KDQA 2BOHB 3PTNA 1NROH 4LOYH 2AMQA 1GHBF 1GBMA 1CHOF 1GBLA 1TRYA 5F8XA 4I8KA 3HK6B 1GI9B 1BTUA 1E0FD 2THFB 4NFFA 3RMLH 1ZRKA 2BXTH 3RXVA 4ZHMU 1BTZA 2SGPE 4MPUA 1CO7E 5AHGH 2FOAA 1C2MA 1O5CB 2ZCKP 2GV6A 1IQMA 1MD8A 4NIXA 1H4WA 1YGCH 2P16A 2HRVA 5GWZA 1GHXH 2XCFA 1G3DA 1WCZA 4IN1A 1LO6A 1B7XB 4K69A 2XC4A 3VFEA 1L1GA 1O2NA 4OS5A 1GG6C 3DA9B 1C1WH 1CT0E 3QTOH 1RIWC 1K1IA 1UVSH 1NRSH 3PWBA 3RXFA 2VWOA 3QTVH 1VCWA 1GI7B 3KL6A 1UTNA 4Z6AH 1ZGIA 5DO4H 1IQJA 1MAYA 1BTWA 1O3GA 3HKJB 3QWCH 1SBWA 2ZFPH 5E8EH 5FXLA 5T3HA 1SGDE 1ZHRA 4X6NA 1SGYE 1K28D 1QBOA 1FJSA 4JK5A 4WMEA 2Z3CA 3U69H 1FQ3A 1GHAF 4NG9H 1K1PA 3URCA 2GGVB 1C1VH 1D3DB 4GHQA 1SGEE 5EU8A 1S6FA 2A0QB 3A8CA 3GDVA 1GG6B 2A4OA 2XXLA 3MNCA 3KN2A 2VU8E 1O5FH 4IBLH 1RIWB 4ISLA 2Z3DA 1P11E 1C5YB 1V2KT 1SLWB 1QHRB 2QY0B 1O3CA 2ZDAH 4K8YA 3A8AA 1Y3XA 1RTLA 1YCPK 1QJ1B 4DJZB 1P05A 4TY6A 1ELEE 3SV9A 1HGTH 1N6XA 2ZPSA 2P8OC 3BTKE 1SGFG 2GKVE 4X6OA 3SN8A 3VB6A 4WXIA 3FP7E 4K3JA 1YCPH 2QC2A 2OD3B 3LU9B 3QN7A 2ALVA 2K1QA 5HM9A 2BZ6H 2V35A 1MMJN 1GJCB 2VIWA 4I8GA 2Y81A 3QGNB 1PPBH 1K9OE 1Z1JA 1UTQA 3LC5A 4MDSA 3MOCA 3VEQB 1Y3VA 1GI0A 4E05H 1C5QA 1L2EA 2Y5FA 3SU4A 1O2WA 1TWXB 1NZQH 3PROA 8KME2 3OY5U 4RN6A 1FAXA 2BX3A 2XNIA 4X8VH 3UTUH 3MFJA 4ZKOU 4E7NA 1ABIH 2P8OB 4I8LA 4U32A 4YOIA 2FZZA 5EQRA 4WH6A 2RA0A 1TGBA 3QO6A 1HAVA 2XW9A 2ZO3H 3OTJE 4B71A 2A7CA 3PYHA 1P2KA 1BTPA 2DUCA 1C1MA 2Y82A 3NCLA 5TJXA 3LH1A 2GZ9A 2ZHEH 1LMWB 1Q31A 5DP3A 1SGPE 2GDDA 1GJ9B 1H8DH 4BTUB 1F5LA 1X7AC 1LVMA 1KXBA 2CXVA 1BRUP 2Z9KA 1TONA 3BIVH 4X1PU 1GMHF 1Z8IB 3TNSA 1ZYOA 1EAWA 1K21H 1O38A 3HPTB 5GDSH 2Z9LA 1LPZB 2QA9E 4ABGA 1DY9A 1C9PA 2ZU2A 3RXTA 2QV1A 4TWYA 1A5HA 5A0AE 2CN0H 3MU1A 3T25A 2FM2A 2ANKH 3SV6A 6CHAC 1K22H 4RSPA 1M9UA 1Y3YA 2K7XA 4HGCA 3RXBA 3PMJA 4UEHH 1AQ7A 1EAIA 1ABJH 4R8TB 1K1MA 2GCHG 3IWMA 4XE4A 1CU1A 1BOQA 1O2RA 3A89A 1O3FA 2ZWLH 2P93A 2J9NA 1A5GH 3MO3A 4MLFB 2BDHA 5DK1A 2G51A 3TK9A 1AGJA 4FUIA 1FIWA 1C5OH 3UREA 1O3MA 1KSNA 4JZFH 1SOZA 3I77A 3ZV9A 5FPYA 4CR9A 1QBNA 4WMFA 2A1DB 1C2DA 5AFYH 4X2WA 2OBOA 3SQHE 1SGCA 1IQEA 4LZ4B 1ZMLA 2ESTE 2Y5HA 3EE0B 7GCHG 1P02A 3B23B 1GJ5H 1SLUB 3MU0A 4DOQA 2ZHDA 4FVDA 6CHAB 1TRNA 3SOSA 3ODDA 5C20A 2SGAA 4AZ2B 4FU8A 1QJ7B 3SV8A 2B9LA 2ZU4A 3A86A 1G9IE 2B5TB 2ZHQH 3C27B 1BTXA 2FWWA 2EEKA 1EB1H 1FI8A 4YOGA 2PR3A 3IITA 4X1NU 2PUXB 2VIDA 3T28A 1NS3A 4Y8ZA 4CH2B 2EI8A 3M36A 1MD7A 3ZZ8A 3SU3A 1IQGA 1MAXA 2FOGA 2BX4A 2VGCC 3BG8A 1GMDF 1P12E 2FP7B 3SNCA 3QDZB 5JBCS 2UUFB 2A4QA 3DUXH 3E3TA 3RXUA 3H7OA 1SR5C 1EPTB 3UOUA 1H8IH 1GBCA 1D6WA 3GY2A 5CMXH 3E91A 4YT6H 1O3KA 2PUQH 5GXPA 3RXPA 1K1NA 1D3PB 3BTEE 2BVXH 3RC6A 1O2HA 1KXDA 1THSH 5BPEA 2WPKS 1FY8E 1ZMJA 5GIBA 1J14A 1SVPA 4NA8A 1MZAA 2QN5T 3F9HA 1EUFA 1AVGH 2ZU1A 2F9UA 3L33A 1O5GH 2FO9A 3A84A 1G2MA 2VGCB 3ATIA 1NRNH 2BQ7B 4CREA 2QXHA 3ODFA 2AYWA 1YPEH 5A8XA 1XKBC 3B9FH 4FXGH 1TPOA 1V2MT 1A4WH 2BY5X 2FI5E 3MMGA 2C8ZB 5E0GA 2VB0A 1C5MD 1CBWC 3DFJA 1O35A 2VH6A 1Y5BT 2Y80A 5A8YA 1LHCH 3FP8E 7LPRA 4FUFA 1JRSA 1W10U 3V7TA 1GHVH 4XFQA 1FLEE 1BT7A 3RXAA 1BBRK 1Y3UA 2FMJA 1LTOA 2UUJB 2OINA 4O97A 1ANDA 1EASA 1V6DA 3RXGA 1C5RA 1HAIH 1PFXC 3SV7A 4DURA 1BBRH 1GHZA 4OGXA 3SUFA 4BOHA 2H6MA 1DPOA 2I6QA 1TIOA 2ZP0H 3GY3A 3TU7H 2OC0A 4AFQA 2ZGJA 2GMTC 3EYDA 1WTGH 1CBWB 4ZMAH 4JYTA 1O3NA 2VWLA 1GJAB 1T31A 2F9PA 3CENA 4YTAA 3A7WA 2O8TA 1DSUA 1F0SA 1GHWH 2XC0A 2FPZA 3P95A 2B8OH 1F0TA 2ANWA 4Q80A 1O5BB 3NWUA 1VCQA 1D3QB 3RXKA 1ZLRA 1ZMNA 3UQVA 3ZVBA 1FY5A 1RJXB 4BANB 5GCHG 1PJPA 2HLCA 2BDGA 4AGJA 1FIZA 1FY1A 4X2YA 4DG4A 1C5NH 1V2LT 3BTWE 1GBDA 1FXYA 2BD9A 1GJBB 5EQSA 1CT4E 1P9UA 4KKDA 2GMTB 3Q77A 4I31A 2BB4A 1O5EH 1AWHB 3SJ8A 1SQAA 4I32A 2NU1E 3M35A 3NZIA 4ZXXH 1RFNA 3SUGA 1MU6B 1PPCE 1S82A 1ANEA 1F2SE 2A7JA 2PHBA 4X8UH 3SZNA 1F5RA 3NPSA 1Q2WA 1L4DA 2Q1JA 3AAVA 1C9TA 1WQSA 2AMPA 4K60A 1UK3A 3Q3XA 1QA0A 1EZSC 3TK5A 3LH3A 3MH4A 4GVUA 3ATWA 2XBYA 2FX4A 2EI7A 2BLOA 2A5IA 3B8JA 1C5ZB 2UWPA 2FX6A 1XM1A 1GI5A 1GMCG 1BBRE 5FX6A 3P92A 4SGAE 5EPYA 3D23A 5F8TA 3K6ZA 1S0QA 1E37B 2XWBI 5HYOA 2YNBA 1TALA 1NESE 2AGGX 3ZZ9A 2VIOA 2XYAA 2JH5D 1O2XA 1BMAA 5L2ZH 1ETTH 2WV4A 3SU5A 2Y7ZA 5G4BA 3S69A 2BY9X 1C5WB 1C2FA 5ETXA 1O36A 1O3OA 2FOHA 5E2OA 3GCOA 1DOJA 1GHBG 1CHOG 4LXBH 1Z8RA 3EGKH 3M61U 1HFDA 1LDTT 1Y59T 3FFGA 4GCHF 4NIWA 2BYAX 3D65E 1K1OA 1P2MA 1NU9A 3RMMH 5LGOA 1UJ1A 1QB6A 2G5VA 5HXFA 3S0NA 1H9IE 3SUDA 1C2HA 1MTWA 5L2YH 2GP9B 2LNCA 5SGAE 3I78A 1SFIA 2TPIZ 2R2MB 5LH8A 1C2EA 5DG6A 1KIGH 1V3XA 1YCPM 1S0RA 2TIOA 3KIDU 1W11U 2C90B 1O5AB 1O2OA 2BY7X 1YPGH 3Q3YA 2BY8X 1XKAC 4CH8B 1O3DA 5IYTA 3A7XA 3A85A 1KXFA 1TMUH 1NFXA 1C5TA 4FVBA 3SV2H 3A7TA 1BQYA 1ELDE 3BTDE 2AGEX 4ABIA 4KTSA 4VGCC 3M3SA 4CRDA 4E06H 7KMEH 3ZVEA 3TLOA 1IOEA 2ZFFH 1W0ZU 2J34A 1TX6A 4YESB 1JIRA 1UHBA 1TE0A 1PQ8A 3U98H 2FOCA 2OBQA 3UNQA 3UIRA 2JH0D 4ABHA 1GHAG 5ESTE 1O2PA 5L30H 2BZAA 3E8LA 3F6UH 4CRFA 1KXEA 2GT8A 4AB9A 1W3CA 3O8DA 4ZAEA 1MBMA 2C8XB 1SI5H 3UWIA 3F9EA 1PQ5A 2D26C 5E0JA 4ABAA 1HAVB 5CE1A 1GMCF 1QRXA 2BD3A 1AD8H 1LHGH 1ID5H 2SGDE 1ZTKA 1VGCC 1GBAA 2Z9IA 5AF9H 2ZGHA 1QRWA 1TABE 1GJ7B 3BIUH 1EOJA 5BRRE 1L4ZA 4D76A 3AW0A 3UQOA 3PV4A 3MO6A 2PSXA 1C4U2 1CA8B 1C2GA 1RRKA 3A83A 3BTME 4X2VA 4AN7A 1DUAA 1FDPA 1GGDB 3E0PB 5B6OA 1V2VT 1MZDA 4A7IB 1AHTH 1O2TA 3A82A 1H9HE 2F91A 2ZKSA 4HFPB 3TH3H 2ZF0H 1BMNH 1ARCA 3RU4D 3RU4T 2WUCA 3E16B 1ELTA 2I6SA 4BXSA 1KTTB 3M5NA 2B0FA 1A61H 1O3AA 2ZFTA 1YPLH 4D7GA 1LVYA 1N6YA 3SNAA 1AZ8A 2WYGA 4Q2KA 1AMHA 4JK6A 1QL9A 4NIYA 3DHKH 1A2CH 3LONA 4GLYA 4Q7YA 2H9HA 4ISIH 2Z94A 1GBKA 5FCKA 1XUIA 2FTLE 1DWDH 1GPZA 4OS1A 1GBBA 1C1OA 3RXJA 1F92A 1QNJA 4INHA 3SHCH 1KXAA 1TA6A 1GBJA 2TGDA 2WPHS 4Z0KA 3VB7A 1QURH 1G2LA 4AOQA 1AUJA 1GMHG 2FESH 4UFDH 2D8WA 4Y0ZE 2STBE 4MPVA 1AI8H 2G8TA 1DICA 4TYDA 3E90B 1FN6A 1TYNA 1TNIA 3UFAA 1UVTH 1GCTC 1YPMH 1ESTA 1MTSA 4AFZA 3P8FA 2PTCE 1PPZA 4SGBE 3U8RH 1HUTH 3NXPA 2C4FH 4I7YH 3A87A 1ZPBA 1C5UA 1YPHC 1MKWK 5FCRA 3MU4A 3AASA 1B0FA 4H42U 1K1LA 2O9QA 3A8DA 3MI4A 2V6NA 2CGAA 2PKAB 2AS9A 2H9TH 1YF4A 1UTKA 3F9GA 5EXLA 3NUMA 3GY7A 8LPRA 1HNEE 5FX5A 1HV7A 1MKWH 1HLTH 3F68H 5EW1H 2H9EH 1J15A 2QYIA 2R3UA 1ANCA 1P06A 4UFGH 1SHYA 1FY4A 2F83A 3A7YA 3E6PH 5A0BA 1KLTA 3K9XB 1GCTB 4DGJA 4ASHA 3ZVAA 4IGDA 3ZYEA 1O2VA 2BLQA 2ZFRH 1HJAC 1SQOA 1BTYA 1WQVH 1CT2E 3KHVA 1AUTC 3SGAE 5E0HA 1LPGB 1HXEH 1J16A 1QJ6B 2WUBA 1DITH 1CGJE 2FYQA 3NK8A 4JZEH 5JB8S 1E34B 2O8MA 1OYQA 1XUFA 3GCHC 1GMDG 1QRZA 2ULLA 3PMBB 9ESTA 4O03A 5CHAC 4OS4A 3PM3A 3SHAH 1OXGA 3P17H 5IDKA 1LVOA 2HNTF 2VWNA 3SJIA 1QR3E 1UK4A 4D8NA 1TGCA 1QFKH 1O3HA 3LOXA 1GL1A 3RXEA 4NIVA 2G81E 1C1UH 2HOBA 2PKSC 1L1NA 1O3IA 2QGRA 1NRQH 2HVXA 2CJIA 5A0CA 3ZV8A 2NWNA 2LPRA 1F0UA 1O3BA 1W13U 2GTBA 1C5SA 5HMAA 2ANMH 3ELAH 3M5MA 1O2IA 1BDAA 3GICB 1IHSH 2RCEA 3RLWH 1WUNH 1XUHA 3RXLA 1YPKH 2BDYA 1SGIB 3HK3B 1AFEH 3MO9A 3IG6B 1O3LA 1DSTA 1W7GH 2VH0A 2A32A 4CRGA 1O3EA 1B5GH 2BTCE 1FONA 3UPEA 3M3VA 4K1SA 3M3TA 3SW2B 2PKSB 3VGCC 1EQ9A 1NC6A 3UR6A 1ELAA 5C5OA 1BJVA 4HI3A 3PLBA 1PPGE 5LPRA 1BUIA 3SNBA 1MUEB 3GISB 1BA8B 5DP8A 4MPWA 4X6PA 5FPTA 1EP5A 1CA0C 3LGUA 1ZSKA 1C4Y2 2GCTC 3KGPA 3PLKA 3FZDA 5HM2A 4BAQB 2WPLS 2BOKA 1TNGA 3TGIE 5DP5A 2WV5A 2ZDVH 2ZU5A 2J94A 3BG4C 4DY7B 2AFQB 4WJG2 1KTSB 4RKOB 3ZZ7A 2OQ5A 1QQUA 1C1PA 1FPHH 1G3CA 2YOLA 3ZZAA 1ESAA 3BEFB 1HRTH 1BIOA 1KY9A 1RGQA 1D3TB 1B0EA 4NGAH 4X1SU 4DVAU 1TQ0B 1GI2A 4OS6A 2ANYA 2A31A 1KLIH 1AE5A 4ZKSU 2OC1A 1DT2A 1MKXK 1NY22 1PPFE 1QIXB 1HJ8A 1EOLA 2VIQA 3G01A 4X0WU 1OWIA 1CA0B 2PGQB 2Y6TA 3LGIA 3ZZBA 4GHTA 2GCTB 4DIIH 4B74A 1SGTA 2QXJA 4X1QU 1E36B 2FLRH 1J9CH 3BTHE 4CR5A 4WH8A 2NU4E 3BG4B 3TPIZ 1MKXH 3A8BA 5EW2H 3HGPA 2VJ1A 1W2KH 2SNVA 3KCGH 5F03A 3GY8A 3U8OH 4O3UA 1U6QA 2H1UA 1AFQC 1P10A 1O2YA 3P8NA 4K1EA 1ZPZA 2GT7A 1BB0B 1TOMH 1GDUA 1G36A 2BHGA 1EX3A 1EAXA 3VPKA 4WVPE 3T62A 4BXWA 3QGJA 1G3EA 2C8YB 6GCHF 1KLJH 1EB2A 2FOEA 3OYPA 3R3GB 1ANBA 1ZSLA 1GDQA
chains in the Genus database with same CATH superfamily
3KQCA 1QTFA 1EP6A 2FOMB 1UTLM 1VKYA 5CDFE 5AVDA 5C5NA 5HIZA 3SQEE 4NA9H 2VNTA 3UB0A 3ZVDA 1DXWA 1W0YH 1GDNA 1P3CA 5A8ZA 2ZDKA 2O8LA 1BMFD 5TCCA 2Q6FA 1SC8U 4FUDA 5EG4A 1GI4A 1AFQB 3S9BA 1Y5AT 4F4OC 3KYFA 3EA7A 3RLYH 1CGHA 3TJUA 3UWJH 1O31A 2FTMA 2XBXA 2Z6BD 5HGGA 1OWDA 3OU0A 1T4UH 4Y8XA 3TVJB 2OQUA 2XCNA 5DN6D 1TGTA 2QIQA 3SI4H 1BMLA 2BLVA 1Z6JH 1XVMA 3F9FA 1T4VH 1H9LB 1Z7KA 2QXGA 1SGQE 1WSSH 2RA3A 3MH6A 3OSYA 4ISNA 2QAAA 3M7UA 1UK2A 4GCHG 2FEQH 1UHBB 3A88A 4IMQA 5E2PA 1HAYB 1DLEA 1ZPCA 1G30B 2WPJS 1C2JA 1OKXA 1GBTA 3EQ0H 2GV7A 3VXFH 2SGQE 3S9CA 1N1LA 3A81A 2AIQA 1ELGA 3RXOA 2FODA 1O2QA 3BF6H 3VXEH 5EGMA 2RG3A 3EA8A 4KGAA 2VBCA 5F8ZA 1LHFH 3HATH 2YMSD 3U1IB 3ATMA 1MTNC 4MNVA 2FIRH 4I86A 4Q7ZA 9LPRA 1EAUA 1SLXB 3LGWA 3D49H 2ZTZA 3RMNH 1C2LA 3QUMP 1SHHB 5J4SA 4YZUA 1E38B 4BTTB 4CRBA 2PP6A 1A7SA 1PPEE 2V0BA 1MCVA 2Z3EA 1WAYB 3TITA 1MQ5A 2PSYA 3GDUA 4X2XA 1C1SA 4NSVA 1LHEH 2G4UA 5PTPA 1ETRH 1BTHH 1VITF 2TGTA 3ZZ5A 2SGFE 4A92A 4IC6A 2K0QA 1FV9A 4GUXA 3GOVB 1O2KA 2VIVA 1KDQB 1GJ4H 3SNDA 3RC4A 4IN2A 3UNRA 1LPKB 2FS8A 2TGPZ 3M37A 1LVBA 2EI6A 4U30A 1IHTH 1TPSA 2OK5A 3TJOA 3UOPA 5EIYA 3S7HB 1ELBA 1HAHH 1O2MA 1MU8B 3UR9A 2FOBA 1QA7A 3RXMA 1BHXF 1HAXB 5EXNA 5C3NA 2BMGB 4IMZA 4TPYA 2NU2E 1YPHE 1S83A 4Y71A 1OX1A 1OP0A 1W14U 1ZJKA 1DWEH 1F0RA 1J17T 2CV3A 1WOFA 2W5EA 1V2JT 1E35B 1O0DH 4CBNA 1AE8H 4CBOA 3ITIA 1EPTA 1RXPA 3DD2H 4CHAC 1A5IA 2BDAA 2FOFA 1DFPA 4NZLA 1P57B 4B1TA 1ELCA 2P95A 1EFRD 5FPSA 3AAUA 4RKJB 1GVZA 1TGNA 3TGKE 4FUJA 1AZZA 3LKWA 1PYTD 1NM6A 2EQNA 2CMYA 4ZKRU 3RXDA 1S5SA 1A3EH 1LHDH 2VVVA 2W3KA 1DWBH 1S81A 1TBZH 3F3BA 2P59A 1LQDB 2VVUA 2FLBH 3KQBA 4X6MA 3SU0A 4YM9A 3T26A 2WZQA 4AG2A 4H6TA 4HZHA 4TY7A 2CF8H 4UD9H 2XWAA 1DUEA 5FHTA 3K2UA 1TNLA 2V3MA 4QT8C 2ZQ1A 2ODPA 1EZXC 3AVZA 2CHAC 3SJ9A 4CHAB 3SJKA 3RM2H 1DANH 1JWTA 3T29A 1HAZB 5K7RA 3TH4H 1S6LA 1YC0A 3SORA 4YO9A 2W7UA 2O8WA 2HPQH 4XOJA 4Y11E 1E79D 3Q00A 3LT3A 3MU8A 1ZTJA 4WY3A 2PWXA 2QXIA 2J95A 1EZQA 3TJNA 1A0JA 2PTNA 3JZ1B 2KCYA 1P04A 2BDBA 5LPFA 4FUCA 2M2AA 3O8BA 4XBDA 1THPB 4J1YA 1DXPA 1Y3WA 2J92A 1OWHA 2A4GA 4XBCA 1OYTH 3M5OA 4ABJA 1DX5M 1NFWA 5H4IB 1K2I1 5JYIA 3FANA 1TX8A 2G52A 3KQEA 4I8JA 4NCYA 1HIAA 5FAHA 3ZZCA 3M7TA 2BY6X 2BXUH 5F6MA 1SB1H 3RP2A 1YBWA 2PFEA 4VGCB 1DVAH 4Q7XA 2HVYB 1TX7A 5C1UA 1W8BH 2OUAA 2SFAA 3LPRA 1S84A 4Y79A 4B2CA 2IPQX 1RD3B 4BTIB 3CP7A 1XUGA 1ELFA 2QF0A 3W95A 4RT1A 3WWFA 1MH0A 4NZQA 2P94A 1ZHMA 4I33A 4ZXYH 1DY8A 2ZCLP 3A7ZA 2KCPA 3LDXH 1CGIE 2R0LA 2XBWA 1G3BA 4WF8A 2ZC9H 2BD8A 1EZUC 1HYLA 8GCHF 4Y7BA 4LZ1H 4ZUHA 1K1JA 1EJMA 1AY6H 1LQEA 4XSKU 1TA2A 1VGCB 3DFLA 3RXSA 3KQDA 2VIPA 1JOUB 4J2YB 5EQQA 3S9AA 1SLVB 4KTUA 2TGAA 5DPAA 4MNYA 3ZVCA 1C5XB 1O34A 1SSXA 4MVNA 2ZEBA 2WINI 3OTPA 2OC7A 3LJJA 5EPNA 6ESTA 1UCYK 3VB3A 1L1JA 1D4PB 3TH2H 1A46H 2H2ZA 2J4IA 4OS2A 3ZVGA 1TOCB 3I29A 4ISOA 4IW4E 1QQ4A 1P2JA 3R0FA 1A0HB 5DP6A 4D9QA 2KAIA 4JZ1A 3RMOH 2TBSA 3VB5A 1UCYH 1HDTH 1VJAU 1S85A 3SU2A 3LIWA 4WWYA 2BM2A 4FU7A 1SG8B 4AB8A 2AHME 4PROA 2UWOA 1ZTLA 5I25A 4UFFH 4O3TA 1N8OC 3RC5A 2JH6D 5GJ4B 2LIZA 1NFUA 2ZPQA 4GPGA 1AVXA 4MNXA 3BEIB 3HGNA 4D9RA 1UTMA 4ZCNA 2ZQ2A 1TGSZ 1Z8JB 2JDID 5T6GA 4ZKNU 1ZZZA 4XD7D 3U1JB 5DKMA 3NKKA 1KYNA 4Y6DA 4UE7H 1TRMA 2FI3E 1O3JA 1UTOA 1QB1A 1MABB 1TAWA 2G5NA 1WTHD 5LPEA 2HPPH 4F49A 1CQQA 2ZIQH 3VB4A 1GVLA 1XXDA 3ATKA 4AORA 1N8OB 1NTPA 3DSPA 1LCYA 2R2WU 2M5TA 1XUJA 1FPCH 1UTPA 3QZRA 1Z6EA 5JB9S 1ETSH 1WU1A 1LKAA 3GYMA 5C67A 2WPMS 4WMDA 3GY6A 2W26A 2P3UB 3MNXA 4M7GA 5AFZH 3RM0H 1WBGB 1DM4B 4AFUA 3LGVA 1H8ED 5ABWA 4KP0A 2VINA 1JBUH 3PLPA 1H8HD 1VR1H 3M5LA 3P6ZB 3ENSB 1AKSA 4OS7A 2F9NA 4Q4LA 4DW2U 2DE8A 5JBAS 1TLDA 2RDEA 5FBEA 1E1RD 3E1XB 3MYWA 5T6FA 1MTVA 3C1KA 1AB9C 4JYUH 2ZCHP 1Z1IA 1TB6H 4Y7AA 4ZHLU 1FN8A 1IQNA 3RXRA 3V12A 4UDWH 1BMMH 1NT1A 3KF2A 2ZHWH 3E0NB 1C5VA 4NWKA 3AK5A 3FKSD 3H7TA 1P2QA 2YNAA 3TGJE 4B6EA 2NU3E 1C1TA 2OP9A 1HJAB 1UCYE 2ASUB 1P2OA 3PWCA 2IOTA 1HAOH 1HB0B 1NBME 1SOTA 1TQ7B 3W1EA 2NU0E 3BTQE 1BCUH 2UUYA 5I46H 3SBKA 1TPAE 3L6PA 4ZH8A 4ABFA 3L3TA 4R0IA 1DWCH 2VVCA 1YY3A 1UVPA 1AIXH 1O3PB 5EJZA 1THRH 3A7VA 5A2MH 4KTCA 6GCHG 3GCHB 3SNEA 2ODQA 4D7FA 3H5CB 2A5AA 1AB9B 5TCAA 1HJ9A 1SMFE 2W6ID 2PW8H 4XDEA 5CHAB 3DT0H 4DCDA 5JBTA 2AEIH 4WXVA 1WYKA 3W94A 1JMOH 1YLCA 3MWIU 4MG3A 1T8LA 1F5KU 2JIZD 2J5UA 3O8RA 4A5TS 4X8TH 3MH7A 2J97A 3F1SB 5KGOA 1ZOMA 5J4QA 1XVOA 1GI3A 3RU4E 1EJNA 5C0TA 1G32B 2F3CE 1V2UT 5FBIA 1C2IA 1EXFA 1BITA 3MTYA 3MNBA 1VJ9U 3ZYDA 4AGKA 4B2AA 3QLPH 3ZZ4A 2YMSC 4TPIZ 1PQ7A 5DJ7A 4BAOB 1OSSA 4A1TA 2QF3A 1T8MA 4THNH 4OM9A 1QL7A 3ZZDA 1IQFA 2AERH 3M7QA 1FAKH 3GCTG 1JXPA 1V2WT 3T2NA 3GDSA 4NSYA 1C5LH 4JCNA 1V2OT 1D9IA 1GL0E 1OWKA 1OPHB 3SUEA 1EJAA 2W6JD 1WV7H 3MH5A 1SGFA 2ZDNA 4BAKB 1TNJA 4K5ZA 5DP4A 3F2GA 1C1NA 1V2RT 3VGCB 5JDUB 2AMDA 1EPTC 2BQ6B 3Q76A 1GBEA 1INCA 2YMSB 1SPJA 2ILNA 1GI8B 1O5DH 2Y5GA 4H6SB 2W3IA 4Y0YE 1AVWA 1EATA 1O32A 2BD4A 3PV5A 3SGQE 2R9PA 1HAGE 1RTKA 4U2WA 3KNXA 4LK4A 1AN1E 5C1XA 4Y8YA 1ZR0A 2ZECA 1BHXB 1T7CA 3U28C 3PMHB 4OGYA 2Q6DA 1TNHA 1L0ZA 3BSQA 3RXCA 5DP9A 1ELVA 3RXQA 3Q3KA 1A3BH 4O9VA 4AX9H 2GDEH 3PO1C 4CRCA 4INKA 5A09A 3GY5A 5KEDA 2GJGA 4ZHAA 1QB9A 2PKAA 2BVSH 1GBHA 3SJOA 2XC5A 1VITG 2OCVB 4AG1A 8ESTE 5EODA 1GVKB 1GI1A 4YT7H 4A1VA 1V2TT 2ZU3A 1JIMA 1NRPH 2HNTE 1O30A 2A4RA 3SGBE 3QZQA 2A7HA 1IQKA 3OE7D 1FX0B 3HKIB 3RXIA 1P3EA 4BAHB 2IN2A 1PYTC 3UY9A 1YYY1 2PGBB 2ALPA 1OS8A 2O8UA 3PO1B 3RXHA 3LGTA 2XTTB 3P8GA 2XOKD 4B76A 2RDLA 2ZGXH 3O8CA 1O2LA 1O39A 3EBNA 2KR7A 1HXFH 1W12U 2OLGA 3PMAB 1O2SA 1HAPH 4MPXA 1ARBA 2GCHF 1XXFA 1RTFB 2ZTYA 1V2QT 1AU8A 3V3MA 1VCPA 1YKTA 2F9BH 2R0KA 3MNSA 4JYVH 3V0XA 3PRBA 4NFEA 3CS0A 1ESBA 1IAUA 3GCTF 1G37A 1UO6A 1GJ6A 5C2ZA 5T6DA 3PB1E 1O2ZA 1FNIA 1ZRBA 3UUZA 4E7RG 3FO8D 1XMNB 2AGIX 1P2IA 2Y7XA 2BQWB 1WDIA 1VZQH 2CF9H 4I8HA 1OP2A 2FXRA 1FY3A 2ZGBH 1O2UA 3P70B 2BDIA 2R3YA 2V7QD 3GYLB 2V3OH 3T27A 7GCHF 4UFEH 1A0LA 2B7DH 2H5DA 3RDZA 3F2HA 1UVOA 1NRRH 2BD7A 1AO5A 1QCPA 5K0HA 3TK6A 2BD2A 4FUEA 4A1XA 2L6OA 1HIAB 3UNSA 3TIUA 1DE7H 1NO9H 2PLXA 1SGNE 1BRAA 2DE9A 1DDJA 2EA3A 1O37A 2P3FH 1CSOE 2J2UA 5EXMA 1EKBB 2QCYA 2XRCA 4ACBA 3EA9A 2KFWA 3SU6A 2H5CA 1TMTH 1MTUA 3OEED 4Y76A 3FZZA 1IQIA 1AWFH 6LPRA 1Y8TA 3LC3A 3BN9A 3FAOA 3PTBA 1YPJH 3ZVFA 1C4V2 3QK1A 3EAJA 5DGJA 1GBFA 1GWAA 2EC9H 3EDXB 2OC8A 5C1YA 5JPMH 1SGRE 4BNRA 1UTJA 4DIHH 2C93B 2GZ7A 3GY4A 1C2KA 4GSOA 1TPPA 1CHGA 2D1JA 2WPIS 3A80A 3F2FA 1HPGA 1HBTH 2IPHA 1MTNB 1YM0A 4JMYA 3QX5H 3TJVA 4JZDH 2ZZUH 2JKHA 1V2ST 1V2PT 5JBBS 4AC9A 1Y5UT 4ABDA 1GI6A 1GHYH 3EE7A 1TMBH 4FUGA 1PQAA 2BD5A 3ATLA 4TWWA 1ACBE 3OAAD 5HKKD 1T8OA 2ZDMA 4K8BA 1TBRH 3BTGE 4U01A 3K6YA 3OX7U 1J8AA 3PRDA 1O33A 3P8OA 1Q3XA 4IC5A 1NU7B 3LJOA 2OXSA 1VITH 2AIPA 1GBIA 1SFQB 2C8WB 1F7ZA 1Z71A 2G4TA 3BTTE 3WY8A 4MQAA 4MTBA 2J98A 1OP8A 1IQHA 3JZ2B 1ORFA 5DP7A 4B2BA 1LKBA 2KAIB 1H1BA 2BLWA 4K1TA 1SL3A 3T5FH 4FETA 1NPMA 1C1RA 1ZJDA 4AYYB 1CE5A 3FP6E 2STAE 1YLDA 1SQTA 4GAWA 2FS9A 2UUKB 3V13A 3BV9B 2TRMA 4BAMB 2VWMA 8GCHG 1P01A 3STIA 1C1QA 1JRTA 1ZGVA 3MHWU 4DT7B 1BRBE 1ZSJA 3ESTA 4NWLA 1GCDA 1BJUA 2HWLB 1GJ8B 1P8VC 1XUKA 2GZ8A 2ZPRA 5EOKA 2G55A 4AYVB 4KELA 1DS2E 2D2DA 1UMAH 1OOKB 4INLA 5HIYA 2ZNKH 1TBQH 3URDA 1TFXA 2ZDLA 4A6LA 1P2NA 2GX4A 1QBVH 3N7OA 1QY6A 1P0SH 3LGYA 4H4FA 1O2JA 3FVFB 4YLQH 2AH4X 1BZXE 4FUHA 5GCHF 2KZ4A 3AW1A 4HTCH 1CVWH 1KXCA 1T8NA 1QL8A 4NA7A 2SGEE 4YLUA 2HNTC 1MQ6A 1RS0A 1DLKB 2A45B 5ESBA 3SO3A 5L6NH 2UWLA 3BTFE 4ESTE 2G00A 1OWJA 3GCNA 2GVFA 2ZGCA 1TNKA 1PPHE 2W7SA 1D6RA 2ODYB 2ZHFH 1MCTA 1C5PA 1FMGA 2A2XH 2BVRH 4X1RU 2WYJA 4K2YA 4Y10E 1XX9A 4ABBA 4IS5A 2XBVA 2C3SA 1AKSB 1ZHPA 1MBQA 2CHAB 2ZI2H 2ZTXA 3MU5A 3RUOA 1NN6A 4CRAA 3SYJA 4UONA 1T32A 1GJDB 1OWEA 4YOJA 1BRCE 4B75A 2FDAA 1GGDC 2OTVA 4X8SH 1A1RA 1FUJA 2WSSD 3TNTA 4JZIA 2JETC 1YP9A 3K65B 3S7KB 3SI3H 3WWBA 4ABEA 1V2NT 2HGTH 3OEHD 2ZG0H 3CS7A 2ZFSA 3DSGA 3D62A 3U9AH 2F9OA 4FUBA 3SU1A 5T1VA 3STJA 3U8TH 1FZZA 2PV9B 2Z9GA 3DSOA 2A2QH 2Z7FE 2V3HH 1HCGA 2F9VA 4AFSA 5IK2D 3KEEA 2A5KA 2P3TB 3OY6U 4B73A 2GD4B 4ZROA 3WW7A 2FI4E 2Q6GA 1IQLA 2ZA5A 2SNWA 1P09A 1QGFA 1NFYA 7ESTE 3BEUA 3ZZ3A 2J38A 2FYRA 1Z8GA 2BDCA 1UVUH 1QZ8A 4XBBA 4MNWA 5GPIB 1P03A 2Z9JA 1S6HA 2JETB 1W7XH 3ZIAD 2IJOB 3ZZ6A 4FU9A 1P9SA 4RT0A 2HALA 1O2GH 4ISHH 2ZFQH 1KDQA 2BOHB 3PTNA 1NROH 4LOYH 2AMQA 1GHBF 1GBMA 1CHOF 1GBLA 1TRYA 5F8XA 4I8KA 3HK6B 1GI9B 1BTUA 1E0FD 2THFB 4NFFA 3RMLH 1ZRKA 2BXTH 3RXVA 4ZHMU 1BTZA 2SGPE 4MPUA 1CO7E 5AHGH 2FOAA 1C2MA 1O5CB 2ZCKP 2GV6A 1IQMA 1MD8A 4NIXA 1H4WA 1YGCH 2P16A 2HRVA 5GWZA 1GHXH 2XCFA 1G3DA 1WCZA 4IN1A 1LO6A 1B7XB 4K69A 2XC4A 3VFEA 1L1GA 1O2NA 3VG8A 4OS5A 1GG6C 3DA9B 1C1WH 1CT0E 3QTOH 1RIWC 1K1IA 1UVSH 1NRSH 3PWBA 3RXFA 2VWOA 3QTVH 1VCWA 1GI7B 3KL6A 1UTNA 4Z6AH 1ZGIA 5DO4H 1IQJA 1MAYA 1BTWA 1O3GA 3HKJB 3QWCH 1SBWA 2QF5A 2ZFPH 5E8EH 5FXLA 5T3HA 1SGDE 1ZHRA 4X6NA 1SGYE 1K28D 1QBOA 1FJSA 4JK5A 4WMEA 2Z3CA 3U69H 1FQ3A 1GHAF 4NG9H 1K1PA 3URCA 2GGVB 1C1VH 1D3DB 4GHQA 1SGEE 5EU8A 1S6FA 2A0QB 3A8CA 3GDVA 1GG6B 2A4OA 2XXLA 3H09A 3KN2A 2VU8E 1O5FH 3MNCA 1RIWB 4IBLH 2Z3DA 4ISLA 1P11E 1C5YB 1V2KT 3KYGA 5DSFA 1SLWB 1QHRB 2QY0B 3DCLA 1O3CA 2ZDAH 4K8YA 3A8AA 1Y3XA 1RTLA 1YCPK 1QJ1B 4DJZB 1P05A 4TY6A 5EJ1A 1ELEE 2KM0A 3SV9A 1HGTH 1N6XA 2ZPSA 2P8OC 3BTKE 1SGFG 2GKVE 4X6OA 3PV2A 3SN8A 3VB6A 4WXIA 3FP7E 2XNDD 4K3JA 4DT4A 1YCPH 2QC2A 2OD3B 3LU9B 3QN7A 2ALVA 2K1QA 5HM9A 2BZ6H 2V35A 1MMJN 1GJCB 2VIWA 2KCAA 4I8GA 2Y81A 5C17A 3QGNB 1PPBH 1K9OE 1Z1JA 1UTQA 3LC5A 4MDSA 3MOCA 3VEQB 1Y3VA 1GI0A 4E05H 4B6FA 1C5QA 1L2EA 2Y5FA 3SU4A 1O2WA 1TWXB 1NZQH 3PROA 8KME2 3OY5U 4RN6A 1FAXA 2BX3A 2XNIA 4X8VH 3UTUH 3MFJA 4ZKOU 4E7NA 1ABIH 2P8OB 4I8LA 4U32A 4YOIA 2FZZA 5EQRA 4WH6A 2K8IA 2RA0A 1TGBA 3QO6A 1HAVA 2XW9A 2ZO3H 3OTJE 2QF4A 4B71A 2A7CA 3PYHA 1P2KA 1BTPA 2DUCA 1C1MA 2Y82A 3NCLA 5TJXA 3LH1A 3N7DA 2GZ9A 2ZHEH 1LMWB 1Q31A 5DP3A 1SGPE 2GDDA 1GJ9B 1H8DH 4BTUB 1F5LA 1X7AC 1LVMA 1KXBA 2CXVA 2JJ2D 1SKYE 1BRUP 2Z9KA 1TONA 3BIVH 4X1PU 1GMHF 1Z8IB 3TNSA 1ZYOA 1EAWA 1K21H 1O38A 3HPTB 3UAIC 5GDSH 2Z9LA 1LPZB 2QA9E 4ABGA 1DY9A 1C9PA 2ZU2A 3RXTA 2QV1A 4TWYA 1A5HA 5A0AE 2CN0H 3MU1A 3T25A 2FM2A 2ANKH 3SV6A 6CHAC 1K22H 4RSPA 1M9UA 1Y3YA 2K7XA 4HGCA 3RXBA 3PMJA 4UEHH 1AQ7A 1EAIA 1ABJH 4R8TB 1K1MA 5GNDA 5C0UA 2GCHG 3IWMA 4XE4A 1CU1A 1BOQA 1O2RA 3A89A 1O3FA 2ZWLH 2CK3D 2P93A 2J9NA 1A5GH 3MO3A 4MLFB 2BDHA 5DK1A 2G51A 3TK9A 1AGJA 4FUIA 1FIWA 1C5OH 3UREA 1O3MA 1KSNA 4JZFH 1SOZA 3I77A 3ZV9A 5FPYA 1W0KD 4CR9A 1QBNA 4WMFA 2A1DB 1C2DA 5AFYH 4X2WA 2OBOA 3SQHE 1SGCA 1IQEA 4LZ4B 1ZMLA 2ESTE 2Y5HA 3EE0B 7GCHG 1P02A 3B23B 1GJ5H 1SLUB 5EJLA 3MU0A 4DOQA 2ZHDA 4FVDA 6CHAB 1TRNA 3SOSA 3ODDA 5C20A 2SGAA 4AZ2B 4FU8A 1QJ7B 3SV8A 2B9LA 2ZU4A 3A86A 1G9IE 2B5TB 2ZHQH 3C27B 1BTXA 2FWWA 2EEKA 1EB1H 1FI8A 4YOGA 2PR3A 3IITA 4X1NU 2PUXB 2VIDA 3T28A 1NS3A 4Y8ZA 4CH2B 2EI8A 3M36A 2F43B 1MD7A 3ZZ8A 3SU3A 1IQGA 1MAXA 2FOGA 2BX4A 2VGCC 3BG8A 4P00A 1GMDF 1P12E 2FP7B 3SNCA 3QDZB 5JBCS 2UUFB 2A4QA 3DUXH 3E3TA 3RXUA 3H7OA 1SQRA 1SR5C 2J98B 1EPTB 3UOUA 1H8IH 1GBCA 1D6WA 3GY2A 5CMXH 3E91A 4YT6H 5F53A 1O3KA 2PUQH 5GXPA 3RXPA 1K1NA 1D3PB 3BTEE 2BVXH 5CHBA 3RC6A 1O2HA 1KXDA 1THSH 5BPEA 3KQ5A 2WPKS 1FY8E 1ZMJA 5GIBA 1J14A 1SVPA 4NA8A 1MZAA 2QN5T 3F9HA 3MQKC 1EUFA 1AVGH 2ZU1A 2F9UA 3L33A 1O5GH 2FO9A 3A84A 1G2MA 2VGCB 3ATIA 1NRNH 2BQ7B 4CREA 2QXHA 3ODFA 1E1QD 2AYWA 1YPEH 5A8XA 1XKBC 3B9FH 4FXGH 1TPOA 1V2MT 1A4WH 2BY5X 2FI5E 3MMGA 2C8ZB 5E0GA 2VB0A 1C5MD 1CBWC 1YWUA 3DFJA 1O35A 2VH6A 1Y5BT 2Y80A 5A8YA 1LHCH 3FP8E 7LPRA 4FUFA 1JRSA 1W10U 3V7TA 1GHVH 4XFQA 1FLEE 1BT7A 3RXAA 1BBRK 1Y3UA 2FMJA 1LTOA 2UUJB 2OINA 4O97A 1ANDA 1EASA 1V6DA 1YLNA 3RXGA 1C5RA 1HAIH 1PFXC 3SV7A 4DURA 1BBRH 1GHZA 4OGXA 3F0PA 3SUFA 4BOHA 2H6MA 1DPOA 2I6QA 1TIOA 2ZP0H 3GY3A 3TU7H 2OC0A 4AFQA 2ZGJA 2GMTC 3EYDA 1WTGH 1UW7A 1CBWB 4ZMAH 4JYTA 1O3NA 2VWLA 1GJAB 1T31A 2F9PA 3CENA 4YTAA 3A7WA 2O8TA 1DSUA 1F0SA 3NRLA 1GHWH 2XC0A 2FPZA 3P95A 2B8OH 1F0TA 2ANWA 4Q80A 1O5BB 3NWUA 1VCQA 1D3QB 3RXKA 1ZLRA 1ZMNA 3UQVA 3ZVBA 1FY5A 1RJXB 4BANB 5GCHG 1PJPA 2HLCA 2BDGA 4AGJA 1FIZA 1FY1A 4X2YA 5B6LA 4DG4A 1C5NH 1V2LT 3BTWE 1GBDA 1FXYA 2BD9A 1GJBB 5EQSA 4YXWD 1CT4E 1P9UA 4KKDA 2GMTB 3Q77A 4I31A 2BB4A 1O5EH 1AWHB 3SJ8A 1SQAA 4I32A 5C94A 2NU1E 3M35A 2QE7D 3NZIA 4ZXXH 1RFNA 3SUGA 1MU6B 1PPCE 1S82A 1ANEA 1F2SE 2A7JA 2PHBA 4X8UH 3SZNA 1F5RA 3NPSA 1Q2WA 1L4DA 2Q1JA 3AAVA 1C9TA 1WQSA 2AMPA 4K60A 1UK3A 3Q3XA 1QA0A 1EZSC 3TK5A 3LH3A 3MH4A 4GVUA 3ATWA 2XBYA 2FX4A 2EI7A 2BLOA 3N99A 2A5IA 3B8JA 1C5ZB 2UWPA 2FX6A 1XM1A 1GI5A 1GMCG 1BBRE 5FX6A 3P92A 4SGAE 5EPYA 3D23A 5F8TA 3K6ZA 1S0QA 1E37B 2XWBI 5HYOA 2YNBA 1TALA 1NESE 2AGGX 3ZZ9A 2VIOA 2XYAA 2JH5D 1O2XA 1BMAA 5L2ZH 1ETTH 2WV4A 3SU5A 2Y7ZA 5G4BA 3S69A 2BY9X 1C5WB 1C2FA 5ETXA 1O36A 1O3OA 2FOHA 5E2OA 3GCOA 1DOJA 1GHBG 1CHOG 4LXBH 1Z8RA 3EGKH 3M61U 1HFDA 1LDTT 1Y59T 3FFGA 4GCHF 4NIWA 2BYAX 3D65E 1K1OA 1P2MA 1NU9A 3RMMH 5LGOA 3OFND 1UJ1A 1QB6A 2G5VA 5HXFA 3S0NA 1H9IE 3SUDA 1C2HA 1MTWA 5L2YH 2GP9B 2LNCA 5SGAE 2EY4C 3I78A 2RFKC 1SFIA 2TPIZ 2R2MB 5LH8A 1C2EA 3GS9A 5DG6A 1KIGH 1V3XA 1YCPM 1S0RA 2TIOA 3KIDU 1W11U 2C90B 1O5AB 1O2OA 2BY7X 1YPGH 3Q3YA 2BY8X 1XKAC 4CH8B 1O3DA 5IYTA 3A7XA 3A85A 1KXFA 1TMUH 1NFXA 1C5TA 4FVBA 3SV2H 3A7TA 1BQYA 1ELDE 3BTDE 2AGEX 4ABIA 1W0JD 4KTSA 4VGCC 3M3SA 4CRDA 4E06H 7KMEH 2F4LA 3ZVEA 3TLOA 1IOEA 2ZFFH 1W0ZU 2J34A 1TX6A 4YESB 1JIRA 1UHBA 5KECA 1TE0A 4FOUC 1PQ8A 3U98H 2KCOA 2FOCA 2OBQA 3UNQA 3UIRA 2JH0D 4ABHA 1GHAG 5ESTE 1O2PA 5L30H 2BZAA 3E8LA 3F6UH 4TSFD 4CRFA 3SZEA 1KXEA 2GT8A 4AB9A 1W3CA 3O8DA 4ZAEA 1MBMA 2C8XB 1SI5H 2IJD1 3UWIA 3F9EA 1NBMD 1PQ5A 2D26C 5E0JA 4ABAA 4XRNA 1HAVB 5CE1A 1GMCF 1QRXA 2BD3A 2KX4A 1AD8H 1LHGH 1ID5H 2SGDE 1ZTKA 1VGCC 1GBAA 2Z9IA 5AF9H 2ZGHA 3F0OA 1QRWA 1TABE 1GJ7B 3BIUH 1EOJA 5BRRE 1L4ZA 4D76A 3AW0A 3UQOA 3PV4A 3MO6A 2PSXA 1C4U2 1CA8B 1C2GA 1RRKA 3A83A 3BTME 4X2VA 4AN7A 1DUAA 1FDPA 1GGDB 2LP6A 3E0PB 5B6OA 1V2VT 1MZDA 4A7IB 1AHTH 1O2TA 3A82A 1H9HE 2F91A 2ZKSA 4HFPB 3TH3H 2ZF0H 1BMNH 1ARCA 3RU4D 3RU4T 2WUCA 3E16B 1ELTA 2I6SA 4BXSA 1KTTB 3M5NA 2B0FA 1A61H 4Z1MD 1O3AA 2ZFTA 1YPLH 4D7GA 1LVYA 1N6YA 3FOAA 3SNAA 1AZ8A 2WYGA 4Q2KA 1AMHA 4JK6A 4P02A 1QL9A 4NIYA 3DHKH 1A2CH 3LONA 4GLYA 4Q7YA 2H9HA 4ACAA 4ISIH 2Z94A 1GBKA 5FCKA 1XUIA 2FTLE 1DWDH 1GPZA 4OS1A 4Q63A 1GBBA 1C1OA 3RXJA 1F92A 1QNJA 4INHA 3SHCH 1KXAA 1TA6A 1GBJA 2TGDA 2WPHS 4Z0KA 3VB7A 1QURH 1G2LA 4AOQA 1AUJA 1GMHG 2FESH 4UFDH 2D8WA 4Y0ZE 2STBE 4MPVA 1AI8H 2G8TA 1DICA 4TYDA 3E90B 1FN6A 1TYNA 4F55A 1TNIA 3UFAA 1UVTH 1GCTC 1YPMH 1ESTA 1MTSA 4AFZA 4HG6A 3P8FA 2PTCE 1PPZA 4SGBE 1OHHD 1K0HA 3U8RH 1HUTH 3NXPA 2C4FH 4I7YH 3A87A 1ZPBA 1C5UA 1YPHC 1MKWK 5FCRA 3MU4A 3AASA 5FL7D 1B0FA 4H42U 4RI0A 1K1LA 2O9QA 3A8DA 3MI4A 2V6NA 2CGAA 2PKAB 2AS9A 2H9TH 1YF4A 4F48B 1UTKA 3F9GA 3N7EA 5EXLA 3NUMA 3GY7A 8LPRA 1HNEE 5FX5A 1HV7A 1MKWH 1HLTH 3F68H 5EW1H 2H9EH 1J15A 2QYIA 2R3UA 1ANCA 1P06A 4UFGH 1SHYA 1FY4A 2F83A 3A7YA 3E6PH 5A0BA 1KLTA 3K9XB 1GCTB 4DGJA 4ASHA 3ZVAA 4IGDA 3ZYEA 1O2VA 2BLQA 2ZFRH 1HJAC 1SQOA 1BTYA 4ASUD 1WQVH 1CT2E 3KHVA 1AUTC 3SGAE 3CNRA 5E0HA 1LPGB 1HXEH 1J16A 1QJ6B 2WUBA 1DITH 1CGJE 2FYQA 3NK8A 4JZEH 5JB8S 1E34B 2O8MA 1OYQA 1XUFA 3GCHC 1GMDG 1QRZA 2ULLA 3PMBB 9ESTA 2JJ1D 4O03A 5CHAC 4OS4A 1COWD 3PM3A 3SHAH 1OXGA 3P17H 5IDKA 1LVOA 2HNTF 2VWNA 3SJIA 1QR3E 1UK4A 4D8NA 1TGCA 1QFKH 1O3HA 3LOXA 1GL1A 3RXEA 4NIVA 2G81E 1C1UH 2HOBA 2PKSC 1L1NA 1O3IA 2QGRA 1NRQH 2HVXA 2CJIA 5A0CA 3ZV8A 2NWNA 2LPRA 1F0UA 1O3BA 1W13U 2GTBA 1C5SA 5HMAA 2ANMH 3ELAH 3M5MA 1O2IA 1BDAA 3GICB 1IHSH 2RCEA 3RLWH 1WUNH 1XUHA 3RXLA 1YPKH 2BDYA 1SGIB 3HK3B 1AFEH 3MO9A 3IG6B 1O3LA 1DSTA 1W7GH 2VH0A 2A32A 4CRGA 1O3EA 1B5GH 2BTCE 1FONA 3UPEA 3FN8A 3M3VA 4K1SA 3M3TA 3SW2B 2PKSB 3VGCC 1EQ9A 1NC6A 3UR6A 1ELAA 5C5OA 1BJVA 4HI3A 2L74A 3PLBA 1PPGE 5LPRA 1BUIA 3SNBA 1MUEB 2HLDD 3GISB 1BA8B 5DP8A 4MPWA 2WPDD 4X6PA 5FPTA 1EP5A 1CA0C 3LGUA 4TT3D 1ZSKA 1C4Y2 2GCTC 3KGPA 3PLKA 3FZDA 5HM2A 4BAQB 2WPLS 2BOKA 1TNGA 3TGIE 5DP5A 2WV5A 2ZDVH 2ZU5A 2J94A 3BG4C 4DY7B 2AFQB 4WJG2 1KTSB 4RKOB 3ZZ7A 2OQ5A 1QQUA 1C1PA 1FPHH 1G3CA 2YOLA 3ZZAA 1ESAA 3BEFB 1HRTH 1BIOA 1KY9A 1RGQA 1D3TB 1B0EA 4NGAH 4X1SU 4DVAU 1TQ0B 1GI2A 4OS6A 2ANYA 2A31A 1KLIH 2WHXA 1AE5A 4ZKSU 2OC1A 1DT2A 1MKXK 1NY22 1PPFE 1QIXB 1HJ8A 1EOLA 2VIQA 3G01A 4X0WU 1OWIA 1CA0B 2PGQB 2Y6TA 3LGIA 3ZZBA 4GHTA 2GCTB 4DIIH 4B74A 1SGTA 2QXJA 1KMHB 4X1QU 1E36B 2WV9A 2FLRH 1J9CH 3BTHE 4M9FA 4CR5A 4WH8A 2NU4E 3BG4B 3TPIZ 1MKXH 3A8BA 5EW2H 3HGPA 2VJ1A 1W2KH 2SNVA 3KCGH 5F03A 3GY8A 3U8OH 4O3UA 1U6QA 2H1UA 1AFQC 1P10A 1O2YA 3P8NA 2LELA 4K1EA 1ZPZA 2GT7A 1BB0B 1TOMH 1WXRA 1GDUA 1G36A 2BHGA 1EX3A 1EAXA 3VPKA 4WVPE 3T62A 4BXWA 3QGJA 1G3EA 2C8YB 6GCHF 1KLJH 1EB2A 2FOEA 3OYPA 3R3GB 1ANBA 1ZSLA 1GDQA
chains in the Genus database with same CATH topology
3KQCA 1QTFA 1EP6A 2FOMB 1UTLM 5AVDA 5C5NA 3SQEE 4NA9H 2VNTA 3ZVDA 1DXWA 1W0YH 1GDNA 1P3CA 5A8ZA 2ZDKA 2O8LA 5TCCA 2Q6FA 1SC8U 4FUDA 5EG4A 1GI4A 1AFQB 3S9BA 1Y5AT 4F4OC 3EA7A 3RLYH 1CGHA 3TJUA 3UWJH 1O31A 2FTMA 2XBXA 2Z6BD 5HGGA 1OWDA 3OU0A 1T4UH 4Y8XA 3TVJB 2OQUA 2XCNA 1TGTA 2QIQA 3SI4H 1BMLA 2BLVA 1Z6JH 1XVMA 3F9FA 1T4VH 1H9LB 1Z7KA 2QXGA 1SGQE 1WSSH 2RA3A 3MH6A 3OSYA 4ISNA 2QAAA 3M7UA 1UK2A 4GCHG 2FEQH 1UHBB 3A88A 4IMQA 5E2PA 1HAYB 1DLEA 1ZPCA 1G30B 2WPJS 1C2JA 1OKXA 1GBTA 3EQ0H 2GV7A 3VXFH 2SGQE 3S9CA 1N1LA 3A81A 2AIQA 1ELGA 3RXOA 2FODA 1O2QA 3BF6H 3VXEH 5EGMA 2RG3A 3EA8A 4KGAA 5F8ZA 1LHFH 3HATH 3U1IB 3ATMA 1MTNC 4MNVA 2FIRH 4Q7ZA 9LPRA 1EAUA 1SLXB 3LGWA 3D49H 2ZTZA 3RMNH 1C2LA 3QUMP 1SHHB 5J4SA 4YZUA 1E38B 4BTTB 4CRBA 1A7SA 1PPEE 2V0BA 1MCVA 2Z3EA 1WAYB 3TITA 1MQ5A 2PSYA 3GDUA 4X2XA 1C1SA 4NSVA 1LHEH 2G4UA 5PTPA 1ETRH 1BTHH 1VITF 2TGTA 3ZZ5A 2SGFE 4A92A 4IC6A 1FV9A 4GUXA 3GOVB 1O2KA 2VIVA 1KDQB 1GJ4H 3SNDA 3RC4A 4IN2A 3UNRA 1LPKB 2FS8A 2TGPZ 3M37A 1LVBA 2EI6A 4U30A 1IHTH 1TPSA 3TJOA 3UOPA 3S7HB 1ELBA 1HAHH 1O2MA 1MU8B 3UR9A 2FOBA 1QA7A 3RXMA 1BHXF 1HAXB 5EXNA 5C3NA 2BMGB 4IMZA 4TPYA 2NU2E 1YPHE 1S83A 4Y71A 1OX1A 1OP0A 1W14U 1ZJKA 1DWEH 1F0RA 1J17T 2CV3A 1WOFA 2W5EA 1V2JT 1E35B 1O0DH 4CBNA 1AE8H 4CBOA 3ITIA 1EPTA 1RXPA 3DD2H 4CHAC 1A5IA 2BDAA 2FOFA 1DFPA 4NZLA 1P57B 4B1TA 1ELCA 2P95A 5FPSA 3AAUA 4RKJB 1GVZA 1TGNA 3TGKE 4FUJA 1AZZA 3LKWA 1PYTD 1NM6A 4ZKRU 2CMYA 3RXDA 1S5SA 1A3EH 1LHDH 2VVVA 2W3KA 1DWBH 1S81A 1TBZH 2P59A 1LQDB 2VVUA 2FLBH 3KQBA 4X6MA 3SU0A 4YM9A 3T26A 4AG2A 4H6TA 4HZHA 4TY7A 2CF8H 4UD9H 2XWAA 1DUEA 5FHTA 3K2UA 1TNLA 4QT8C 2ZQ1A 2ODPA 1EZXC 3AVZA 2CHAC 3SJ9A 4CHAB 3SJKA 3RM2H 1DANH 1JWTA 3T29A 1HAZB 5K7RA 3TH4H 1YC0A 3SORA 4YO9A 2W7UA 2O8WA 2HPQH 4XOJA 4Y11E 3Q00A 3LT3A 3MU8A 1ZTJA 4WY3A 2PWXA 2QXIA 2J95A 1EZQA 3TJNA 1A0JA 2PTNA 3JZ1B 1P04A 2BDBA 5LPFA 4FUCA 3O8BA 4XBDA 1THPB 4J1YA 1DXPA 1Y3WA 2J92A 1OWHA 2A4GA 4XBCA 1OYTH 3M5OA 4ABJA 1DX5M 1NFWA 5H4IB 1K2I1 5JYIA 3FANA 1TX8A 2G52A 3KQEA 4I8JA 4NCYA 1HIAA 5FAHA 3ZZCA 3M7TA 2BY6X 2BXUH 5F6MA 1SB1H 3RP2A 1YBWA 2PFEA 4VGCB 1DVAH 4Q7XA 1TX7A 5C1UA 1W8BH 2OUAA 2SFAA 3LPRA 1S84A 4Y79A 4B2CA 1RD3B 4BTIB 3CP7A 1XUGA 1ELFA 2QF0A 3W95A 1MH0A 4NZQA 2P94A 1ZHMA 4I33A 4ZXYH 1DY8A 2ZCLP 3A7ZA 3LDXH 1CGIE 2R0LA 2XBWA 1G3BA 4WF8A 2ZC9H 2BD8A 1EZUC 1HYLA 8GCHF 4Y7BA 4LZ1H 4ZUHA 1K1JA 1EJMA 1AY6H 1LQEA 4XSKU 1TA2A 1VGCB 3DFLA 3RXSA 3KQDA 2VIPA 1JOUB 4J2YB 5EQQA 3S9AA 1SLVB 4KTUA 2TGAA 5DPAA 4MNYA 3ZVCA 1C5XB 1O34A 1SSXA 4MVNA 2ZEBA 2WINI 2OC7A 3LJJA 5EPNA 6ESTA 1UCYK 3VB3A 1L1JA 1D4PB 3TH2H 1A46H 2H2ZA 2J4IA 4OS2A 3ZVGA 1TOCB 3I29A 4ISOA 4IW4E 1QQ4A 1P2JA 3R0FA 1A0HB 5DP6A 4D9QA 2KAIA 4JZ1A 3RMOH 2TBSA 3VB5A 1UCYH 1HDTH 1VJAU 1S85A 3SU2A 3LIWA 4WWYA 2BM2A 4FU7A 1SG8B 4AB8A 4PROA 2UWOA 1ZTLA 5I25A 4UFFH 4O3TA 1N8OC 3RC5A 2JH6D 5GJ4B 2LIZA 1NFUA 2ZPQA 4GPGA 1AVXA 4MNXA 3BEIB 3HGNA 4D9RA 1UTMA 2ZQ2A 1TGSZ 1Z8JB 5T6GA 4ZKNU 1ZZZA 3U1JB 5DKMA 3NKKA 1KYNA 4Y6DA 4UE7H 1TRMA 2FI3E 1O3JA 1UTOA 1QB1A 1TAWA 2G5NA 1WTHD 5LPEA 2HPPH 4F49A 1CQQA 2ZIQH 3VB4A 1GVLA 1XXDA 3ATKA 4AORA 1N8OB 1NTPA 1LCYA 2R2WU 2M5TA 1XUJA 1FPCH 1UTPA 3QZRA 1Z6EA 5JB9S 1ETSH 1WU1A 1LKAA 3GYMA 5C67A 2WPMS 4WMDA 3GY6A 2W26A 2P3UB 3MNXA 4M7GA 5AFZH 3RM0H 1WBGB 1DM4B 4AFUA 3LGVA 5ABWA 4KP0A 2VINA 1JBUH 3PLPA 1VR1H 3M5LA 3P6ZB 3ENSB 1AKSA 4OS7A 2F9NA 4DW2U 2DE8A 5JBAS 1TLDA 5FBEA 3E1XB 3MYWA 5T6FA 1MTVA 3C1KA 1AB9C 4JYUH 2ZCHP 1Z1IA 1TB6H 4Y7AA 4ZHLU 1FN8A 1IQNA 3RXRA 3V12A 4UDWH 1BMMH 1NT1A 3KF2A 2ZHWH 3E0NB 1C5VA 4NWKA 3H7TA 1P2QA 2YNAA 3TGJE 2NU3E 1C1TA 2OP9A 1HJAB 1UCYE 2ASUB 1P2OA 3PWCA 2IOTA 1HAOH 1HB0B 1SOTA 1TQ7B 2NU0E 3BTQE 1BCUH 2UUYA 5I46H 3SBKA 1TPAE 3L6PA 4ZH8A 4ABFA 3L3TA 4R0IA 1DWCH 2VVCA 1UVPA 1AIXH 1O3PB 1THRH 3A7VA 5A2MH 4KTCA 6GCHG 3GCHB 3SNEA 2ODQA 4D7FA 3H5CB 2A5AA 1AB9B 5TCAA 1HJ9A 1SMFE 4XDEA 2PW8H 5CHAB 4DCDA 3DT0H 5JBTA 2AEIH 4WXVA 1WYKA 3W94A 1JMOH 1YLCA 3MWIU 4MG3A 1T8LA 1F5KU 3O8RA 4A5TS 4X8TH 3MH7A 3F1SB 1ZOMA 5J4QA 1XVOA 1GI3A 3RU4E 1EJNA 1G32B 2F3CE 1V2UT 5FBIA 1C2IA 1EXFA 1BITA 3MTYA 3MNBA 1VJ9U 3ZYDA 4AGKA 4B2AA 3QLPH 3ZZ4A 4TPIZ 1PQ7A 5DJ7A 4BAOB 1OSSA 4A1TA 2QF3A 1T8MA 4THNH 1QL7A 3ZZDA 1IQFA 2AERH 3M7QA 1FAKH 3GCTG 1JXPA 1V2WT 3T2NA 3GDSA 4NSYA 1C5LH 4JCNA 1V2OT 1D9IA 1GL0E 1OWKA 1OPHB 3SUEA 1EJAA 1WV7H 3MH5A 1SGFA 2ZDNA 4BAKB 1TNJA 4K5ZA 5DP4A 1C1NA 1V2RT 3VGCB 5JDUB 2AMDA 1EPTC 2BQ6B 3Q76A 1GBEA 1INCA 1SPJA 2ILNA 1GI8B 1O5DH 2Y5GA 4H6SB 2W3IA 4Y0YE 1AVWA 1EATA 1O32A 2BD4A 3SGQE 2R9PA 1HAGE 1RTKA 4U2WA 3KNXA 4LK4A 1AN1E 5C1XA 4Y8YA 1ZR0A 2ZECA 1BHXB 1T7CA 3PMHB 4OGYA 2Q6DA 1TNHA 1L0ZA 3BSQA 3RXCA 5DP9A 1ELVA 3RXQA 3Q3KA 1A3BH 4O9VA 4AX9H 2GDEH 3PO1C 4CRCA 4INKA 5A09A 3GY5A 4ZHAA 1QB9A 2PKAA 2BVSH 1GBHA 3SJOA 2XC5A 1VITG 2OCVB 4AG1A 8ESTE 5EODA 1GVKB 1GI1A 4YT7H 4A1VA 1V2TT 2ZU3A 1JIMA 1NRPH 2HNTE 1O30A 2A4RA 3SGBE 3QZQA 2A7HA 1IQKA 3HKIB 3RXIA 1P3EA 4BAHB 2IN2A 1PYTC 3UY9A 1YYY1 2PGBB 2ALPA 1OS8A 2O8UA 3PO1B 3RXHA 3LGTA 2XTTB 3P8GA 4B76A 2RDLA 2ZGXH 3O8CA 1O2LA 1O39A 3EBNA 1HXFH 1W12U 2OLGA 3PMAB 1O2SA 1HAPH 4MPXA 1ARBA 2GCHF 1XXFA 1RTFB 2ZTYA 1V2QT 1AU8A 3V3MA 1VCPA 1YKTA 2F9BH 2R0KA 3MNSA 4JYVH 3V0XA 4NFEA 3CS0A 1ESBA 1IAUA 3GCTF 1G37A 1UO6A 1GJ6A 5C2ZA 5T6DA 3PB1E 1O2ZA 1FNIA 1ZRBA 3UUZA 4E7RG 1XMNB 2AGIX 1P2IA 2Y7XA 2BQWB 1VZQH 2CF9H 4I8HA 1OP2A 2FXRA 1FY3A 2ZGBH 1O2UA 3P70B 2BDIA 2R3YA 3GYLB 2V3OH 3T27A 7GCHF 4UFEH 1A0LA 2B7DH 2H5DA 3RDZA 1UVOA 1NRRH 2BD7A 1AO5A 1QCPA 5K0HA 3TK6A 2BD2A 4FUEA 4A1XA 1HIAB 3UNSA 3TIUA 1DE7H 1NO9H 2PLXA 1SGNE 1BRAA 2DE9A 1DDJA 2EA3A 1O37A 2P3FH 1CSOE 2J2UA 5EXMA 1EKBB 2QCYA 2XRCA 3EA9A 3SU6A 2H5CA 1TMTH 1MTUA 4Y76A 3FZZA 1IQIA 1AWFH 6LPRA 1Y8TA 3LC3A 3BN9A 3FAOA 3PTBA 1YPJH 3ZVFA 1C4V2 3QK1A 3EAJA 5DGJA 1GBFA 1GWAA 2EC9H 3EDXB 2OC8A 5C1YA 5JPMH 1SGRE 4BNRA 1UTJA 4DIHH 2C93B 2GZ7A 3GY4A 1C2KA 4GSOA 1TPPA 1CHGA 2D1JA 2WPIS 3A80A 1HPGA 1HBTH 2IPHA 1MTNB 1YM0A 4JMYA 3QX5H 3TJVA 4JZDH 2ZZUH 2JKHA 1V2ST 1V2PT 5JBBS 1Y5UT 4ABDA 1GI6A 1GHYH 1TMBH 4FUGA 1PQAA 2BD5A 3ATLA 4TWWA 1ACBE 1T8OA 2ZDMA 4K8BA 1TBRH 3BTGE 4U01A 3K6YA 3OX7U 1J8AA 1O33A 3P8OA 1Q3XA 4IC5A 1NU7B 3LJOA 2OXSA 1VITH 2AIPA 1GBIA 1SFQB 2C8WB 1F7ZA 1Z71A 2G4TA 3BTTE 3WY8A 4MQAA 4MTBA 1OP8A 1IQHA 3JZ2B 1ORFA 5DP7A 4B2BA 1LKBA 2KAIB 1H1BA 2BLWA 4K1TA 1SL3A 3T5FH 1NPMA 1C1RA 1ZJDA 4AYYB 1CE5A 3FP6E 2STAE 1YLDA 1SQTA 4GAWA 2FS9A 2UUKB 3V13A 3BV9B 2TRMA 4BAMB 2VWMA 8GCHG 1P01A 3STIA 1C1QA 1JRTA 1ZGVA 3MHWU 4DT7B 1BRBE 1ZSJA 3ESTA 4NWLA 1GCDA 1BJUA 2HWLB 1GJ8B 1P8VC 1XUKA 2GZ8A 2ZPRA 5EOKA 2G55A 4AYVB 4KELA 1DS2E 2D2DA 1UMAH 1OOKB 4INLA 2ZNKH 1TBQH 3URDA 1TFXA 2ZDLA 4A6LA 1P2NA 2GX4A 1QBVH 3N7OA 1QY6A 1P0SH 3LGYA 4H4FA 1O2JA 3FVFB 4YLQH 2AH4X 1BZXE 4FUHA 5GCHF 3AW1A 4HTCH 1CVWH 1KXCA 1T8NA 1QL8A 4NA7A 2SGEE 4YLUA 2HNTC 1MQ6A 1RS0A 1DLKB 2A45B 5ESBA 3SO3A 5L6NH 2UWLA 3BTFE 4ESTE 2G00A 1OWJA 3GCNA 2GVFA 2ZGCA 1TNKA 1PPHE 2W7SA 1D6RA 2ODYB 2ZHFH 1MCTA 1C5PA 1FMGA 2A2XH 2BVRH 4X1RU 2WYJA 4K2YA 4Y10E 1XX9A 4ABBA 4IS5A 2XBVA 2C3SA 1AKSB 1ZHPA 1MBQA 2CHAB 2ZI2H 2ZTXA 3MU5A 3RUOA 1NN6A 4CRAA 4UONA 1T32A 1GJDB 1OWEA 4YOJA 1BRCE 4B75A 2FDAA 1GGDC 2OTVA 4X8SH 1A1RA 1FUJA 3TNTA 4JZIA 2JETC 1YP9A 3K65B 3S7KB 3SI3H 4ABEA 1V2NT 2HGTH 2ZG0H 3CS7A 2ZFSA 3D62A 3U9AH 2F9OA 4FUBA 3SU1A 3STJA 3U8TH 1FZZA 2PV9B 2Z9GA 2A2QH 2Z7FE 2V3HH 1HCGA 2F9VA 4AFSA 3KEEA 2A5KA 2P3TB 3OY6U 4B73A 2GD4B 4ZROA 2FI4E 2Q6GA 1IQLA 2ZA5A 2SNWA 1P09A 1QGFA 1NFYA 7ESTE 3BEUA 3ZZ3A 2J38A 2FYRA 1Z8GA 2BDCA 1UVUH 4XBBA 4MNWA 5GPIB 1P03A 2Z9JA 1S6HA 2JETB 1W7XH 2IJOB 3ZZ6A 4FU9A 1P9SA 2HALA 1O2GH 4ISHH 2ZFQH 1KDQA 2BOHB 3PTNA 1NROH 4LOYH 2AMQA 1GHBF 1GBMA 1CHOF 1GBLA 1TRYA 5F8XA 4I8KA 3HK6B 1GI9B 1BTUA 1E0FD 2THFB 4NFFA 3RMLH 1ZRKA 2BXTH 3RXVA 4ZHMU 1BTZA 2SGPE 4MPUA 1CO7E 5AHGH 2FOAA 1C2MA 1O5CB 2ZCKP 2GV6A 1IQMA 1MD8A 4NIXA 1H4WA 1YGCH