3FZDA

Mutation of asn28 disrupts the enzymatic activity and dimerization of sars 3clpro
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
299
structure length
296
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLAGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutation of Asn28 disrupts the dimerization and enzymatic activity of SARS 3CL(pro) .
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 79
structure length 296
sequence length 299
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3fzdA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fzdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fzdA02
3LKWA 4IMQA 2GZ8A 1CA0C 2ZHWH 1EPTA 2J95A 1G36A 2ZA5A 3RXKA 1IQHA 1HYLA 1BT7A 1WV7H 1TQ7B 1O3PB 1TPPA 2VH0A 1FONA 4Y6DA 1QRWA 1BRUP 1RD3B 3BTGE 3ZV8A 3ZVCA 1MKXK 1RXPA 2A5AA 3GY7A 1RRKA 1LHCH 2G4TA 3P8GA 1IQLA 1A2CH 1C2EA 1C5XB 2TPIZ 3PB1E 3SV2H 2ZEBA 2VWNA 1W7GH 1DWEH 1K28D 1A5GH 4INLA 4HZHA 3S9CA 2W5EA 1O2VA 1G2MA 2ZGCA 3KCGH 2OC8A 1EOLA 3QWCH 2O8WA 1O2ZA 1O39A 5AFZH 2BVXH 4ABFA 4J2YB 5EW1H 1SR5C 3RU4D 4CRCA 2BLVA 8GCHG 1TMUH 2QIQA 4WVPE 2ZHDA 1T32A 5EODA 1OOKB 2BXTH 2CV3A 2QA9E 1NZQH 3MO3A 4A5TS 1KIGH 1PPFE 5DG6A 3W94A 2H5DA 1EP6A 1DPOA 1S0QA 1RTLA 2BHGA 2ZGXH 4OGYA 1MAYA 3LGUA 3L33A 1DLEA 3UY9A 3SGAE 1UTNA 2BDBA 1FY3A 1DE7H 2OBOA 2Z3CA 1C1RA 2ESTE 4NZLA 3RXMA 1S83A 2ZFPH 1GJAB 1QBNA 5L2ZH 1W12U 1FQ3A 1TOCB 3UNRA 1GJCB 2FMJA 4X2XA 1O2SA 1RIWB 2B0FA 3VEQB 1AY6H 1LVBA 1TALA 2SGAA 1TNJA 4KTCA 4DOQA 1RTFB 2ZFSA 1TBRH 1SMFE 4X2YA 3T2NA 1AFQB 3O8RA 1J8AA 1S81A 2Z94A 1QFKH 1BBRE 2KAIA 4B71A 4VGCB 5T6FA 3CS7A 1AVXA 2A4OA 1OYQA 4OS2A 3SV7A 1TGTA 3AW1A 1Z8RA 2Q6GA 3KHVA 1D3PB 2BTCE 4UONA 1UK3A 3RC6A 1ANBA 1OS8A 3OX7U 3A80A 4MG3A 3PMHB 1A61H 4I8GA 2ALVA 1GVKB 3TJVA 1C1NA 2CHAC 2OTVA 4UFFH 3H7OA 4BAMB 4X8TH 1GHZA 2A5KA 5C5OA 2AGEX 1GBLA 1UTQA 1Z8IB 3Q3YA 4FUHA 1C2JA 1P2IA 3SW2B 4YTAA 3P8NA 1YKTA 4Y8XA 4I32A 5FBIA 2LPRA 2ZDMA 2R0LA 3MNCA 4AG1A 1FDPA 2ODYB 1Y59T 1W0ZU 2C8YB 1KXCA 1EB1H 4Q7ZA 4WXVA 1SQAA 4OS5A 3TPIZ 3RXLA 2FZZA 1GI5A 1Q3XA 1UO6A 1LKAA 1DY9A 1AE5A 5JB9S 1C5PA 1BIOA 1DWDH 3KN2A 4DY7B 1NS3A 2Z6BD 4Y7BA 1O5GH 4OS7A 2P8OC 1INCA 5F8XA 1EKBB 1XUFA 1EJMA 3E0PB 3ZZCA 2FO9A 3VXFH 3NPSA 2OXSA 4MNXA 1TRYA 1TPAE 3T25A 4NIYA 5B6OA 5EQSA 3D49H 7GCHF 2ZHEH 1TBZH 1O3MA 4I33A 2UWLA 1Z7KA 1BBRH 1AN1E 1FN8A 4NIXA 4X8UH 4AOQA 2C8WB 4CBOA 1K1PA 1HAHH 3M7UA 3SUEA 3MH7A 1MBQA 2HGTH 4LXBH 1BJVA 4NFEA 3FZZA 1SC8U 1PYTC 4UFGH 2WUCA 3IG6B 3K65B 4OS4A 3AW0A 1WU1A 2WYGA 5E2PA 3STJA 1LPZB 1B0EA 3QTOH 1Z8GA 4TY6A 3LC5A 5JBBS 4R0IA 1QQUA 1DT2A 1QB1A 1K2I1 2BD8A 3T27A 2SNWA 3MU5A 3A7VA 4E7NA 1AVWA 3LU9B 4JZIA 4HI3A 3SOSA 1KTTB 4AX9H 2UWPA 3MH5A 4FVBA 3RXEA 1BOQA 4WXIA 1KLJH 1CU1A 4XOJA 4WWYA 2BLOA 3G01A 4ZKSU 3FZDA 2AMPA 1HJ8A 2ZIQH 2BDHA 2GDEH 1C5MD 1GBMA 1ELFA 3GY3A 1UCYH 3PTNA 3N7OA 1BTWA 1ORFA 1GBJA 1Y3VA 1AU8A 2BY8X 2OD3B 2VU8E 3OSYA 2BVSH 3A8CA 1H9HE 3S9BA 1ZMNA 2GVFA 5K7RA 1SPJA 4X2WA 3GY2A 1CA8B 1EPTB 3O8DA 4GAWA 2Y5GA 3SO3A 1HIAA 2HRVA 3ZYEA 4DCDA 5DP8A 1V2WT 3BEUA 3SQEE 4I7YH 1JRTA 1D3DB 4O97A 1H9IE 1PPCE 1NRQH 4ABIA 1UTPA 3PMJA 4YZUA 3I77A 3DA9B 1V2VT 1AUTC 4AB9A 2PTCE 4ZROA 2PHBA 3A8BA 1GBEA 2CXVA 3GDVA 1E36B 1ZMLA 4WMFA 2ZTYA 1WBGB 2GZ9A 1O2TA 2V35A 2ZCHP 3TJNA 1BUIA 1F5LA 1YGCH 1MTSA 1ZGVA 3SV6A 1WCZA 2R3YA 2VIVA 3VB6A 3QGJA 1GPZA 3PMAB 1EZXC 1V6DA 2ZDNA 3TJUA 2IPHA 1GBTA 3ZZ8A 3U69H 2BLQA 1NRPH 3RXFA 1GMDF 4JCNA 3SHCH 3V0XA 1C1UH 3IWMA 3TVJB 2DE9A 1GVLA 1ANCA 1O2IA 4MTBA 4ISLA 1JXPA 2J2UA 3TK6A 3ZZ9A 1PJPA 5A8ZA 2R0KA 1G37A 1F92A 3ATKA 1PQ8A 2H9TH 1V2NT 1HGTH 1P2JA 1G32B 1MTNB 1O5CB 2HOBA 1T7CA 7ESTE 1BDAA 4B73A 2PKSB 1MBMA 1BMNH 5T3HA 1W13U 3A86A 1FI8A 2ANKH 3A82A 1ZRKA 4B76A 1IAUA 1DANH 3MHWU 2SGPE 2GT7A 1SLUB 4F4OC 3NUMA 3LPRA 1UVSH 3ITIA 4JYUH 2OC0A 3PM3A 2J34A 1GMCG 1EUFA 4JZDH 2BZ6H 1O2LA 1VGCC 4X6OA 2FTLE 1T31A 4GCHG 3RXRA 1C9TA 4YOJA 1FAKH 1EJAA 1KYNA 5DP7A 5FPTA 2NU4E 2Z9KA 1SGRE 2VWOA 2YNBA 1MTUA 2A1DB 5ESBA 4AFZA 2BX4A 5JYIA 3MH4A 1EQ9A 4GHTA 5EU8A 2R3UA 1ZSLA 4WMEA 1YPHE 2PUQH 3AAVA 3L6PA 2C8XB 2WPMS 1XUHA 1QTFA 2AS9A 1BITA 1DFPA 3F9EA 2D1JA 3PWCA 5G4BA 1LVOA 1F7ZA 2Z3DA 4K2YA 1WYKA 1O3IA 4NWKA 4YOGA 5FBEA 1D4PB 3KF2A 1L4DA 2XW9A 1IQEA 4O3TA 4K8YA 3MO9A 1FLEE 1D9IA 1K22H 5GIBA 1O2XA 2ZG0H 3E0NB 4AFSA 1A46H 1GWAA 2WPJS 1KDQB 2G5NA 3RLYH 4CH2B 1MKWH 2P95A 1YYY1 4MDSA 2WPLS 1V2RT 4XBCA 3MU8A 2BD2A 3P95A 3SNBA 3MU1A 2PSXA 2SGQE 1Z8JB 1WUNH 3CENA 5FPSA 4KGAA 2AEIH 1CGHA 1FUJA 3Q77A 1T8MA 4UD9H 1C1TA 2GV6A 1BHXB 4Q2KA 2HNTF 1V2LT 2AH4X 1C4U2 3SU4A 4DGJA 4UEHH 3TU7H 1VCQA 1A3BH 1O2WA 1O30A 1Y5BT 2VWLA 2XBYA 1PQ7A 2ZC9H 2K7XA 1ABIH 1MD7A 5A8YA 2J4IA 3R0FA 2P59A 2XRCA 1SGNE 2FX6A 3BG8A 2J92A 4LOYH 2PTNA 2FX4A 1GHAF 4JYVH 3Q00A 4X1RU 1CGIE 1EAWA 1AUJA 1GJ7B 1SQTA 2BDGA 3BEIB 1LPGB 1J9CH 2PKAA 1XM1A 2BVRH 1AB9C 3D62A 2ZQ1A 1O31A 1P09A 1QHRB 1IOEA 1P04A 2BD5A 2A5IA 1P01A 3RXQA 2ZU2A 5E2OA 3SGQE 3ZVDA 2F3CE 4DVAU 1PQAA 1RTKA 1VJ9U 1DLKB 2JKHA 2R2MB 4AGKA 3A7WA 4CBNA 3RDZA 1HAPH 1UK2A 2AYWA 2ZWLH 2AIQA 4DIIH 1V3XA 1SGEE 4ABDA 2CHAB 1O3GA 2Y81A 2J9NA 3LH1A 1UTMA 1ETTH 1NT1A 3A81A 5GJ4B 1A0HB 3BIUH 1LQEA 2ZHQH 2Y7XA 3V3MA 1ZRBA 2P3TB 1EASA 1YPGH 4TY7A 1LDTT 1ACBE 2WPHS 3SI3H 3T28A 1JWTA 3UFAA 5GXPA 1YPKH 2C8ZB 1PFXC 1TNIA 2F9NA 1GL1A 5IYTA 1ZMJA 2QY0B 4IS5A 3PROA 2FDAA 3K6YA 8GCHF 4MVNA 3QX5H 2BOKA 8ESTE 1GL0E 1ZTKA 5A2MH 2Y5HA 2G52A 1CE5A 2QYIA 1GBAA 1SLXB 5BPEA 2Q1JA 2FOEA 2PR3A 2VVCA 3QK1A 1ANDA 5LPFA 4K60A 2ASUB 2TGAA 3M3VA 1FXYA 1XX9A 2HALA 2H1UA 1NFXA 1S0RA 2VIPA 4RKJB 3NWUA 5DP9A 3F68H 3FAOA 4O9VA 1NC6A 3PYHA 2FOAA 1C5TA 5FXLA 4OS1A 3M5NA 1MH0A 1TNHA 1Y5UT 2V6NA 1ZR0A 3Q76A 1HUTH 1KTSB 4IBLH 4DG4A 2BDIA 1TGNA 1HPGA 2BQ6B 1ZYOA 1C5OH 1S82A 1BMAA 1SGCA 1VJAU 2FTMA 1VGCB 1C4V2 4NA8A 4UFEH 1TONA 2TBSA 5GCHF 1RFNA 1CT2E 3EBNA 2FS8A 2XBXA 3BTHE 3C1KA 3F6UH 1ARCA 1W7XH 1DWBH 1P11E 1FN6A 1HFDA 2BX3A 2QF3A 2FI4E 3ZZ7A 1BMLA 3QO6A 4ABHA 1QNJA 2ZU3A 4WH6A 1WQSA 4E06H 3VB5A 1V2KT 4B2AA 4H42U 1VR1H 4Y8YA 1NFYA 1V2PT 3RU4T 2XWBI 1X7AC 3SJ8A 1OP0A 4ESTE 4K1SA 1BTXA 3GYMA 3WY8A 3E91A 3JZ1B 1GGDB 4AFUA 1K1JA 4UFDH 4Y8ZA 3SV9A 1GGDC 1WTHD 5JPMH 2W26A 4CHAB 4HTCH 4M7GA 1GI3A 1H9LB 2BD4A 2G8TA 3ZZ3A 3Q3KA 3U1IB 3RC5A 1J16A 3M3TA 1HAXB 1OWDA 2H6MA 3GY8A 3RLWH 1CGJE 2GKVE 2AIPA 4D9QA 5J4SA 2RDLA 1CT0E 1QCPA 2ZPSA 1GHVH 4ISOA 1C1WH 1JBUH 4ZAEA 1GHBG 5GWZA 1THPB 1W14U 1WTGH 3GCOA 4ABEA 1KLIH 1PPZA 3RMLH 5JDUB 5FX5A 1O2KA 4Y10E 2A0QB 3M3SA 1F0UA 1NO9H 1C1OA 3A7ZA 4AGJA 1OXGA 3KQEA 2A31A 1K1MA 1KXFA 3A83A 1EATA 1BB0B 1IQKA 1ZHRA 3M5LA 2XBWA 1AB9B 2ZFTA 3UREA 3HKIB 1O2HA 4ASHA 1N8OC 1F0TA 1ELAA 2PKSC 4ZHMU 2Z9IA 4A1XA 1YPLH 2P16A 2QAAA 4BTTB 1A0JA 3ZZ4A 2VGCC 4X1SU 1W0YH 2A45B 1DICA 4TYDA 3BTKE 3F1SB 1Z1IA 3KL6A 4BTIB 2A7HA 3TLOA 1T4VH 3A84A 1OWHA 3GYLB 3QGNB 2A4RA 4TWWA 2QF0A 1GI7B 1SLVB 4DJZB 1O5DH 3GCTF 4X2VA 2VVVA 2FYRA 2JETB 5HGGA 1L0ZA 2HNTE 3HGPA 1OP8A 4K1EA 1P2QA 3MWIU 1GBDA 1O5BB 4K8BA 1Z6EA 2BQWB 1C5SA 4DT7B 1Q31A 2NU3E 1RS0A 1C2MA 2NWNA 4K3JA 3QUMP 2ANYA 1O38A 1AHTH 2V0BA 1O2OA 5EW2H 3SHAH 2HPPH 1QGFA 1AKSA 2Y7ZA 1DDJA 1UTKA 3AASA 2ZTXA 3PTBA 2ZCKP 2DUCA 3TNSA 3P6ZB 3TH3H 4LZ1H 3FP7E 5JB8S 2GMTB 2PSYA 1FIZA 1DITH 2FODA 9ESTA 3KGPA 1VITH 2SGDE 2GMTC 2GT8A 3A85A 5EXMA 3RXAA 1D6RA 3LGIA 4Y0ZE 2SNVA 1TABE 4AB8A 4H4FA 1UTJA 1VCPA 1NRRH 1BJUA 1TMTH 4B74A 2FIRH 3KQBA 4TPIZ 3ZVBA 5A0AE 2VIQA 3PLBA 3GISB 3ZZ5A 2EC9H 5LGOA 2ZGJA 1QL7A 1O3OA 1QJ6B 1K1IA 4UE7H 4NWLA 2XC0A 3M35A 2A2XH 1GJDB 2OQ5A 3DHKH 1MKXH 2IOTA 1C1PA 3LJOA 4X6PA 3LGWA 4ZH8A 4FUFA 3V13A 5JBAS 2EA3A 3HK3B 4JZEH 1IQNA 4Q80A 1HAVB 2FEQH 2A4QA 1HAZB 1AD8H 5HXFA 4JK5A 4Q7YA 1XKAC 1TX6A 3STIA 2PGQB 1OSSA 1O3AA 1SVPA 3EA8A 1T8NA 1WQVH 2FPZA 1P02A 4H6TA 1AE8H 4R8TB 2AGIX 5C1UA 2CGAA 2VVUA 1P0SH 1EX3A 3M61U 5CE1A 5AVDA 1ZZZA 5CHAB 5DP3A 5K0HA 3I78A 1AZ8A 1YPEH 2ZDVH 3EGKH 1YPHC 4INHA 4WH8A 3RXJA 4F49A 4Z0KA 2P93A 1OYTH 1TLDA 1O0DH 1TYNA 5SGAE 3RC4A 1KLTA 4FU7A 1IQGA 1WSSH 1QB6A 3OU0A 1V2MT 1HXFH 2QXGA 3TH4H 2QGRA 1SLWB 3SJIA 3HATH 3RXSA 1F5RA 3HPTB 1S6HA 1OKXA 1V2ST 1MZDA 1FAXA 2G81E 1C1QA 2AMQA 5TCCA 3C27B 3LOXA 1W10U 3RU4E 2ZECA 3GY4A 2GCHF 3A88A 3PO1B 2UUFB 4B1TA 1P3CA 1SBWA 2GV7A 4MNVA 1A1RA 1C2GA 2VWMA 2F91A 5C1YA 1MAXA 4IMZA 3NXPA 4BAKB 5DJ7A 1AGJA 1EAUA 1G3EA 3OY5U 2Y80A 1JOUB 5AF9H 1DM4B 1GI0A 2ZCLP 3MU0A 1MTNC 5C67A 1ELCA 2KAIB 1GVZA 3ODFA 1SHYA 4BXWA 1BBRK 2FOHA 2BZAA 3TNTA 1DSUA 4THNH 3U8TH 1LPKB 5ESTE 1VITG 5DPAA 4JZ1A 4CREA 1DUEA 1K1OA 1DY8A 2FI5E 2ZGHA 3UUZA 2G5VA 1UMAH 3S0NA 3M7TA 1XKBC 3ODDA 1ELDE 1P2NA 4Y11E 1P9SA 3BSQA 2FP7B 1D3QB 3MU4A 1QIXB 1GMDG 2OP9A 2JH0D 2XTTB 1JMOH 2O8UA 1ID5H 3KEEA 1QRXA 3PWBA 3RUOA 3GCHC 1DX5M 2JETC 1BHXF 5EPYA 3ATLA 2BD9A 1FPCH 3TH2H 2B7DH 3B23B 1B0FA 1BTHH 3TJOA 4O3UA 1C9PA 3EAJA 3SNAA 5FPYA 3RXPA 5A8XA 3QTVH 1ZHPA 3AVZA 2WV5A 2BD3A 2QN5T 4RN6A 1AO5A 3GDUA 5A0BA 1O3DA 5T6GA 2G51A 1G30B 4D7FA 3UPEA 2EI6A 1SQOA 3U9AH 2D8WA 4DW2U 1BTZA 1ESBA 4XFQA 4YM9A 5FCKA 5JBCS 2BYAX 4KTUA 4LZ4B 5L30H 3TGJE 1MCVA 2F9BH 3RXIA 4O03A 1O32A 3P8FA 4FUJA 5EPNA 1CSOE 3P17H 2H9HA 3GICB 5DP6A 2YOLA 2GCTC 2QV1A 3VB3A 3EA9A 2W7SA 1C5VA 2XBVA 4BAHB 4ZMAH 1YPJH 4CR5A 3RXVA 1A7SA 3TK5A 3RM2H 3E16B 1E34B 1BRBE 5AHGH 1C5LH 6GCHG 3EA7A 5FAHA 4U2WA 1RIWC 1OWKA 1ZJDA 3NK8A 4QT8C 5C5NA 1Z71A 4MPVA 5PTPA 1AFQC 4ZXYH 1KDQA 5DGJA 5H4IB 3U8RH 1DOJA 2J38A 4NG9H 3FVFB 2FI3E 4MNWA 2OQUA 1AZZA 3MH6A 1S85A 1RJXB 3A7YA 3SU0A 4A7IB 1B7XB 1C2HA 1NPMA 5DO4H 1O2JA 1O3CA 3OTJE 2Z7FE 3SU5A 1L4ZA 2A7CA 3E1XB 4NIVA 1DS2E 2I6SA 3LONA 2D2DA 3UTUH 1CT4E 3ZVAA 3H5CB 3HKJB 5F8ZA 3F9FA 4FUGA 3R3GB 1OWJA 1GMCF 3S7KB 3URDA 4ABBA 2M5TA 2VGCB 4NA7A 3P8OA 1XUGA 3F9GA 1C5YB 4BAQB 3GDSA 1Y3XA 2FLBH 5ETXA 2ANWA 3I29A 2ZDLA 2G4UA 1QR3E 2BXUH 3ZZDA 1LQDB 2Q6DA 2HLCA 2BLWA 2AGGX 2NU0E 1L1JA 1GJ8B 2DE8A 4KP0A 4SGBE 7LPRA 1UCYE 1SOZA 2B8OH 1V2QT 2EI7A 1W3CA 2BDYA 2P3UB 5EGMA 1TRMA 4FUBA 4GPGA 1HAYB 2W7UA 1YC0A 4AG2A 1AVGH 1P3EA 3O8BA 4B2CA 3EQ0H 3S69A 1U6QA 1P9UA 1ZPCA 1NFUA 2PLXA 3ZVEA 4WY3A 2TIOA 3UNSA 1SG8B 3U8OH 1AFEH 1TWXB 1QURH 1EZSC 3V12A 1UTOA 1SGTA 1YBWA 1BRAA 2F9UA 2RCEA 4H6SB 1K1LA 1LTOA 3VB4A 1H8DH 2V3OH 3DD2H 1EAXA 3V7TA 1H8IH 4X0WU 1UVUH 1SL3A 3BTME 4FUCA 3MNXA 2FS9A 2VINA 4ZKOU 1P10A 4YOIA 1XVOA 3D23A 1CA0B 2FOMB 4Y7AA 5FHTA 1BA8B 2ZKSA 3W95A 2H9EH 1C5RA 3A8AA 4IN1A 1DUAA 4AN7A 2Z9GA 1GJBB 1QQ4A 1EOJA 3M36A 5A09A 1K9OE 1QBOA 1SGFG 1ZTJA 1GDQA 1C5WB 1EZUC 1E35B 1TIOA 1DWCH 1Z6JH 1MU6B 1YM0A 5EOKA 3T5FH 5EG4A 2ZU4A 1ELBA 5J4QA 1G9IE 1ETSH 1LVYA 2BMGB 1W2KH 6ESTA 3BTEE 1MZAA 1O2RA 3IITA 1HDTH 4BOHA 3ATIA 2R9PA 5LPRA 4UDWH 2Q6FA 1ESTA 1P2MA 3BTTE 4Y79A 4FU8A 4TPYA 1HIAB 1FY8E 4A1TA 4YT6H 1AQ7A 1GJ9B 3QZRA 1AKSB 1A5IA 1PPBH 3ZZAA 4ABJA 1P05A 3VFEA 2VJ1A 2A32A 4AYVB 1T4UH 2H5CA 1SGFA 3A87A 2OC1A 1TNKA 2AFQB 2IJOB 1GCTC 2GZ7A 4U01A 7GCHG 1LHFH 1BTYA 3NKKA 1NRNH 1UJ1A 4Y76A 3GY5A 1TB6H 3A7XA 3FFGA 1AI8H 1AWHB 1O37A 2VH6A 2XCNA 2Y82A 2WV4A 4X8VH 1QL8A 4AORA 3SNCA 4KELA 4MLFB 3EYDA 2ZU1A 2OINA 3LGYA 2ODPA 2VIOA 4NGAH 2ILNA 1L1GA 2PKAB 1MD8A 1MU8B 1JIRA 1F0SA 4GSOA 5AFYH 2PW8H 2Z3EA 1MQ6A 3D65E 1NFWA 3L3TA 1AMHA 2PGBB 2ZI2H 1K21H 2XC5A 4MPXA 4E05H 4K5ZA 2GP9B 1IQMA 1PYTD 3P92A 1BMMH 1O36A 2VIDA 2J94A 3K2UA 1GI6A 3SN8A 1DVAH 1BCUH 1E0FD 4HFPB 4BAOB 3BTQE 1SGDE 2W3IA 4X1NU 1C2IA 2VNTA 2IN2A 2K1QA 4MPWA 4SGAE 1HNEE 1BTUA 1QJ1B 2BD7A 1C2DA 1O2PA 1EXFA 1W11U 2ANMH 3TK9A 4I8HA 2YNAA 3DT0H 3BN9A 2GX4A 1O2NA 4RSPA 4X1QU 1A5HA 1GHAG 1OWEA 3S7HB 1ZJKA 3U98H 2C3SA 3KNXA 2GTBA 2THFB 5DK1A 1V2TT 1YCPK 1LHEH 1FIWA 4ABGA 2A4GA 5T6DA 1GDNA 1NN6A 2C93B 1C1VH 3MNSA 4NSVA 5E8EH 1IHTH 3EDXB 5I25A 3M5MA 1EZQA 4FUEA 1F0RA 3SI4H 3KQCA 1O5FH 1CHGA 1TMBH 4YO9A 1PPEE 3ZV9A 3LDXH 3ZZ6A 3GCHB 1ARBA 1C5QA 1L2EA 3BEFB 4A92A 3MMGA 4A1VA 3UOPA 2P94A 4ZKRU 4OS6A 1O35A 1J15A 1DSTA 2PV9B 2RA0A 5ABWA 1FNIA 4IC6A 4Y71A 1P12E 2FXRA 1TGSZ 1GHYH 3T26A 1ZTLA 2JH6D 2FOCA 1RGQA 3BIVH 1ELEE 3B9FH 3RMNH 1CQQA 1C1SA 2O9QA 3VGCC 1HLTH 2RG3A 1ELGA 1YCPM 1C1MA 3KQDA 2BQ7B 1EAIA 4CHAC 1FY1A 4HGCA 1JIMA 2CF8H 2HPQH 1J17T 1GI2A 2ZFFH 3FANA 4FUIA 3RMOH 3ZVGA 4CRAA 2VB0A 1GCDA 1TA2A 3SJOA 3GCTG 1KSNA 1LKBA 1TGBA 3BTWE 1ZSKA 1GBCA 2BY9X 2I6QA 1P8VC 2ZO3H 3UOUA 3UR6A 1V2JT 1AWFH 7KMEH 1FV9A 3SNDA 5IDKA 2ODQA 4PROA 3RXDA 1LMWB 3UQOA 2JH5D 3M5OA 2TGTA 3FP8E 1C2KA 4ZKNU 1KXEA 4NFFA 2PFEA 1GBKA 4Y0YE 3VPKA 1ABJH 3BTDE 5HMAA 1QRZA 4LK4A 2ZHFH 2OUAA 2TGPZ 3QDZB 1S5SA 6GCHF 1ETRH 1OWIA 1O33A 3SORA 4YLUA 2BY6X 2QXIA 1MMJN 2XC4A 4GHQA 2F9OA 3MYWA 3RP2A 5DP4A 1YF4A 1TBQH 4JYTA 3MI4A 1NRSH 5CHAC 4U32A 1ANEA 3LGTA 1ELTA 2CN0H 4VGCC 3LC3A 1PPHE 2WUBA 1THRH 3VB7A 1XUJA 3SUDA 3PMBB 5FCRA 1VZQH 3PV4A 3A89A 3GOVB 3MO6A 1C2FA 2B5TB 2O8LA 4XDEA 1NROH 1MTWA 2BY5X 1CVWH 1GCTB 3SU6A 2RA3A 1LHGH 1NU9A 3M7QA 1W8BH 1HJ9A 5GDSH 4CH8B 4D7GA 2XNIA 1NY22 1GI1A 9LPRA 4IGDA 2FESH 1SFIA 1HCGA 1TPSA 4K69A 1CO7E 4GLYA 1OX1A 1LO6A 4DURA 1A0LA 3TGKE 2A2QH 1AIXH 2FOBA 3QLPH 2AERH 5EQQA 3GY6A 3UR9A 1N1LA 4XE4A 2STAE 1GG6B 1SGQE 4K1TA 3BV9B 1ELVA 3E6PH 2CMYA 1L1NA 1UVPA 2W3KA 3PO1C 3RXHA 4KTSA 2OCVB 3SNEA 2SFAA 3SUFA 4WJG2 1HRTH 1TQ0B 4IC5A 3ELAH 1O3LA 5C1XA 1WOFA 5F03A 4DIHH 2QXJA 2BDAA 4JZFH 1UVTH 3M37A 3HK6B 4I8LA 1V2OT 2O8TA 2VIWA 3SJ9A 1NU7B 4MQAA 1TNLA 2F83A 1GBHA 4WF8A 5FX6A 2UUKB 2ZPQA 1XUIA 3CP7A 2G55A 2FWWA 1ZHMA 1WAYB 2SGEE 1LHDH 1TPOA 1XMNB 1IQIA 1O3EA 1TAWA 1D6WA 1KXAA 1VITF 4FVDA 2FOGA 4D8NA 2H2ZA 1GBIA 5F6MA 1O2MA 1HXEH 3P70B 3DFJA 4BTUB 1VCWA 3RXTA 2Y5FA 4FU9A 1GI9B 1TX8A 1YCPH 5JBTA 1SFQB 1ZOMA 6CHAB 1PQ5A 1O3NA 1O3HA 3HGNA 4Z6AH 6CHAC 2EI8A 4GVUA 4MPUA 1SGIB 1QB9A 2R2WU 3VXEH 1S84A 5C20A 2XXLA 3ESTA 2F9PA 1O2GH 3B8JA 1Y3WA 4B2BA 1UK4A 1QBVH 1Z1JA 5CMXH 2PUXB 5DP5A 3ZZBA 4E7RG 4GCHF 1G2LA 4I8JA 1KY9A 4INKA 3SJKA 2QXHA 1YLDA 3PLPA 1XXFA 3TGIE 3MOCA 1GJ5H 4I8KA 1SGYE 4ISHH 2XCFA 1YLCA 4CRGA 4X1PU 4B75A 2WYJA 3LGVA 1EPTC 3URCA 1Y3YA 5C3NA 3SZNA 4ZHAA 2HNTC 2F9VA 2GCTB 1HAIH 3QZQA 2QC2A 4TWYA 5A0CA 1EJNA 1D3TB 4X6NA 5E0GA 1GBFA 1UVOA 5HM2A 3RXCA 5HYOA 2HWLB 3A8DA 4ISNA 1MKWK 3SBKA 1LVMA 2P3FH 3DUXH 3TITA 1TRNA 1ZLRA 2BDCA 1IQJA 2ZTZA 5F8TA 3UNQA 1BZXE 2O8MA 1KXDA 1FZZA 4BXSA 1H4WA 2OBQA 1GJ4H 3A7TA 3GCNA 1LCYA 2UUJB 1EP5A 1O5AB 3O8CA 1HAOH 1TFXA 3EE0B 1XUKA 3H7TA 1O3KA 1B5GH 1QY6A 2ALPA 2TRMA 2CJIA 2C90B 2ZQ2A 4I31A 2GDDA 1C5ZB 1P57B 1O3JA 5LPEA 1O3BA 1SHHB 2B9LA 3K9XB 2NU2E 3DFLA 3BG4B 3U1JB 4ZUHA 1QA7A 2PWXA 1NESE 1S6FA 1XXDA 3BG4C 4BNRA 2Z9LA 1GI4A 3K6ZA 1DXWA 1OPHB 1N8OB 2GGVB 2STBE 1MUEB 1MCTA 1P03A 2ULLA 1H1BA 1FJSA 5EXNA 3UWIA 1MTVA 2HVXA 3ENSB 1GBBA 1F2SE 4NIWA 4WMDA 3UQVA 1O3FA 1G3DA 3SV8A 4J1YA 2WPIS 1N6YA 1GMHG 2XYAA 5E0HA 1C5NH 2ZNKH 1A4WH 1C4Y2 1FPHH 1FY5A 2D26C 2ZDKA 3TIUA 3T29A 2EEKA 1GG6C 2A7JA 4JK6A 3RXGA 3LH3A 1HB0B 1JRSA 3F9HA 2P8OB 1P2KA 4AFQA 1DXPA 1HV7A 1T8OA 2ZFRH 3RM0H 1V2UT 4X6MA 4ZHLU 1O34A 2ZP0H 2V3HH 1E37B 4BANB 8KME2 3AAUA 3FP6E 2LNCA 4YT7H 2QCYA 1GJ6A 1SB1H 5GPIB 1P06A 1THSH 1ZSJA 1T8LA 2GCHG 2OLGA 1TNGA 2UWOA 1Q2WA 1SSXA 4IW4E 3SUGA 4ABAA 1BRCE 2NU1E 1E38B 1ZPBA 4YESB 4U30A 1BQYA 3RXBA 4CRBA 1GHWH 1UHBA 3VGCB 3SU2A 3RXUA 2BY7X 3BF6H 2SGFE 2ZDAH 1IHSH 5L2YH 2UUYA 1HBTH 1TGCA 2FLRH 1IQFA 2BM2A 3E8LA 3ATWA 3MTYA 1CHOF 1G3BA 4Q7XA 4NZQA 4AZ2B 1HAGE 2Y6TA 2C4FH 3LJJA 5C2ZA 2LIZA 1CHOG 3NCLA 1GI8B 1HJAB 2G00A 3OYPA 3Q3XA 3OY6U 2Z9JA 2TGDA 5TCAA 1NM6A 3MFJA 1HJAC 1C2LA 4ZXXH 2BOHB 5EQRA 1UCYK 3UIRA 1GHBF 2WINI 4XBBA 4NSYA 1TE0A 1Y3UA 4RKOB 3SGBE 1BTPA 4D9RA 3MNBA 1ESAA 1YPMH 4FXGH 4D76A 2ZF0H 1Y5AT 5TJXA 2OC7A 1OP2A 1GMHF 4XSKU 3ZYDA 5DKMA 4CR9A 3BTFE 1G3CA 4NA9H 5BRRE 1GHXH 3PLKA 4KKDA 2ZPRA 4X8SH 3SU3A 1HAVA 3LIWA 4ISIH 3T62A 1ZPZA 3ZVFA 4A6LA 3KIDU 1TA6A 3RMMH 3RXOA 1SOTA 4IN2A 4CRDA 4YLQH 5LH8A 1UTLM 2ZFQH 1F5KU 1O5EH 1NTPA 1QJ7B 1P2OA 1GDUA 1SGPE 4CRFA 2FM2A 3QN7A 2GD4B 3ATMA 1QA0A 3E90B 1YP9A 1EB2A 2ZGBH 3LT3A 5HM9A 3JZ2B 1MQ5A 1ZGIA 4GUXA 1SI5H 1O2YA 5E0JA 4MNYA 4OGXA 8LPRA 5GCHG 3S9AA 3SQHE 2ZZUH 1A3EH 4AYYB 3E3TA 1O2UA 1O2QA 2WPKS 1N6XA 1M9UA 2FOFA 5L6NH 1KXBA 2BB4A 1TX7A 1FMGA 2XWAA 5I46H 1FY4A 3UWJH 6LPRA 3CS0A 2AMDA 4JMYA 2ZU5A 2FYQA 1QL9A 4NCYA 5EXLA 1K1NA 1CBWC 1Y8TA 1PPGE 3SU1A 1UHBB 1C5UA 3NZIA 1CBWB 4XBDA 2CF9H 4FUDA 1XVMA 1J14A 1TOMH
chains in the Genus database with same CATH superfamily
3LKWA 4IMQA 2GZ8A 1CA0C 2ZHWH 1EPTA 2J95A 1G36A 2ZA5A 3RXKA 1IQHA 1HYLA 1BT7A 1WV7H 1TQ7B 1O3PB 1TPPA 2VH0A 1FONA 4Y6DA 1QRWA 1BRUP 1RD3B 3BTGE 3ZV8A 3ZVCA 1MKXK 1RXPA 2A5AA 3GY7A 1RRKA 1LHCH 2G4TA 3P8GA 5FL7D 1IQLA 1A2CH 1C2EA 1C5XB 2TPIZ 3PB1E 3SV2H 2ZEBA 2VWNA 1W7GH 1DWEH 1K28D 1A5GH 2VBCA 4Q4LA 4INLA 4HZHA 3S9CA 2W5EA 1O2VA 1G2MA 2ZGCA 3KCGH 2OC8A 1EOLA 3QWCH 2O8WA 1O2ZA 1O39A 5AFZH 2BVXH 4ABFA 4J2YB 5EW1H 1SR5C 3RU4D 4CRCA 2BLVA 8GCHG 1TMUH 2QIQA 4WVPE 2ZHDA 1T32A 5EODA 1OOKB 2BXTH 2CV3A 2QA9E 1NZQH 3MO3A 4A5TS 1KIGH 1PPFE 5DG6A 3W94A 2H5DA 1EP6A 1DPOA 1S0QA 1RTLA 2BHGA 2ZGXH 4OGYA 1MAYA 3LGUA 3L33A 1DLEA 3UY9A 3SGAE 1UTNA 2BDBA 1FY3A 1DE7H 2OBOA 2Z3CA 1C1RA 2ESTE 2WSSD 4NZLA 3RXMA 1S83A 2ZFPH 1GJAB 3EE7A 1QBNA 5L2ZH 1W12U 1FQ3A 1TOCB 3UNRA 1GJCB 2FMJA 4X2XA 1O2SA 1RIWB 2B0FA 3VEQB 1AY6H 1LVBA 5GNDA 1TALA 2SGAA 1TNJA 4KTCA 4DOQA 1RTFB 2ZFSA 1TBRH 1SMFE 4X2YA 3T2NA 1AFQB 3O8RA 1J8AA 1S81A 2Z94A 1QFKH 1BBRE 2KAIA 4B71A 4VGCB 5T6FA 3CS7A 1AVXA 2A4OA 2KCOA 1OYQA 4OS2A 3SV7A 1TGTA 3AW1A 1Z8RA 2Q6GA 3KHVA 1D3PB 2BTCE 4UONA 1UK3A 3RC6A 1ANBA 1OS8A 5KGOA 3OX7U 3A80A 1W0JD 4MG3A 3PMHB 1A61H 4I8GA 2ALVA 1GVKB 3TJVA 1C1NA 2CHAC 2OTVA 4UFFH 3H7OA 4BAMB 4X8TH 1GHZA 2A5KA 5C5OA 2AGEX 1GBLA 1UTQA 1Z8IB 3Q3YA 4FUHA 1C2JA 1P2IA 3SW2B 4YTAA 3P8NA 1YKTA 4Y8XA 4I32A 5FBIA 2LPRA 2ZDMA 2R0LA 3MNCA 4AG1A 1FDPA 2ODYB 1Y59T 1W0ZU 2C8YB 1KXCA 1EB1H 2PP6A 4Q7ZA 4WXVA 1SQAA 4OS5A 3TPIZ 3RXLA 2FZZA 1GI5A 1Q3XA 1UO6A 1LKAA 1DY9A 1AE5A 5JB9S 1C5PA 1BIOA 1DWDH 3KN2A 4DY7B 4Z1MD 2HVYB 5HIYA 1NS3A 2Z6BD 4Y7BA 1O5GH 4OS7A 2P8OC 1INCA 5F8XA 1EKBB 2QF4A 2V3MA 1XUFA 1EJMA 3E0PB 3ZZCA 2FO9A 5CHBA 3VXFH 3NPSA 2OXSA 4MNXA 1TRYA 1TPAE 3T25A 4NIYA 5B6OA 5EQSA 3D49H 7GCHF 2ZHEH 1TBZH 1O3MA 4I33A 2UWLA 1Z7KA 1BBRH 2M2AA 1AN1E 1FN8A 4NIXA 4X8UH 2IJD1 4AOQA 2OK5A 2C8WB 4CBOA 1K1PA 1HAHH 3M7UA 3SUEA 3MH7A 1MBQA 2HGTH 4LXBH 1BJVA 4NFEA 3FZZA 1SC8U 1PYTC 4UFGH 2WUCA 3IG6B 3K65B 4OS4A 3AW0A 1WU1A 2WYGA 5E2PA 3STJA 1LPZB 1B0EA 3QTOH 1Z8GA 4TY6A 3LC5A 5JBBS 4R0IA 1QQUA 1DT2A 1QB1A 1K2I1 2BD8A 3T27A 2SNWA 3MU5A 3A7VA 4E7NA 1AVWA 3LU9B 4JZIA 4HI3A 3SOSA 1KTTB 4AX9H 2UWPA 3MH5A 4FVBA 3RXEA 1BOQA 4WXIA 3PV5A 1KLJH 1CU1A 4XOJA 4WWYA 4ZCNA 2BLOA 3G01A 4ZKSU 3FZDA 2AMPA 1HJ8A 2ZIQH 2BDHA 2GDEH 1C5MD 1GBMA 1ELFA 3GY3A 5KECA 1UCYH 3PTNA 3F0PA 3N7OA 1BTWA 1ORFA 1GBJA 1Y3VA 1AU8A 2BY8X 2OD3B 2VU8E 3OSYA 4AC9A 2BVSH 3DSOA 3A8CA 1H9HE 3S9BA 1ZMNA 2GVFA 5K7RA 1SPJA 4X2WA 3GY2A 1CA8B 1EPTB 3O8DA 4GAWA 2Y5GA 3SO3A 1HIAA 2HRVA 3ZYEA 4DCDA 5DP8A 1V2WT 3BEUA 3SQEE 4I7YH 1JRTA 1D3DB 4O97A 1H9IE 1PPCE 1NRQH 4ABIA 1UTPA 3PMJA 4YZUA 3I77A 3N7DA 3DA9B 4HG6A 1V2VT 3OEED 1AUTC 4AB9A 2PTCE 5KEDA 4ZROA 2PHBA 5C94A 3A8BA 1GBEA 2CXVA 3GDVA 1E36B 1ZMLA 4WMFA 2ZTYA 1WBGB 2GZ9A 1O2TA 2V35A 2ZCHP 3TJNA 1BUIA 1F5LA 1YGCH 1MTSA 1ZGVA 3UB0A 3SV6A 2QF5A 1WCZA 2R3YA 2VIVA 3VB6A 3QGJA 1GPZA 3PMAB 1EZXC 1V6DA 2ZDNA 3TJUA 2IPHA 1GBTA 3ZZ8A 3U69H 2BLQA 1NRPH 3OFND 1GMDF 3RXFA 4JCNA 3SHCH 3V0XA 1C1UH 3IWMA 4ASUD 3TVJB 2DE9A 1GVLA 1ANCA 1O2IA 4M9FA 4MTBA 4ISLA 1JXPA 2J2UA 3TK6A 3ZZ9A 1PJPA 5A8ZA 2R0KA 1G37A 1F92A 3ATKA 1PQ8A 2H9TH 1V2NT 1HGTH 1P2JA 1G32B 1MTNB 1O5CB 5HIZA 2HOBA 1T7CA 7ESTE 1BDAA 4B73A 2PKSB 1MBMA 1BMNH 3KYFA 5T3HA 1W13U 3A86A 1FI8A 2ANKH 3A82A 1ZRKA 4B76A 1IAUA 1DANH 3MHWU 2SGPE 2GT7A 1SLUB 5DSFA 4F4OC 3NUMA 2J5UA 3LPRA 1UVSH 3ITIA 4JYUH 2OC0A 3PM3A 2J34A 1GMCG 4F55A 1EUFA 4JZDH 2BZ6H 1O2LA 1VGCC 4X6OA 2FTLE 1T31A 4GCHG 3RXRA 1C9TA 4YOJA 1FAKH 1EJAA 1KYNA 5DP7A 5FPTA 2NU4E 2Z9KA 1SGRE 2VWOA 2YNBA 1MTUA 2A1DB 5ESBA 4AFZA 2BX4A 5JYIA 4RT0A 3MH4A 1EQ9A 4GHTA 5EU8A 2R3UA 1ZSLA 4WMEA 1YPHE 2PUQH 3AAVA 3L6PA 2C8XB 2WPMS 1XUHA 1QTFA 2AS9A 1BITA 1DFPA 3F9EA 2D1JA 3PWCA 5G4BA 1LVOA 1F7ZA 2Z3DA 4K2YA 1WYKA 1O3IA 4NWKA 4YOGA 5FBEA 1D4PB 3KF2A 1L4DA 2XW9A 1IQEA 4O3TA 4K8YA 3MO9A 1SQRA 1FLEE 1D9IA 1K22H 5GIBA 1O2XA 2ZG0H 3E0NB 4AFSA 1A46H 1GWAA 2WPJS 1KDQB 2G5NA 3RLYH 4CH2B 1MKWH 2P95A 1YYY1 4MDSA 3F3BA 2WPLS 1V2RT 4XBCA 3MU8A 2BD2A 3P95A 3SNBA 3MU1A 2PSXA 2SGQE 1Z8JB 1WUNH 3CENA 5FPSA 4KGAA 2AEIH 1CGHA 1FUJA 3Q77A 3WWFA 1T8MA 4UD9H 1C1TA 2GV6A 1BHXB 4Q2KA 2AHME 3PRDA 2HNTF 1V2LT 2AH4X 1C4U2 3SU4A 5EJZA 4DGJA 4UEHH 3TU7H 1VCQA 1FX0B 1A3BH 1O2WA 1O30A 1Y5BT 2VWLA 2XBYA 1PQ7A 2XOKD 2K7XA 1ABIH 1MD7A 2ZC9H 2J4IA 3R0FA 2P59A 2XRCA 1SGNE 2FX6A 1W0KD 3BG8A 2J92A 4LOYH 2PTNA 2FX4A 1GHAF 4JYVH 2F43B 3Q00A 4X1RU 1CGIE 1EAWA 1AUJA 1GJ7B 1SQTA 2BDGA 3BEIB 1LPGB 1J9CH 2PKAA 1XM1A 2BVRH 1AB9C 3D62A 2ZQ1A 1O31A 1P09A 1QHRB 1IOEA 1P04A 2BD5A 2A5IA 1P01A 3RXQA 2ZU2A 5E2OA 3SGQE 3ZVDA 2F3CE 1NBME 4DVAU 1PQAA 1RTKA 1VJ9U 1DLKB 2JKHA 2R2MB 4AGKA 3A7WA 4CBNA 3RDZA 1HAPH 1UK2A 2AYWA 2ZWLH 2AIQA 4DIIH 1V3XA 1SGEE 4ABDA 2CHAB 1O3GA 2Y81A 2J9NA 3LH1A 1UTMA 1ETTH 1NT1A 3A81A 5GJ4B 1A0HB 3BIUH 1LQEA 2ZHQH 2Y7XA 3V3MA 1ZRBA 2P3TB 1EASA 1YPGH 4TY7A 1LDTT 1ACBE 2WPHS 3SI3H 3T28A 1JWTA 3UFAA 5GXPA 1YPKH 2C8ZB 1PFXC 1TNIA 2F9NA 1GL1A 3SYJA 5IYTA 1ZMJA 2QY0B 4IS5A 3WW7A 5B6LA 3PROA 2FDAA 3K6YA 8GCHF 4MVNA 3QX5H 4I86A 2BOKA 8ESTE 1GL0E 1ZTKA 5A2MH 2Y5HA 2G52A 1CE5A 2QYIA 1GBAA 1SLXB 5BPEA 2KX4A 2Q1JA 2FOEA 2WPDD 2PR3A 2VVCA 3QK1A 1ANDA 5LPFA 4K60A 2ASUB 3UAIC 2TGAA 3M3VA 1FXYA 1XX9A 2HALA 2H1UA 1NFXA 1S0RA 2VIPA 4RKJB 3NWUA 5DP9A 3F68H 3FAOA 4O9VA 1NC6A 3PYHA 2FOAA 1C5TA 5FXLA 4OS1A 3M5NA 1MH0A 1TNHA 1Y5UT 2V6NA 1ZR0A 3Q76A 1HUTH 1KTSB 4IBLH 4DG4A 2BDIA 1TGNA 1K0HA 1HPGA 2BQ6B 1ZYOA 1C5OH 1S82A 1BMAA 1SGCA 1VJAU 2FTMA 1YY3A 1VGCB 1C4V2 4NA8A 4UFEH 1TONA 2TBSA 5GCHF 1RFNA 1CT2E 3EBNA 2FS8A 2XBXA 3BTHE 3C1KA 3F6UH 1ARCA 1W7XH 1DWBH 1P11E 1FN6A 1HFDA 2BX3A 2QF3A 2FI4E 3ZZ7A 1BMLA 3QO6A 4ABHA 1QNJA 2ZU3A 4WH6A 1WQSA 4E06H 3VB5A 1V2KT 4B2AA 4H42U 1VR1H 4Y8YA 5A8YA 2XNDD 1NFYA 1V2PT 3RU4T 2XWBI 1X7AC 3SJ8A 1OP0A 4ESTE 4K1SA 1BTXA 3GYMA 3WY8A 3E91A 3JZ1B 2F4LA 1GGDB 4AFUA 1K1JA 4UFDH 4Y8ZA 3SV9A 1GGDC 1WTHD 5JPMH 2W26A 1QZ8A 4CHAB 3OAAD 4HTCH 4M7GA 1GI3A 1H9LB 2BD4A 2G8TA 3ZZ3A 3Q3KA 3U1IB 3RC5A 1J16A 3M3TA 1HAXB 1OWDA 2H6MA 3GY8A 3RLWH 3DSGA 1CGJE 2GKVE 2AIPA 4D9QA 5J4SA 1CT0E 1QCPA 2RDLA 2ZPSA 1GHVH 4ISOA 1C1WH 1JBUH 4ZAEA 1GHBG 5GWZA 1THPB 1W14U 1WTGH 3GCOA 4ABEA 1KLIH 1PPZA 3RMLH 5JDUB 5FX5A 2QE7D 1O2KA 4Y10E 2A0QB 3M3SA 1F0UA 1NO9H 1C1OA 3A7ZA 4AGJA 1OXGA 3KQEA 2A31A 1K1MA 1KXFA 3A83A 1EATA 1BB0B 1IQKA 1ZHRA 3M5LA 2XBWA 1AB9B 2ZFTA 3UREA 3HKIB 1O2HA 2K0QA 3N99A 4ASHA 1N8OC 1F0TA 1ELAA 2PKSC 4ZHMU 2Z9IA 4A1XA 1YPLH 2P16A 2QAAA 4BTTB 1A0JA 3ZZ4A 2VGCC 4X1SU 1W0YH 2A45B 1DICA 4B6EA 4TYDA 3BTKE 3F1SB 1Z1IA 3KL6A 4BTIB 2A7HA 3TLOA 2LELA 1T4VH 3A84A 1OWHA 3GYLB 3QGNB 2A4RA 4TWWA 2QF0A 1GI7B 1SLVB 4DJZB 1O5DH 3GCTF 4X2VA 2VVVA 2FYRA 2JETB 5HGGA 1L0ZA 2HNTE 3HGPA 1OP8A 4K1EA 1P2QA 3MWIU 1GBDA 1O5BB 4K8BA 1Z6EA 2BQWB 1C5SA 4DT7B 1Q31A 2NU3E 1RS0A 3NRLA 1WXRA 1C2MA 2NWNA 4K3JA 3QUMP 2ANYA 1O38A 1AHTH 2V0BA 1O2OA 5EW2H 3SHAH 2HPPH 1QGFA 1AKSA 2Y7ZA 1DDJA 1UTKA 3AASA 2ZTXA 3PTBA 2WZQA 2ZCKP 2DUCA 3TNSA 3P6ZB 3TH3H 2W6JD 4LZ1H 3FP7E 5JB8S 2GMTB 2PSYA 1FIZA 1DITH 2FODA 9ESTA 3KGPA 1VITH 2SGDE 2GMTC 2GT8A 3A85A 5EXMA 3RXAA 1D6RA 3LGIA 4Y0ZE 2SNVA 1H8HD 1TABE 4AB8A 4H4FA 1UTJA 1VCPA 1NRRH 1BJUA 1TMTH 4B74A 2FIRH 3KQBA 4TPIZ 3ZVBA 5A0AE 2VIQA 3PLBA 3GISB 3ZZ5A 2EC9H 5LGOA 2ZGJA 1QL7A 1O3OA 1QJ6B 1K1IA 4UE7H 4NWLA 2XC0A 3M35A 2A2XH 1GJDB 2OQ5A 3DHKH 1MKXH 2IOTA 1C1PA 3LJOA 4X6PA 3LGWA 3W1EA 4ZH8A 4FUFA 3V13A 5JBAS 2EA3A 3HK3B 4JZEH 1MABB 1IQNA 4Q80A 4YXWD 1HAVB 2FEQH 1E1QD 2A4QA 1HAZB 1AD8H 5HXFA 4JK5A 4Q7YA 1XKAC 1TX6A 3STIA 2PGQB 1OSSA 1O3AA 1SVPA 3EA8A 1T8NA 1WQVH 2FPZA 1P02A 4H6TA 1AE8H 4R8TB 2AGIX 5C1UA 2CGAA 1COWD 2VVUA 2KR7A 1P0SH 1EX3A 3M61U 5CE1A 5AVDA 1ZZZA 5CHAB 5DP3A 5K0HA 3I78A 1AZ8A 1YPEH 2ZDVH 3EGKH 1YPHC 4INHA 4WH8A 3RXJA 4F49A 4Z0KA 2P93A 1OYTH 1TLDA 1O0DH 1TYNA 5SGAE 3RC4A 1KLTA 4FU7A 1IQGA 1WSSH 1QB6A 3OU0A 1V2MT 1HXFH 4OM9A 2QXGA 2YMSD 3TH4H 2QGRA 1SLWB 3SJIA 3HATH 3RXSA 1F5RA 3HPTB 1S6HA 1OKXA 1V2ST 1MZDA 1FAXA 2G81E 1C1QA 2AMQA 5TCCA 3C27B 3LOXA 1W10U 3RU4E 2ZECA 3GY4A 2GCHF 3A88A 3PO1B 2UUFB 4B1TA 1P3CA 1SBWA 2GV7A 4MNVA 1A1RA 1C2GA 2VWMA 2F91A 2KZ4A 5C1YA 1MAXA 4IMZA 3NXPA 4BAKB 5DJ7A 1AGJA 1EAUA 1G3EA 3OY5U 2Y80A 1JOUB 5AF9H 1DM4B 1GI0A 2ZCLP 3MU0A 1MTNC 5C67A 1ELCA 2KAIB 1GVZA 3ODFA 1SHYA 4BXWA 1BBRK 2FOHA 2BZAA 3TNTA 1DSUA 4THNH 3U8TH 5DN6D 1LPKB 5ESTE 1VITG 5DPAA 4JZ1A 4CREA 2W6ID 1DUEA 1K1OA 1DY8A 2FI5E 2ZGHA 2KM0A 3UUZA 2G5VA 1UMAH 3S0NA 3M7TA 1XKBC 3ODDA 1ELDE 1P2NA 4Y11E 2JDID 1P9SA 3BSQA 2FP7B 1D3QB 3MU4A 1QIXB 1GMDG 2OP9A 2JH0D 2XTTB 1JMOH 2O8UA 1ID5H 3KEEA 1QRXA 3PWBA 3RUOA 3GCHC 1DX5M 2JETC 1BHXF 5EPYA 3ATLA 2BD9A 1FPCH 3TH2H 2B7DH 2RDEA 3B23B 1B0FA 1BTHH 3TJOA 4O3UA 1C9PA 3EAJA 3SNAA 5FPYA 3RXPA 5A8XA 3QTVH 1ZHPA 3AVZA 2WV5A 2BD3A 3PV2A 2QN5T 4RN6A 1AO5A 3GDUA 5A0BA 1O3DA 5T6GA 2G51A 1G30B 4D7FA 3UPEA 2EI6A 1SQOA 3U9AH 2D8WA 4DW2U 1BTZA 1ESBA 4XFQA 4YM9A 5FCKA 5JBCS 2BYAX 4KTUA 4LZ4B 5L30H 3TGJE 1MCVA 4P02A 2F9BH 3RXIA 4O03A 1O32A 3P8FA 4FUJA 5EPNA 1CSOE 3P17H 2H9HA 3GICB 2EQNA 5DP6A 2YOLA 2GCTC 2QV1A 3VB3A 3EA9A 2W7SA 1C5VA 2XBVA 4BAHB 4ZMAH 1YPJH 4CR5A 3RXVA 1A7SA 3TK5A 3RM2H 3E16B 2J98A 1E34B 1BRBE 5AHGH 1C5LH 6GCHG 3EA7A 5FAHA 4U2WA 1RIWC 1OWKA 1ZJDA 3NK8A 4QT8C 5C5NA 3AK5A 1Z71A 4MPVA 5PTPA 1AFQC 4ZXYH 1KDQA 1SKYE 5DGJA 5H4IB 3U8RH 2RFKC 1DOJA 2J38A 4NG9H 3FVFB 2FI3E 4MNWA 2OQUA 1AZZA 3FO8D 3MH6A 1S85A 1RJXB 3A7YA 3SU0A 4A7IB 1B7XB 1C2HA 1NPMA 3ZIAD 1O2JA 5DO4H 1O3CA 3OTJE 2Z7FE 3SU5A 1NBMD 1L4ZA 2A7CA 3E1XB 4NIVA 1DS2E 2I6SA 3LONA 2D2DA 3U28C 1CT4E 3UTUH 3ZVAA 5EIYA 3H5CB 3HKJB 5F8ZA 3F9FA 4FUGA 3R3GB 1OWJA 1GMCF 3S7KB 3URDA 4ABBA 2M5TA 2VGCB 3DSPA 4NA7A 3P8OA 1XUGA 3WWBA 3F9GA 1C5YB 2J98B 4BAQB 3GDSA 1Y3XA 2FLBH 5ETXA 2ANWA 3I29A 2ZDLA 2G4UA 1QR3E 2BXUH 3ZZDA 1LQDB 2Q6DA 2HLCA 2BLWA 2AGGX 5HKKD 2NU0E 1L1JA 1GJ8B 2DE8A 4KP0A 4SGBE 7LPRA 1UCYE 1SOZA 2B8OH 1V2QT 2EI7A 1W3CA 2BDYA 2P3UB 4ACBA 5EGMA 1TRMA 4FUBA 4GPGA 1HAYB 2EY4C 2W7UA 1YC0A 5T1VA 4AG2A 1AVGH 1P3EA 3PRBA 3O8BA 4B2CA 3EQ0H 3S69A 1U6QA 3FOAA 1P9UA 1ZPCA 1NFUA 2PLXA 3ZVEA 4WY3A 2TIOA 3UNSA 4F48B 1SG8B 3U8OH 1AFEH 1TWXB 1QURH 1EZSC 3V12A 1UTOA 1SGTA 1YBWA 1BRAA 2F9UA 2RCEA 4H6SB 1K1LA 1LTOA 3VB4A 1H8DH 2V3OH 3DD2H 1EAXA 3V7TA 5C0UA 1H8IH 4X0WU 1UVUH 1SL3A 2IPQX 3BTME 4FUCA 3MNXA 2FS9A 2VINA 4ZKOU 1P10A 4YOIA 1XVOA 3D23A 1CA0B 2FOMB 4Y7AA 5FHTA 1BA8B 2ZKSA 3W95A 2H9EH 1C5RA 3A8AA 4IN1A 1DUAA 5EJ1A 4AN7A 2Z9GA 1GJBB 1QQ4A 1EOJA 3M36A 5A09A 1K9OE 1QBOA 1SGFG 1ZTJA 1GDQA 1C5WB 1EZUC 1E35B 1TIOA 1DWCH 1Z6JH 1MU6B 1YM0A 5EOKA 3T5FH 5EG4A 2ZU4A 1ELBA 5J4QA 1G9IE 1ETSH 1LVYA 2BMGB 1W2KH 6ESTA 3BTEE 1MZAA 1O2RA 3IITA 1HDTH 1E1RD 4BOHA 3ATIA 2R9PA 5LPRA 4UDWH 2Q6FA 1ESTA 1P2MA 3BTTE 4Y79A 4FU8A 4TPYA 1HIAB 1FY8E 4A1TA 4YT6H 1AQ7A 1GJ9B 3FKSD 3QZRA 1AKSB 1A5IA 1PPBH 3SZEA 1VKYA 3ZZAA 4ABJA 1P05A 3VFEA 2VJ1A 2A32A 4Q63A 4AYVB 1T4UH 2H5CA 1SGFA 3A87A 2OC1A 1TNKA 2AFQB 3OTPA 2IJOB 1GCTC 2GZ7A 4U01A 7GCHG 1LHFH 1BTYA 3NKKA 1NRNH 1YWUA 1UJ1A 4Y76A 3GY5A 1TB6H 3A7XA 3MQKC 3FFGA 1AI8H 1AWHB 1O37A 2VH6A 2XCNA 2Y82A 2WV4A 4X8VH 1QL8A 4AORA 3SNCA 4KELA 4MLFB 3EYDA 2ZU1A 2OINA 3LGYA 2ODPA 2VIOA 4NGAH 2ILNA 1L1GA 2PKAB 1MD8A 2L74A 2YMSB 1MU8B 1JIRA 1F0SA 4GSOA 5AFYH 2PW8H 2Z3EA 1MQ6A 3D65E 1NFWA 3L3TA 1AMHA 2PGBB 2ZI2H 1K21H 2XC5A 4MPXA 4E05H 4K5ZA 2GP9B 1IQMA 1PYTD 3P92A 1BMMH 1O36A 2VIDA 2J94A 3K2UA 1GI6A 3SN8A 1DVAH 1BCUH 1E0FD 4HFPB 4BAOB 2HLDD 3BTQE 1SGDE 2W3IA 3KQ5A 4X1NU 1C2IA 2VNTA 2IN2A 2K1QA 4MPWA 4SGAE 1HNEE 1BTUA 1QJ1B 3F2HA 2BD7A 1C2DA 4P00A 1O2PA 1EXFA 1W11U 2ANMH 2J97A 3TK9A 4I8HA 2YNAA 3DT0H 3BN9A 2GX4A 1O2NA 4RSPA 4X1QU 1A5HA 1GHAG 1OWEA 3S7HB 1ZJKA 3U98H 2C3SA 3KNXA 2GTBA 2THFB 5DK1A 1V2TT 1YCPK 1LHEH 1FIWA 4ABGA 2A4GA 5T6DA 1GDNA 1NN6A 3H09A 2C93B 1C1VH 3MNSA 4NSVA 5E8EH 1IHTH 3EDXB 3GS9A 5I25A 3M5MA 1EZQA 4FUEA 1F0RA 3SI4H 3KQCA 1O5FH 1CHGA 1TMBH 4YO9A 1PPEE 3ZV9A 3OEHD 3LDXH 3ZZ6A 3GCHB 1ARBA 1C5QA 3KYGA 1L2EA 3BEFB 4A92A 3MMGA 4A1VA 3UOPA 2P94A 4RT1A 4ZKRU 4OS6A 1O35A 4FETA 1J15A 1S6LA 1DSTA 3CNRA 2PV9B 2RA0A 5ABWA 1FNIA 4IC6A 4Y71A 1P12E 2FXRA 1TGSZ 1GHYH 3F2GA 3T26A 1ZTLA 2JH6D 2FOCA 1RGQA 3BIVH 2LP6A 1ELEE 3B9FH 3RMNH 1CQQA 1C1SA 2O9QA 3VGCC 1HLTH 2RG3A 1ELGA 1YCPM 1C1MA 4DT4A 3KQDA 2BQ7B 1EAIA 3VG8A 4CHAC 1FY1A 4HGCA 1JIMA 2CF8H 2HPQH 1J17T 1GI2A 2ZFFH 3FANA 4FUIA 3RMOH 3ZVGA 4CRAA 2VB0A 1GCDA 1TA2A 3SJOA 3GCTG 1KSNA 1LKBA 1TGBA 3BTWE 1ZSKA 1GBCA 2BY9X 2I6QA 3FN8A 1P8VC 2ZO3H 3UOUA 3UR6A 1V2JT 1AWFH 7KMEH 1FV9A 3SNDA 5IDKA 2ODQA 4PROA 3RXDA 1LMWB 3UQOA 5F53A 2JH5D 3M5OA 2TGTA 3FP8E 1C2KA 4ZKNU 1KXEA 4NFFA 2PFEA 1GBKA 4Y0YE 3VPKA 1ABJH 3BTDE 2WV9A 4RI0A 1QRZA 5HMAA 4LK4A 1H8ED 2ZHFH 2OUAA 2TGPZ 3QDZB 1S5SA 6GCHF 4TSFD 1ETRH 2WHXA 1OWIA 1O33A 3SORA 4YLUA 2BY6X 2QXIA 1MMJN 2XC4A 4GHQA 2F9OA 3MYWA 3RP2A 5EJLA 5DP4A 1YF4A 1TBQH 4JYTA 3MI4A 1NRSH 5CHAC 4U32A 1ANEA 1EFRD 1ELTA 2CN0H 3LGTA 4VGCC 3LC3A 1PPHE 2WUBA 1THRH 3VB7A 1XUJA 3SUDA 3PMBB 5FCRA 1VZQH 3PV4A 3A89A 3GOVB 3MO6A 1C2FA 2B5TB 2O8LA 4XDEA 1NROH 1MTWA 2CK3D 2BY5X 1CVWH 1GCTB 3SU6A 2RA3A 1LHGH 1NU9A 3M7QA 1W8BH 1HJ9A 5GDSH 4CH8B 4D7GA 2XNIA 1NY22 1GI1A 9LPRA 4IGDA 2FESH 1SFIA 1HCGA 1TPSA 4K69A 1CO7E 4GLYA 1OX1A 1LO6A 4DURA 1A0LA 3TGKE 2A2QH 1AIXH 2FOBA 3QLPH 2AERH 5EQQA 3GY6A 3UR9A 1N1LA 4XE4A 4ACAA 2STAE 1GG6B 1SGQE 4K1TA 3BV9B 1ELVA 3E6PH 2CMYA 1L1NA 1UVPA 2W3KA 3PO1C 3RXHA 4KTSA 2OCVB 3SNEA 2SFAA 3SUFA 4WJG2 1HRTH 1TQ0B 4IC5A 3ELAH 1O3LA 5C1XA 1WOFA 5F03A 4DIHH 2QXJA 2BDAA 4JZFH 1UVTH 3M37A 3HK6B 4XD7D 1BMFD 4I8LA 1V2OT 2O8TA 2VIWA 3SJ9A 1NU7B 4MQAA 1TNLA 2F83A 1GBHA 4WF8A 5FX6A 2UUKB 2KFWA 2ZPQA 1XUIA 3CP7A 2G55A 1UW7A 2FWWA 1ZHMA 3F2FA 1WAYB 2SGEE 1LHDH 1TPOA 1XMNB 3DCLA 4B6FA 1IQIA 1O3EA 1TAWA 1D6WA 1KXAA 1VITF 4FVDA 2FOGA 4D8NA 2H2ZA 1GBIA 5F6MA 1O2MA 1HXEH 3P70B 3DFJA 4BTUB 1VCWA 3RXTA 1OHHD 2V7QD 2Y5FA 4FU9A 1GI9B 1TX8A 1YCPH 5JBTA 1SFQB 2KCAA 1ZOMA 6CHAB 1PQ5A 1O3NA 1O3HA 3HGNA 4Z6AH 6CHAC 2EI8A 4GVUA 4MPUA 1SGIB 1QB9A 2R2WU 3VXEH 1S84A 5C20A 2XXLA 3ESTA 2F9PA 1O2GH 3B8JA 1Y3WA 4B2BA 1UK4A 1QBVH 1Z1JA 5CMXH 2PUXB 5DP5A 3ZZBA 4E7RG 4GCHF 1G2LA 4I8JA 1KY9A 4INKA 3SJKA 2QXHA 5C0TA 1YLDA 3PLPA 1XXFA 3TGIE 3MOCA 1GJ5H 4I8KA 1SGYE 4ISHH 2XCFA 1YLCA 4CRGA 4X1PU 4B75A 2WYJA 3LGVA 1EPTC 3URCA 1Y3YA 5C3NA 3SZNA 4ZHAA 2HNTC 2F9VA 2GCTB 2K8IA 1HAIH 3QZQA 2QC2A 4TWYA 5A0CA 1EJNA 1D3TB 4X6NA 5E0GA 1GBFA 1UVOA 5HM2A 3RXCA 5HYOA 2HWLB 2L6OA 3A8DA 1MKWK 4ISNA 3SBKA 1LVMA 2P3FH 3DUXH 3TITA 1TRNA 1ZLRA 2BDCA 1IQJA 2ZTZA 5F8TA 3UNQA 1WDIA 4TT3D 1BZXE 2O8MA 1KXDA 1FZZA 4BXSA 2KCYA 1H4WA 2OBQA 1GJ4H 2YMSC 3A7TA 3GCNA 1LCYA 2UUJB 1EP5A 1O5AB 3O8CA 1HAOH 1TFXA 3EE0B 1XUKA 3H7TA 1O3KA 1B5GH 1E79D 1QY6A 2ALPA 2TRMA 2CJIA 3N7EA 2C90B 2ZQ2A 4I31A 2GDDA 1C5ZB 1P57B 1O3JA 5LPEA 1O3BA 1SHHB 2B9LA 3K9XB 2NU2E 3DFLA 3BG4B 3U1JB 4ZUHA 1QA7A 2PWXA 1NESE 1S6FA 1XXDA 3BG4C 4BNRA 2Z9LA 1GI4A 3K6ZA 1DXWA 1OPHB 1N8OB 2GGVB 2STBE 1MUEB 1MCTA 1P03A 2ULLA 1H1BA 1FJSA 5EXNA 3UWIA 1MTVA 2HVXA 3ENSB 1GBBA 1F2SE 4NIWA 4WMDA 3UQVA 1O3FA 1G3DA 3SV8A 4J1YA 5CDFE 2WPIS 1N6YA 1GMHG 2XYAA 5E0HA 1C5NH 2ZNKH 4FOUC 1A4WH 1C4Y2 1FPHH 1FY5A 2D26C 2ZDKA 1KMHB 3TIUA 3T29A 2EEKA 1GG6C 2A7JA 4JK6A 3RXGA 3LH3A 1HB0B 1JRSA 3F9HA 2P8OB 1P2KA 4AFQA 1DXPA 1HV7A 1T8OA 2ZFRH 3RM0H 1V2UT 4X6MA 4ZHLU 1O34A 2ZP0H 2V3HH 1E37B 4BANB 8KME2 3AAUA 3FP6E 2LNCA 4YT7H 2QCYA 1GJ6A 1SB1H 5GPIB 1YLNA 1P06A 1THSH 1ZSJA 1T8LA 2GCHG 2OLGA 1TNGA 2UWOA 1Q2WA 1SSXA 4IW4E 3SUGA 4ABAA 1BRCE 2NU1E 1E38B 1ZPBA 4YESB 4U30A 1BQYA 3RXBA 4CRBA 1GHWH 1UHBA 3VGCB 3SU2A 3RXUA 2BY7X 3BF6H 2SGFE 2ZDAH 1IHSH 5L2YH 2UUYA 5C17A 1HBTH 1TGCA 2FLRH 1IQFA 2BM2A 3E8LA 3ATWA 3MTYA 1CHOF 1G3BA 4Q7XA 4NZQA 4AZ2B 1HAGE 2Y6TA 2C4FH 3LJJA 5C2ZA 2LIZA 1CHOG 3NCLA 1GI8B 1HJAB 2G00A 3OYPA 3Q3XA 3OY6U 2Z9JA 2TGDA 5TCAA 1NM6A 3MFJA 1HJAC 1C2LA 4ZXXH 2BOHB 5EQRA 1UCYK 3UIRA 1GHBF 2WINI 4XBBA 4NSYA 2JJ1D 1TE0A 1Y3UA 4RKOB 3OE7D 3SGBE 1BTPA 4D9RA 3MNBA 1ESAA 1YPMH 4FXGH 4D76A 2ZF0H 1Y5AT 5TJXA 2OC7A 1OP2A 1GMHF 4XSKU 3ZYDA 5DKMA 4CR9A 3BTFE 1G3CA 4NA9H 5BRRE 1GHXH 2JJ2D 3PLKA 3F0OA 4KKDA 2ZPRA 4X8SH 3SU3A 1HAVA 3LIWA 4ISIH 3T62A 1ZPZA 3ZVFA 4A6LA 3KIDU 1TA6A 5IK2D 3RMMH 3RXOA 1SOTA 4IN2A 4CRDA 4YLQH 5LH8A 1UTLM 2ZFQH 1F5KU 1O5EH 1NTPA 1QJ7B 1P2OA 1GDUA 1SGPE 4CRFA 2FM2A 3QN7A 2GD4B 3ATMA 1QA0A 3E90B 1YP9A 1EB2A 2ZGBH 3LT3A 5HM9A 3JZ2B 1MQ5A 1ZGIA 4GUXA 1SI5H 1O2YA 5E0JA 4MNYA 4OGXA 8LPRA 5GCHG 3S9AA 3SQHE 2ZZUH 1A3EH 4AYYB 3E3TA 1O2UA 1O2QA 2WPKS 1N6XA 1M9UA 2FOFA 5L6NH 1KXBA 2BB4A 2KCPA 1TX7A 1FMGA 2XWAA 5I46H 1FY4A 2GJGA 3UWJH 6LPRA 3CS0A 2AMDA 4JMYA 2ZU5A 2FYQA 1QL9A 4NCYA 5EXLA 1K1NA 4XRNA 1CBWC 1Y8TA 1PPGE 2JIZD 3SU1A 1UHBB 1C5UA 3NZIA 1CBWB 4XBDA 2CF9H 4FUDA 1XVMA 1J14A 1TOMH
chains in the Genus database with same CATH topology
3LKWA 4IMQA 2GZ8A 1CA0C 2ZHWH 1EPTA 2J95A 1G36A 2ZA5A 3RXKA 1IQHA 1HYLA 1BT7A 1WV7H 1TQ7B 1O3PB 1TPPA 2VH0A 1FONA 4Y6DA 1QRWA 1BRUP 1RD3B 3BTGE 3ZV8A 3ZVCA 1MKXK 1RXPA 2A5AA 3GY7A 1RRKA 1LHCH 2G4TA 3P8GA 1IQLA 1A2CH 1C2EA 1C5XB 2TPIZ 3PB1E 3SV2H 2ZEBA 2VWNA 1W7GH 1DWEH 1K28D 1A5GH 4INLA 4HZHA 3S9CA 2W5EA 1O2VA 1G2MA 2ZGCA 3KCGH 2OC8A 1EOLA 3QWCH 2O8WA 1O2ZA 1O39A 5AFZH 2BVXH 4ABFA 4J2YB 5EW1H 1SR5C 3RU4D 4CRCA 2BLVA 8GCHG 1TMUH 2QIQA 4WVPE 2ZHDA 1T32A 5EODA 1OOKB 2BXTH 2CV3A 2QA9E 1NZQH 3MO3A 4A5TS 1KIGH 1PPFE 5DG6A 3W94A 2H5DA 1EP6A 1DPOA 1S0QA 1RTLA 2BHGA 2ZGXH 4OGYA 1MAYA 3LGUA 3L33A 1DLEA 3UY9A 3SGAE 1UTNA 2BDBA 1FY3A 1DE7H 2OBOA 2Z3CA 1C1RA 2ESTE 4NZLA 3RXMA 1S83A 2ZFPH 1GJAB 1QBNA 5L2ZH 1W12U 1FQ3A 1TOCB 3UNRA 1GJCB 2FMJA 4X2XA 1O2SA 1RIWB 2B0FA 3VEQB 1AY6H 1LVBA 1TALA 2SGAA 1TNJA 4KTCA 4DOQA 1RTFB 2ZFSA 1TBRH 1SMFE 4X2YA 3T2NA 1AFQB 3O8RA 1J8AA 1S81A 2Z94A 1QFKH 1BBRE 2KAIA 4B71A 4VGCB 5T6FA 3CS7A 1AVXA 2A4OA 1OYQA 4OS2A 3SV7A 1TGTA 3AW1A 1Z8RA 2Q6GA 3KHVA 1D3PB 2BTCE 4UONA 1UK3A 3RC6A 1ANBA 1OS8A 3OX7U 3A80A 4MG3A 3PMHB 1A61H 4I8GA 2ALVA 1GVKB 3TJVA 1C1NA 2CHAC 2OTVA 4UFFH 3H7OA 4BAMB 4X8TH 1GHZA 2A5KA 5C5OA 2AGEX 1GBLA 1UTQA 1Z8IB 3Q3YA 4FUHA 1C2JA 1P2IA 3SW2B 4YTAA 3P8NA 1YKTA 4Y8XA 4I32A 5FBIA 2LPRA 2ZDMA 2R0LA 3MNCA 4AG1A 1FDPA 2ODYB 1Y59T 1W0ZU 2C8YB 1KXCA 1EB1H 4Q7ZA 4WXVA 1SQAA 4OS5A 3TPIZ 3RXLA 2FZZA 1GI5A 1Q3XA 1UO6A 1LKAA 1DY9A 1AE5A 5JB9S 1C5PA 1BIOA 1DWDH 3KN2A 4DY7B 1NS3A 2Z6BD 4Y7BA 1O5GH 4OS7A 2P8OC 1INCA 5F8XA 1EKBB 1XUFA 1EJMA 3E0PB 3ZZCA 2FO9A 3VXFH 3NPSA 2OXSA 4MNXA 1TRYA 1TPAE 3T25A 4NIYA 5B6OA 5EQSA 3D49H 7GCHF 2ZHEH 1TBZH 1O3MA 4I33A 2UWLA 1Z7KA 1BBRH 1AN1E 1FN8A 4NIXA 4X8UH 4AOQA 2C8WB 4CBOA 1K1PA 1HAHH 3M7UA 3SUEA 3MH7A 1MBQA 2HGTH 4LXBH 1BJVA 4NFEA 3FZZA 1SC8U 1PYTC 4UFGH 2WUCA 3IG6B 3K65B 4OS4A 3AW0A 1WU1A 2WYGA 5E2PA 3STJA 1LPZB 1B0EA 3QTOH 1Z8GA 4TY6A 3LC5A 5JBBS 4R0IA 1QQUA 1DT2A 1QB1A 1K2I1 2BD8A 3T27A 2SNWA 3MU5A 3A7VA 4E7NA 1AVWA 3LU9B 4JZIA 4HI3A 3SOSA 1KTTB 4AX9H 2UWPA 3MH5A 4FVBA 3RXEA 1BOQA 4WXIA 1KLJH 1CU1A 4XOJA 4WWYA 2BLOA 3G01A 4ZKSU 3FZDA 2AMPA 1HJ8A 2ZIQH 2BDHA 2GDEH 1C5MD 1GBMA 1ELFA 3GY3A 1UCYH 3PTNA 3N7OA 1BTWA 1ORFA 1GBJA 1Y3VA 1AU8A 2BY8X 2OD3B 2VU8E 3OSYA 2BVSH 3A8CA 1H9HE 3S9BA 1ZMNA 2GVFA 5K7RA 1SPJA 4X2WA 3GY2A 1CA8B 1EPTB 3O8DA 4GAWA 2Y5GA 3SO3A 1HIAA 2HRVA 3ZYEA 4DCDA 5DP8A 1V2WT 3BEUA 3SQEE 4I7YH 1JRTA 1D3DB 4O97A 1H9IE 1PPCE 1NRQH 4ABIA 1UTPA 3PMJA 4YZUA 3I77A 3DA9B 1V2VT 1AUTC 4AB9A 2PTCE 4ZROA 2PHBA 3A8BA 1GBEA 2CXVA 3GDVA 1E36B 1ZMLA 4WMFA 2ZTYA 1WBGB 2GZ9A 1O2TA 2V35A 2ZCHP 3TJNA 1BUIA 1F5LA 1YGCH 1MTSA 1ZGVA 3SV6A 1WCZA 2R3YA 2VIVA 3VB6A 3QGJA 1GPZA 3PMAB 1EZXC 1V6DA 2ZDNA 3TJUA 2IPHA 1GBTA 3ZZ8A 3U69H 2BLQA 1NRPH 3RXFA 1GMDF 4JCNA 3SHCH 3V0XA 1C1UH 3IWMA 3TVJB 2DE9A 1GVLA 1ANCA 1O2IA 4MTBA 4ISLA 1JXPA 2J2UA 3TK6A 3ZZ9A 1PJPA 5A8ZA 2R0KA 1G37A 1F92A 3ATKA 1PQ8A 2H9TH 1V2NT 1HGTH 1P2JA 1G32B 1MTNB 1O5CB 2HOBA 1T7CA 7ESTE 1BDAA 4B73A 2PKSB 1MBMA 1BMNH 5T3HA 1W13U 3A86A 1FI8A 2ANKH 3A82A 1ZRKA 4B76A 1IAUA 1DANH 3MHWU 2SGPE 2GT7A 1SLUB 4F4OC 3NUMA 3LPRA 1UVSH 3ITIA 4JYUH 2OC0A 3PM3A 2J34A 1GMCG 1EUFA 4JZDH 2BZ6H 1O2LA 1VGCC 4X6OA 2FTLE 1T31A 4GCHG 3RXRA 1C9TA 4YOJA 1FAKH 1EJAA 1KYNA 5DP7A 5FPTA 2NU4E 2Z9KA 1SGRE 2VWOA 2YNBA 1MTUA 2A1DB 5ESBA 4AFZA 2BX4A 5JYIA 3MH4A 1EQ9A 4GHTA 5EU8A 2R3UA 1ZSLA 4WMEA 1YPHE 2PUQH 3AAVA 3L6PA 2C8XB 2WPMS 1XUHA 1QTFA 2AS9A 1BITA 1DFPA 3F9EA 2D1JA 3PWCA 5G4BA 1LVOA 1F7ZA 2Z3DA 4K2YA 1WYKA 1O3IA 4NWKA 4YOGA 5FBEA 1D4PB 3KF2A 1L4DA 2XW9A 1IQEA 4O3TA 4K8YA 3MO9A 1FLEE 1D9IA 1K22H 5GIBA 1O2XA 2ZG0H 3E0NB 4AFSA 1A46H 1GWAA 2WPJS 1KDQB 2G5NA 3RLYH 4CH2B 1MKWH 2P95A 1YYY1 4MDSA 2WPLS 1V2RT 4XBCA 3MU8A 2BD2A 3P95A 3SNBA 3MU1A 2PSXA 2SGQE 1Z8JB 1WUNH 3CENA 5FPSA 4KGAA 2AEIH 1CGHA 1FUJA 3Q77A 1T8MA 4UD9H 1C1TA 2GV6A 1BHXB 4Q2KA 2HNTF 1V2LT 2AH4X 1C4U2 3SU4A 4DGJA 4UEHH 3TU7H 1VCQA 1A3BH 1O2WA 1O30A 1Y5BT 2VWLA 2XBYA 1PQ7A 2ZC9H 2K7XA 1ABIH 1MD7A 5A8YA 2J4IA 3R0FA 2P59A 2XRCA 1SGNE 2FX6A 3BG8A 2J92A 4LOYH 2PTNA 2FX4A 1GHAF 4JYVH 3Q00A 4X1RU 1CGIE 1EAWA 1AUJA 1GJ7B 1SQTA 2BDGA 3BEIB 1LPGB 1J9CH 2PKAA 1XM1A 2BVRH 1AB9C 3D62A 2ZQ1A 1O31A 1P09A 1QHRB 1IOEA 1P04A 2BD5A 2A5IA 1P01A 3RXQA 2ZU2A 5E2OA 3SGQE 3ZVDA 2F3CE 4DVAU 1PQAA 1RTKA 1VJ9U 1DLKB 2JKHA 2R2MB 4AGKA 3A7WA 4CBNA 3RDZA 1HAPH 1UK2A 2AYWA 2ZWLH 2AIQA 4DIIH 1V3XA 1SGEE 4ABDA 2CHAB 1O3GA 2Y81A 2J9NA 3LH1A 1UTMA 1ETTH 1NT1A 3A81A 5GJ4B 1A0HB 3BIUH 1LQEA 2ZHQH 2Y7XA 3V3MA 1ZRBA 2P3TB 1EASA 1YPGH 4TY7A 1LDTT 1ACBE 2WPHS 3SI3H 3T28A 1JWTA 3UFAA 5GXPA 1YPKH 2C8ZB 1PFXC 1TNIA 2F9NA 1GL1A 5IYTA 1ZMJA 2QY0B 4IS5A 3PROA 2FDAA 3K6YA 8GCHF 4MVNA 3QX5H 2BOKA 8ESTE 1GL0E 1ZTKA 5A2MH 2Y5HA 2G52A 1CE5A 2QYIA 1GBAA 1SLXB 5BPEA 2Q1JA 2FOEA 2PR3A 2VVCA 3QK1A 1ANDA 5LPFA 4K60A 2ASUB 2TGAA 3M3VA 1FXYA 1XX9A 2HALA 2H1UA 1NFXA 1S0RA 2VIPA 4RKJB 3NWUA 5DP9A 3F68H 3FAOA 4O9VA 1NC6A 3PYHA 2FOAA 1C5TA 5FXLA 4OS1A 3M5NA 1MH0A 1TNHA 1Y5UT 2V6NA 1ZR0A 3Q76A 1HUTH 1KTSB 4IBLH 4DG4A 2BDIA 1TGNA 1HPGA 2BQ6B 1ZYOA 1C5OH 1S82A 1BMAA 1SGCA 1VJAU 2FTMA 1VGCB 1C4V2 4NA8A 4UFEH 1TONA 2TBSA 5GCHF 1RFNA 1CT2E 3EBNA 2FS8A 2XBXA 3BTHE 3C1KA 3F6UH 1ARCA 1W7XH 1DWBH 1P11E 1FN6A 1HFDA 2BX3A 2QF3A 2FI4E 3ZZ7A 1BMLA 3QO6A 4ABHA 1QNJA 2ZU3A 4WH6A 1WQSA 4E06H 3VB5A 1V2KT 4B2AA 4H42U 1VR1H 4Y8YA 1NFYA 1V2PT 3RU4T 2XWBI 1X7AC 3SJ8A 1OP0A 4ESTE 4K1SA 1BTXA 3GYMA 3WY8A 3E91A 3JZ1B 1GGDB 4AFUA 1K1JA 4UFDH 4Y8ZA 3SV9A 1GGDC 1WTHD 5JPMH 2W26A 4CHAB 4HTCH 4M7GA 1GI3A 1H9LB 2BD4A 2G8TA 3ZZ3A 3Q3KA 3U1IB 3RC5A 1J16A 3M3TA 1HAXB 1OWDA 2H6MA 3GY8A 3RLWH 1CGJE 2GKVE 2AIPA 4D9QA 5J4SA 2RDLA 1CT0E 1QCPA 2ZPSA 1GHVH 4ISOA 1C1WH 1JBUH 4ZAEA 1GHBG 5GWZA 1THPB 1W14U 1WTGH 3GCOA 4ABEA 1KLIH 1PPZA 3RMLH 5JDUB 5FX5A 1O2KA 4Y10E 2A0QB 3M3SA 1F0UA 1NO9H 1C1OA 3A7ZA 4AGJA 1OXGA 3KQEA 2A31A 1K1MA 1KXFA 3A83A 1EATA 1BB0B 1IQKA 1ZHRA 3M5LA 2XBWA 1AB9B 2ZFTA 3UREA 3HKIB 1O2HA 4ASHA 1N8OC 1F0TA 1ELAA 2PKSC 4ZHMU 2Z9IA 4A1XA 1YPLH 2P16A 2QAAA 4BTTB 1A0JA 3ZZ4A 2VGCC 4X1SU 1W0YH 2A45B 1DICA 4TYDA 3BTKE 3F1SB 1Z1IA 3KL6A 4BTIB 2A7HA 3TLOA 1T4VH 3A84A 1OWHA 3GYLB 3QGNB 2A4RA 4TWWA 2QF0A 1GI7B 1SLVB 4DJZB 1O5DH 3GCTF 4X2VA 2VVVA 2FYRA 2JETB 5HGGA 1L0ZA 2HNTE 3HGPA 1OP8A 4K1EA 1P2QA 3MWIU 1GBDA 1O5BB 4K8BA 1Z6EA 2BQWB 1C5SA 4DT7B 1Q31A 2NU3E 1RS0A 1C2MA 2NWNA 4K3JA 3QUMP 2ANYA 1O38A 1AHTH 2V0BA 1O2OA 5EW2H 3SHAH 2HPPH 1QGFA 1AKSA 2Y7ZA 1DDJA 1UTKA 3AASA 2ZTXA 3PTBA 2ZCKP 2DUCA 3TNSA 3P6ZB 3TH3H 4LZ1H 3FP7E 5JB8S 2GMTB 2PSYA 1FIZA 1DITH 2FODA 9ESTA 3KGPA 1VITH 2SGDE 2GMTC 2GT8A 3A85A 5EXMA 3RXAA 1D6RA 3LGIA 4Y0ZE 2SNVA 1TABE 4AB8A 4H4FA 1UTJA 1VCPA 1NRRH 1BJUA 1TMTH 4B74A 2FIRH 3KQBA 4TPIZ 3ZVBA 5A0AE 2VIQA 3PLBA 3GISB 3ZZ5A 2EC9H 5LGOA 2ZGJA 1QL7A 1O3OA 1QJ6B 1K1IA 4UE7H 4NWLA 2XC0A 3M35A 2A2XH 1GJDB 2OQ5A 3DHKH 1MKXH 2IOTA 1C1PA 3LJOA 4X6PA 3LGWA 4ZH8A 4FUFA 3V13A 5JBAS 2EA3A 3HK3B 4JZEH 1IQNA 4Q80A 1HAVB 2FEQH 2A4QA 1HAZB 1AD8H 5HXFA 4JK5A 4Q7YA 1XKAC 1TX6A 3STIA 2PGQB 1OSSA 1O3AA 1SVPA 3EA8A 1T8NA 1WQVH 2FPZA 1P02A 4H6TA 1AE8H 4R8TB 2AGIX 5C1UA 2CGAA 2VVUA 1P0SH 1EX3A 3M61U 5CE1A 5AVDA 1ZZZA 5CHAB 5DP3A 5K0HA 3I78A 1AZ8A 1YPEH 2ZDVH 3EGKH 1YPHC 4INHA 4WH8A 3RXJA 4F49A 4Z0KA 2P93A 1OYTH 1TLDA 1O0DH 1TYNA 5SGAE 3RC4A 1KLTA 4FU7A 1IQGA 1WSSH 1QB6A 3OU0A 1V2MT 1HXFH 2QXGA 3TH4H 2QGRA 1SLWB 3SJIA 3HATH 3RXSA 1F5RA 3HPTB 1S6HA 1OKXA 1V2ST 1MZDA 1FAXA 2G81E 1C1QA 2AMQA 5TCCA 3C27B 3LOXA 1W10U 3RU4E 2ZECA 3GY4A 2GCHF 3A88A 3PO1B 2UUFB 4B1TA 1P3CA 1SBWA 2GV7A 4MNVA 1A1RA 1C2GA 2VWMA 2F91A 5C1YA 1MAXA 4IMZA 3NXPA 4BAKB 5DJ7A 1AGJA 1EAUA 1G3EA 3OY5U 2Y80A 1JOUB 5AF9H 1DM4B 1GI0A 2ZCLP 3MU0A 1MTNC 5C67A 1ELCA 2KAIB 1GVZA 3ODFA 1SHYA 4BXWA 1BBRK 2FOHA 2BZAA 3TNTA 1DSUA 4THNH 3U8TH 1LPKB 5ESTE 1VITG 5DPAA 4JZ1A 4CREA 1DUEA 1K1OA 1DY8A 2FI5E 2ZGHA 3UUZA 2G5VA 1UMAH 3S0NA 3M7TA