3FZFB

Crystal structure of hsc70/bag1 in complex with atp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 45
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzfB00
5AQSB 3FZKB 5AQRB 4HWDA 3A8YC 3FZLB 1M7KA 3FZFB 3M3ZB 5AQKB 5AQVB 1I6ZA 1T7SA 5AQGB 1HX1B 5AQMB 4HWFA 1M62A 3LDQB 3FZHB 4HWHA 4HWIB 5AQTB 5AQJB 5AQFB 5AQPB 5AQHB 5AQQB 3FZMB 2D9DA 1UGOA 5AQLB 1UK5A 5AQOB 5AQNB 5AQIB 5AQUB 4HWCA
chains in the Genus database with same CATH superfamily
1T72A 2A2FX 3N5LA 2V6YA 3O1IA 4HWDA 3ZT7A 2AE9A 3L8RA 2LSGA 3QK6A 4G2AA 3RYCE 1HR0T 4CQIA 3AA0B 3RYFE 4ISTA 4PNIA 4HFVA 4TNVA 3FBZA 4WNKA 4LF7T 4U72A 2W66A 4L9IA 5KDMC 2ZMAA 1W09A 3CQCB 2YDQA 4X1IE 3RYHE 5J2UE 5L47A 4JI3T 2VWAA 3PUXF 1V9DA 1VCSA 2OV9A 3QB5A 4O2BE 4NXNT 2WSSV 5JRCA 3VKHA 5LCYA 1H7CA 2K5BB 3ZLIA 1HNXT 1MNDA 3UU5A 2VL0A 2UXNB 1AJ3A 3PUAA 2ACXA 3HKBE 2BKPA 3RX6A 3NWIA 4L0RA 3VR9A 5KX5E 1EZ3A 1MNEA 2EHOB 2Q9QC 4HKAA 4ZZCA 4I50E 2DWGA 5AQLB 5FXWA 4DV1T 3EAMA 2MYSA 3JC6C 4TNWA 1LRZA 2M67A 4U2ZA 5AQIB 3ZKRA 5KXJA 2KT9A 3VHLA 2HHHT 4LF6T 3AXJA 3LK42 4IL9A 2UUAT 5CGMA 2I6HA 3MA9A 2BS2A 2K9AA 5F3JA 2V7JA 2XQ8A 4CN4A 2PFVA 3AE6A 5AQVB 2C5JA 5HEOA 4OYKA 3QC9A 4CZZB 3Q5DA 5F5WA 1B7TA 3V5UA 2WZHA 4P0AA 4LF5T 2CBJA 4DMVA 4ADZA 3CKDA 2Q9QA 4CI2B 5JH7E 3P4WA 4JI8T 3N9NA 2VQET 3UUMA 4ZI7E 4OK0A 1XZYA 3PUGA 5JDHA 5L3FB 1UURA 2BS3A 3B5MA 3EABA 2E2AA 2V6YB 5F8PA 5L4EA 5H6RB 3K8PC 3RC3A 5J1GA 3WAJA 2L8KA 2WY2A 4DUYT 5LBMA 5AQQB 1BR2A 1VRBA 1YQ4A 3AE4A 3HA4A 3E08A 5JDLA 3GMIA 1KNZA 3DJBA 3Q5WA 4O8SA 3BK9A 2K48A 3C4XA 3IEEA 4HE8A 5AQSB 2HPLA 3ZT5A 4DR2T 4DR1T 2L9QA 2ACZA 1IBMT 4O4IE 3A8YC 4G63A 3ZPOA 2JMHA 2BS4A 4P0BA 3P4PA 2DL1A 4MBQA 4KHZF 3PUSA 5FXVA 2UXDT 5LG3A 2UXCT 2ES0A 2MPKA 2QRXA 5IUXA 4U31A 2CLYB 2KZ7B 2LRKA 3AEGA 4GK0E 4H9QC 5EK2A 5AQMB 5JDFA 1HCIA 3RQUA 2W67A 4X1YE 1Z0PA 3RYIE 4C91A 4HWFA 2A9UA 2CBIA 1D1AA 1J5ET 2J47A 3TLWA 3F2EA 2QGSA 2D0UA 3PV0F 4GKJT 1NWMX 2IMLA 3NVOA 3T1YT 3AE1A 4DBQA 4JV5T 1G73A 1IBKT 3HKCE 3I0OA 4QH5A 4KMCA 4OX9T 3P4SA 1XDPA 4CXWA 3Q5XA 2V26A 4JI0T 4QX7B 2MOZA 1GQEA 5FXZA 3E22E 3P4QA 4TX5A 5GONE 1XMQT 2UUCT 2CWYA 3FZKB 3MACA 5EK4A 5LHGB 4JI4T 2JPFA 5LNKA 2GK9A 2JQKA 4PJNA 4U2YA 2CCQA 2J1DG 4DR6T 4PK5A 2H7OA 1VCTA 2XM2A 4GIWA 3I0QA 4ZI2D 2SPCA 3PJAJ 4H9RC 5IWAT 3ZC0A 1M62A 4N78D 4YLHA 2VVNA 5JDQA 1WYBA 1IZNB 5JVDE 3OTOT 2X9XA 4JYAT 2D0TA 3FB2A 3PUWF 5C2TA 3KVAA 4BJNA 4KBMB 4GK5E 4IHJE 3VRAA 1HF8A 2VQFT 1X9BA 4XZCA 2ODVA 2FUPA 5ETWA 4GOUA 1MIYA 3M65A 4QXBB 2CRBA 3UU4A 4X62T 4DV7T 2NTYA 4AKGA 2N1GA 4U7YA 3C51A 5HAXA 4TZ4C 3KFWX 4UIGA 4ERRA 1KNRA 3C50A 3SFEA 4EZ4A 4AKIA 4DR3T 2PTFA 3UU8A 2XQ7A 1CHUA 4ZS3A 2WMNA 4OHFA 2MTQA 5C8YE 1SHZC 5AQGB 5ABFB 1J5WA 4MALA 2NOXA 3FXEB 5FYMA 3TKLB 5FVLA 2CM0A 3NBXX 5HCJA 3CPZA 2XPKA 1YKEB 3DTOA 2XAJB 3C98B 1XWMA 3N2GE 1NAFA 2CXDA 4HFBA 4UV9B 3ONLC 2JIWA 2RP4A 5AQJB 2CEAA 1YQ3A 3JCFA 1E1HB 3AEDA 3OJAA 3O1HA 2LE8A 4E7ZA 5JTGA 4I4TE 2OA5A 1XDOA 3ETUA 3ZMUB 4A5XA 4LFBT 5HEHA 4B3MT 4LF9T 2X0HA 3RLFF 2CA5A 4CN1A 3K3QC 4U3CA 2X0YA 3UUXB 2AXDS 4DVDA 3FZLB 3I9YA 2ZM0A 2JQHA 2YINA 4EZHA 5L2LA 3MK7C 3PDYA 4P1NA 2P9BA 4ZS2A 3T1HT 1IBLT 1KFYA 2BBHA 4EEDA 3RKOA 5E0OA 2VB6A 4IIJE 4DUZT 3L39A 5LGNB 3AEFA 3ZYKA 5FMNA 4NUVA 4LF8T 3N9PA 1E2AA 4ZOLE 1OWAA 3ZJ1A 4X64T 4HWHA 4EGWA 4YY3T 4XBFB 2JQQA 2F4VT 5JDGA 3ZMSB 3RGLA 2XAHB 2NW7A 3JAFA 1Y01A 2KWIB 3EI0A 5DQVA 4QHOA 2IHR1 5AQHB 3SOLA 3PUVF 4X1KE 2D9DA 2WCAA 3B13A 2E9XD 3Q9DA 4UXNB 4QX8B 3EVYA 3KV9A 1KEYA 1U4QA 5LBQB 4YT0A 4WW0A 2XQ6A 5ABEA 4YTPA 4B3ST 3O9XA 2V7LA 2C5IT 3QOFA 5EK3A 3D0TA 3KINB 3DP7A 4YXDA 1T7SA 1ZHCA 2YOEA 4UV8B 2BG9A 1W0AA 4DO0A 4CI1B 1E7PA 3AVRA 3OYXA 1HS7A 3A5XA 2VK9A 2G0UA 4CXXA 5HYAA 1Y64B 2V1DB 2YU1A 4HGAA 5L3CB 2E5LT 1XNRT 4HWIB 3TLSA 1N34T 4CI3B 2EHOC 3TLTA 3ZJ2A 2XSAA 5LA6E 3O4XE 5HXEA 5JR9A 2WWUA 3MJXA 5LJNA 3P7IA 2UXBT 3EHZA 4EV6A 5DQWA 3JADA 1HNZT 3H3MA 5DABA 4ZI3C 3RRCA 3AAEB 3HL6A 2KSRA 2XSBA 5AQNB 5LGTB 4X66T 1D0ZA 2BG9C 1UCUA 2C0SA 1WR0A 2VURA 1HTJF 2WDVA 3EDUA 4HEAA 4HWCA 3VU7H 5LG4A 5AQRB 3ZYMA 2XY8B 4EOZB 2NWBA 4QXCB 2Y6XA 3ONXA 5LYJE 5L3GB 2EHOA 3FHNA 2HH7A 4EYYR 4X5TA 5KMGP 4EXTA 3P8CD 2A72A 1BR4A 2LM9A 3GA8A 4KI0F 1US7B 2VASA 2NR4A 2LOPA 3LDQB 2V6XA 3QB5K 2E9XB 4DV2T 4ZI2C 1OEDE 1MMNA 4QWNB 2KNDA 5HEUA 2WBLA 5AQTB 1N32T 2KMFA 2X51A 3KVBA 3AEAA 3AAAB 5TAOA 4DMWA 4YTNA 3NZQA 2XQ5A 2XQ4A 5LHHB 1I94T 5LP6E 1IJ5A 3N2OA 5LMUT 3PE0A 4YHJA 4Z91A 3UQ7A 3VRBA 2Z6EA 3ZEFB 4CN6A 4JLEA 1UK5A 1SUMB 2K3WA 2LSJA 2D2SA 2BG9B 2CMRA 2HPJA 4DR5T 3GN5A 4JUYA 2IDOB 2J62A 3MZKB 4ANJA 2KLQA 4X20E 5L4HA 3PJAA 5L3BB 2CLYC 4YSZA 4LFAT 3BQKA 3NZPA 4IL4A 2XAGB 2W00A 3Q2MA 3UUBA 2D5UA 3AA6B 3L3PA 1D0XA 3ZCIA 3OKQA 1UX4A 3GWHA 3PURA 3R6NA 3SRZA 4JEHB 2E9XA 5HXSA 4ILCA 2LKGA 3MKDA 4QH4A 4WZXA 3KDSE 1HX1B 2V5DA 3RKGA 4A97A 5C3JA 2EHOD 4YFSA 2X9HA 2V7MA 4YHHT 3AE3A 4FI5A 4B3RT 4HFHA 3OYZA 3A7MA 1IJ6A 2XAQB 4K0UA 3RI5A 3WI3A 4EYUA 5ABHA 3BQLA 3KV4A 3U78A 2H89A 2X9WA 2WP9A 4DV4T 3AE9A 3OVUA 2V5CA 1WLXA 4AQFA 2LKHA 3AE7A 3FZMB 2YK0A 3IF8B 4J2CA 3K3NA 4IE7A 2JMKA 2UXXB 2XJ7A 4TN7B 2E9XC 5CA1E 4AI6A 1HNWT 5IYZE 1NENA 2W62A 2LJLA 2KINB 3C4WA 5CJ5A 2L3LA 4I43B 3F57A 3LSVA 2W0GA 4F8HA 2RA1A 2XQ9A 4IT4A 4YJ2E 4JBWF 3RRWA 5FL0A 3NKZA 2MAWA 5L3DB 1OEDB 2CPTA 2LLYA 3I1AA 5CB4E 2K24A 4AQFC 1O3XA 4F6RC 2M6IA 5HEJA 2FJEA 5JR9C 3QNUA 2KXPB 4TUYE 4C90A 3ZMZB 4UEMA 3TLVA 1ZEEA 3EDVA 1MIVA 3O1JA 2IIUA 3PUZF 4GYSA 4HN9A 3RIFA 2XQYA 4AQGA 4KP3C 1R8IA 3IA3A 2LRLA 2VKJA 4X65T 4PAGA 4B3TT 2XQ3A 3AECA 4H63H 1FMWA 3I9WA 3ZCJA 1FMVA 4ZI3D 4LFCT 3R84B 2BZBA 4U74A 3SS1A 1S35A 4QKNA 4TV8E 5FVKA 4DBRA 2FJDA 3ESLA 3OPCA 1D0YA 4EB6E 4DV5T 2KWHA 3N9LA 5JRCB 4Z8XA 5JDNA 3LBXB 1MMAA 4HFDA 1X79A 2IC9A 2N2NA 5J2TE 2CXLA 2NTXA 2XUEA 5LOVE 4WBNE 2CHOA 4UVCB 4PFOA 4NXMT 3AEBA 3FZHB 4JI7T 4LMLA 3UU3A 4JEUB 5IHYA 3ZC1A 4AKLA 3G06A 2YN6A 3MXZA 3ANWB 3N2KE 1QUUA 3AXJB 4UR9A 4IREA 5FY0A 3ZN1B 4JI2T 5FKYA 2WWVA 4IDQA 2FJBA 3H37A 4M1PA 3KV5A 4QXHB 2DHRA 3PUQA 4IDZA 1FJGT 2WU5A 2WDQA 3QUJA 2LOSA 3FXDB 5LGUB 3RC8A 3F31A 3RIUC 3NRXA 4L5GA 4ILAA 4IDPA 2Q9QB 2IAKA 3LBXA 3PUYF 2HN2A 2WZIA 5FL1A 2WS3A 4WYVA 4DNDA 2IC6A 1BR1A 2LHNA 2FJAA 3TLUA 3ZSSA 4K0KT 4YSYA 4DV6T 1I6ZA 2BKNA 2E5VA 3RHWA 5BR8T 3ZSTA 4IDOA 1SA0E 2PJQA 3EUHA 1HX8A 3PU3A 4ILBA 4XAXB 3V5SA 1FIOA 3AA1B 4I55E 4NPPA 4BJMA 5CA0E 5ADXL 1XNQT 1IAPA 1ZP0A 2BVLA 1OEDC 3H3AA 4V1Av 5AFUL 2B76A 2YEVC 4LMKA 4BAYB 2W2UA 1ZV4X 3JAEA 3J9X1 5L3EB 2WB5A 2YU2A 2Y48B 3L09A 4UVAB 2ZM6T 5HWYA 4NUUA 2DLRA 3UU6A 1U5PA 3BQIA 3ZYLA 3ZN0B 2OLTA 2X68A 3HR0A 4AQYT 4GKKT 1YD8G 1FEWA 2XQAA 4PK4A 1OXZA 5AQUB 4YTMA 1CUNA 1MIWA 3RF1A 2LSIA 2E8IA 5ABGA 3OBVE 2BG9E 3W15B 2VKOA 4OFZA 4PJJA 4EAHA 5J0ZA 5H6QB 3ANWA 1YW0A 3M3ZB 1HG5A 2JJ9A 3RIAA 4KHPT 1Z8UA 4DV3T 4O4LE 4U7IA 4H63V 4ZXLA 1LVFA 2ZM8A 2VVSA 2LT3A 5EZYE 3RH3A 3RPUA 3ZT6A 4PJMA 2QYWA 4YSXA 2YKSA 2I0MA 4O4HE 4B6XA 5JDMA 1D1CA 2M6BA 1KNPA 3CMLA 1UUSA 5HWXA 4O2AE 4KUMB 3SFDA 4H9SE 4EEBA 3ETVA 2Q9QD 3K1SA 5A1LA 3PTRB 5AQPB 5AQFB 1L0VA 3KV6A 1W0BA 5LXTE 3FBLA 2NW9A 2V8SV 2QA7A 2YDRA 3LG7A 2DCFA 2CXFA 2BKOA 4JI5T 2W4XA 3HKDE 5M4YA 3CK6A 4PK6A 3ZMTB 1T98A 4O4JE 2H3RA 4TV9E 4TWFA 2C5KT 5FY1A 2YDSA 2ZLYA 3CX7B 1JNZA 2V7IA 4P09A 4FJOA 2VKHA 4UELA 5ABFA 5AQKB 5FP3A 2PBIA 1QSDA 1MMGA 4UVBB 3N9OA 1ZOYA 2LEHA 4Z90A 5LMNT 5HXHA 2UUBT 3AAIA 2XM1A 2I59A 2XASB 2W61A 3IHRA 2X9YA 1NEKA 4HTEA 4IE6A 2IUBA 1XMOT 4ZZBA 4H9OC 2X66A 3CX8B 4YJ3E 3SWHA 2QVAA 1HG2A 4NIQA 3N9MA 4UF0A 4GYRA 4TWDA 3UFEA 4AIUA 5JREA 4AXPA 2Y8DA 3C64A 2VL8A 2LHRA 4HFCA 2DI4A 1WRDA 4IE5A 2WM9A 1KF6A 3HI2A 3AE8A 2IW5B 1T8BA 1D1BA 3AEEA 5JQGE 3Q5EA 1UX5A 2WQYA 2X67A 2R6GF 5AQOB 3UFGA 1WR6A 2NP9A 4LMJA 4OYJA 2DWKA 3AE5A 4ISSA 3E0ZA 4PJLA 4DV0T 4AKRB 4MHCA 4COFA 1BR0A 1YKHB 3RQWA 2XHEB 4QH1A 2UU9T 2BVMA 2NW8A 5FY7A 2N9DA 2VKDA 1HFAA 2W63A 5FXXA 1M7KA 4H9NC 4ZEYA 2RPAA 5BMVE 4U33A 5DJQC 4BA9A 2DNXA 3WAKA 3B57A 4EIWA 3KBUA 1DU2A 2ZM2A 4AKHA 4AISA 4ASKA 1W9RA 2CHNA 2LSYA 3C4ZA 1WFDA 3GN5B 3AA7B 1G8XA 3CQGB 1LVKA 4I0UA 3UT5E 4LF4T 3CQXC 4CXYA 4PFPA 2V7KA 3ABVA 4MLKA 2H88A 5LB7B 1ZKEA 2B1EA 3HKEE 4IGUA 4TWHA 2LM2A 2WDRA 4ILUA 2J4GA 4ZHQE 3ONJA 1WYCA 3LK2B 3VR8A 4PW8A 1UGOA 1VOMA 2XAFB 4HFIA 4IE0A 2WMOA 5HXCA 3UTKA 4DIDB 2JRKA 5LJMA 3VKGA 3PU8A 5HXRA 3U3IA 1N33T 1SE7A 3AE2A 3S4UA 1QLBA 2BBJA 4IDNA 4WBOA 1S94A 1N36T 2HN1A 3JC6D 2A3DA 3NRYA 2X0LB 3T8OA 3FZFB 3LJCA 4UF0B 5CFBA 4HFEA 3RIUA 3N9QA 2WAUA 2JQ9A 3CX6B 4JI1T 3UQ4A 1MMDA 4H9PC 4E7SA 3KBTA 3P50A 3AVSA 2BDEA 2H7VC 3X1DA 5FNVE 4IE4A 4DR4T 3AB3B 4KX6A 4DR7T 5JR9B 2CWOA 3UUNA 1YXRA 1KK7A 1JNRA 4JI6T 3CWZB 4A56A 2FBWA 2CE7A 4A98A 3K3OA 3CIRA 3UULA 2ODUA 2XZEA 1J1JA 3CVRA 1WCRA 2XTLA 4Q25A 3LK3B 1OEDA 5HEGA 5HCMA 2LSKA 3ZMVB 5LHIB 1LKXA 3J7Yq 3P4RA 3IBPA 2PG8A 4MFRA 3LFMA 2MBGA 2WU2A
chains in the Genus database with same CATH topology
5AQSB 3FZKB 5AQRB 4HWDA 3A8YC 3FZLB 1M7KA 3FZFB 3M3ZB 5AQKB 5AQVB 1I6ZA 1T7SA 5AQGB 1HX1B 5AQMB 4HWFA 1M62A 3LDQB 3FZHB 4HWHA 4HWIB 5AQTB 5AQJB 5AQFB 5AQPB 5AQHB 5AQQB 3FZMB 2D9DA 1UGOA 5AQLB 1UK5A 5AQOB 5AQNB 5AQIB 5AQUB 4HWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQS B;  3FZK B;  5AQR B;  4HWD A;  3A8Y C;  3FZL B;  1M7K A;  3FZF B;  3M3Z B;  5AQK B;  5AQV B;  1I6Z A;  1T7S A;  5AQG B;  1HX1 B;  5AQM B;  4HWF A;  1M62 A;  3LDQ B;  3FZH B;  4HWH A;  4HWI B;  5AQT B;  5AQJ B;  5AQF B;  5AQP B;  5AQH B;  5AQQ B;  3FZM B;  2D9D A;  1UGO A;  5AQL B;  1UK5 A;  5AQO B;  5AQN B;  5AQI B;  5AQU B;  4HWC A; 
#chains in the Genus database with same CATH topology
 1T72 A;  2A2F X;  3N5L A;  2V6Y A;  3O1I A;  4HWD A;  3ZT7 A;  2AE9 A;  3L8R A;  2LSG A;  3QK6 A;  4G2A A;  3RYC E;  1HR0 T;  4CQI A;  3AA0 B;  3RYF E;  4IST A;  4PNI A;  4HFV A;  4TNV A;  3FBZ A;  4WNK A;  4LF7 T;  4U72 A;  2W66 A;  4L9I A;  5KDM C;  2ZMA A;  1W09 A;  3CQC B;  2YDQ A;  4X1I E;  3RYH E;  5J2U E;  5L47 A;  4JI3 T;  2VWA A;  3PUX F;  1V9D A;  1VCS A;  2OV9 A;  3QB5 A;  4O2B E;  4NXN T;  2WSS V;  5JRC A;  3VKH A;  5LCY A;  1H7C A;  2K5B B;  3ZLI A;  1HNX T;  1MND A;  3UU5 A;  2VL0 A;  2UXN B;  1AJ3 A;  3PUA A;  2ACX A;  3HKB E;  2BKP A;  3RX6 A;  3NWI A;  4L0R A;  3VR9 A;  5KX5 E;  1EZ3 A;  1MNE A;  2EHO B;  2Q9Q C;  4HKA A;  4ZZC A;  4I50 E;  2DWG A;  5AQL B;  5FXW A;  4DV1 T;  3EAM A;  2MYS A;  3JC6 C;  4TNW A;  1LRZ A;  2M67 A;  4U2Z A;  5AQI B;  3ZKR A;  5KXJ A;  2KT9 A;  3VHL A;  2HHH T;  4LF6 T;  3AXJ A;  3LK4 2;  4IL9 A;  2UUA T;  5CGM A;  2I6H A;  3MA9 A;  2BS2 A;  2K9A A;  5F3J A;  2V7J A;  2XQ8 A;  4CN4 A;  2PFV A;  3AE6 A;  5AQV B;  2C5J A;  5HEO A;  4OYK A;  3QC9 A;  4CZZ B;  3Q5D A;  5F5W A;  1B7T A;  3V5U A;  2WZH A;  4P0A A;  4LF5 T;  2CBJ A;  4DMV A;  4ADZ A;  3CKD A;  2Q9Q A;  4CI2 B;  5JH7 E;  3P4W A;  4JI8 T;  3N9N A;  2VQE T;  3UUM A;  4ZI7 E;  4OK0 A;  1XZY A;  3PUG A;  5JDH A;  5L3F B;  1UUR A;  2BS3 A;  3B5M A;  3EAB A;  2E2A A;  2V6Y B;  5F8P A;  5L4E A;  5H6R B;  3K8P C;  3RC3 A;  5J1G A;  3WAJ A;  2L8K A;  2WY2 A;  4DUY T;  5LBM A;  5AQQ B;  1BR2 A;  1VRB A;  1YQ4 A;  3AE4 A;  3HA4 A;  3E08 A;  5JDL A;  3GMI A;  1KNZ A;  3DJB A;  3Q5W A;  4O8S A;  3BK9 A;  2K48 A;  3C4X A;  3IEE A;  4HE8 A;  5AQS B;  2HPL A;  3ZT5 A;  4DR2 T;  4DR1 T;  2L9Q A;  2ACZ A;  1IBM T;  4O4I E;  3A8Y C;  4G63 A;  3ZPO A;  2JMH A;  2BS4 A;  4P0B A;  3P4P A;  2DL1 A;  4MBQ A;  4KHZ F;  3PUS A;  5FXV A;  2UXD T;  5LG3 A;  2UXC T;  2ES0 A;  2MPK A;  2QRX A;  5IUX A;  4U31 A;  2CLY B;  2KZ7 B;  2LRK A;  3AEG A;  4GK0 E;  4H9Q C;  5EK2 A;  5AQM B;  5JDF A;  1HCI A;  3RQU A;  2W67 A;  4X1Y E;  1Z0P A;  3RYI E;  4C91 A;  4HWF A;  2A9U A;  2CBI A;  1D1A A;  1J5E T;  2J47 A;  3TLW A;  3F2E A;  2QGS A;  2D0U A;  3PV0 F;  4GKJ T;  1NWM X;  2IML A;  3NVO A;  3T1Y T;  3AE1 A;  4DBQ A;  4JV5 T;  1G73 A;  1IBK T;  3HKC E;  3I0O A;  4QH5 A;  4KMC A;  4OX9 T;  3P4S A;  1XDP A;  4CXW A;  3Q5X A;  2V26 A;  4JI0 T;  4QX7 B;  2MOZ A;  1GQE A;  5FXZ A;  3E22 E;  3P4Q A;  4TX5 A;  5GON E;  1XMQ T;  2UUC T;  2CWY A;  3FZK B;  3MAC A;  5EK4 A;  5LHG B;  4JI4 T;  2JPF A;  5LNK A;  2GK9 A;  2JQK A;  4PJN A;  4U2Y A;  2CCQ A;  2J1D G;  4DR6 T;  4PK5 A;  2H7O A;  1VCT A;  2XM2 A;  4GIW A;  3I0Q A;  4ZI2 D;  2SPC A;  3PJA J;  4H9R C;  5IWA T;  3ZC0 A;  1M62 A;  4N78 D;  4YLH A;  2VVN A;  5JDQ A;  1WYB A;  1IZN B;  5JVD E;  3OTO T;  2X9X A;  4JYA T;  2D0T A;  3FB2 A;  3PUW F;  5C2T A;  3KVA A;  4BJN A;  4KBM B;  4GK5 E;  4IHJ E;  3VRA A;  1HF8 A;  2VQF T;  1X9B A;  4XZC A;  2ODV A;  2FUP A;  5ETW A;  4GOU A;  1MIY A;  3M65 A;  4QXB B;  2CRB A;  3UU4 A;  4X62 T;  4DV7 T;  2NTY A;  4AKG A;  2N1G A;  4U7Y A;  3C51 A;  5HAX A;  4TZ4 C;  3KFW X;  4UIG A;  4ERR A;  1KNR A;  3C50 A;  3SFE A;  4EZ4 A;  4AKI A;  4DR3 T;  2PTF A;  3UU8 A;  2XQ7 A;  1CHU A;  4ZS3 A;  2WMN A;  4OHF A;  2MTQ A;  5C8Y E;  1SHZ C;  5AQG B;  5ABF B;  1J5W A;  4MAL A;  2NOX A;  3FXE B;  5FYM A;  3TKL B;  5FVL A;  2CM0 A;  3NBX X;  5HCJ A;  3CPZ A;  2XPK A;  1YKE B;  3DTO A;  2XAJ B;  3C98 B;  1XWM A;  3N2G E;  1NAF A;  2CXD A;  4HFB A;  4UV9 B;  3ONL C;  2JIW A;  2RP4 A;  5AQJ B;  2CEA A;  1YQ3 A;  3JCF A;  1E1H B;  3AED A;  3OJA A;  3O1H A;  2LE8 A;  4E7Z A;  5JTG A;  4I4T E;  2OA5 A;  1XDO A;  3ETU A;  3ZMU B;  4A5X A;  4LFB T;  5HEH A;  4B3M T;  4LF9 T;  2X0H A;  3RLF F;  2CA5 A;  4CN1 A;  3K3Q C;  4U3C A;  2X0Y A;  3UUX B;  2AXD S;  4DVD A;  3FZL B;  3I9Y A;  2ZM0 A;  2JQH A;  2YIN A;  4EZH A;  5L2L A;  3MK7 C;  3PDY A;  4P1N A;  2P9B A;  4ZS2 A;  3T1H T;  1IBL T;  1KFY A;  2BBH A;  4EED A;  3RKO A;  5E0O A;  2VB6 A;  4IIJ E;  4DUZ T;  3L39 A;  5LGN B;  3AEF A;  3ZYK A;  5FMN A;  4NUV A;  4LF8 T;  3N9P A;  1E2A A;  4ZOL E;  1OWA A;  3ZJ1 A;  4X64 T;  4HWH A;  4EGW A;  4YY3 T;  4XBF B;  2JQQ A;  2F4V T;  5JDG A;  3ZMS B;  3RGL A;  2XAH B;  2NW7 A;  3JAF A;  1Y01 A;  2KWI B;  3EI0 A;  5DQV A;  4QHO A;  2IHR 1;  5AQH B;  3SOL A;  3PUV F;  4X1K E;  2D9D A;  2WCA A;  3B13 A;  2E9X D;  3Q9D A;  4UXN B;  4QX8 B;  3EVY A;  3KV9 A;  1KEY A;  1U4Q A;  5LBQ B;  4YT0 A;  4WW0 A;  2XQ6 A;  5ABE A;  4YTP A;  4B3S T;  3O9X A;  2V7L A;  2C5I T;  3QOF A;  5EK3 A;  3D0T A;  3KIN B;  3DP7 A;  4YXD A;  1T7S A;  1ZHC A;  2YOE A;  4UV8 B;  2BG9 A;  1W0A A;  4DO0 A;  4CI1 B;  1E7P A;  3AVR A;  3OYX A;  1HS7 A;  3A5X A;  2VK9 A;  2G0U A;  4CXX A;  5HYA A;  1Y64 B;  2V1D B;  2YU1 A;  4HGA A;  5L3C B;  2E5L T;  1XNR T;  4HWI B;  3TLS A;  1N34 T;  4CI3 B;  2EHO C;  3TLT A;  3ZJ2 A;  2XSA A;  5LA6 E;  3O4X E;  5HXE A;  5JR9 A;  2WWU A;  3MJX A;  5LJN A;  3P7I A;  2UXB T;  3EHZ A;  4EV6 A;  5DQW A;  3JAD A;  1HNZ T;  3H3M A;  5DAB A;  4ZI3 C;  3RRC A;  3AAE B;  3HL6 A;  2KSR A;  2XSB A;  5AQN B;  5LGT B;  4X66 T;  1D0Z A;  2BG9 C;  1UCU A;  2C0S A;  1WR0 A;  2VUR A;  1HTJ F;  2WDV A;  3EDU A;  4HEA A;  4HWC A;  3VU7 H;  5LG4 A;  5AQR B;  3ZYM A;  2XY8 B;  4EOZ B;  2NWB A;  4QXC B;  2Y6X A;  3ONX A;  5LYJ E;  5L3G B;  2EHO A;  3FHN A;  2HH7 A;  4EYY R;  4X5T A;  5KMG P;  4EXT A;  3P8C D;  2A72 A;  1BR4 A;  2LM9 A;  3GA8 A;  4KI0 F;  1US7 B;  2VAS A;  2NR4 A;  2LOP A;  3LDQ B;  2V6X A;  3QB5 K;  2E9X B;  4DV2 T;  4ZI2 C;  1OED E;  1MMN A;  4QWN B;  2KND A;  5HEU A;  2WBL A;  5AQT B;  1N32 T;  2KMF A;  2X51 A;  3KVB A;  3AEA A;  3AAA B;  5TAO A;  4DMW A;  4YTN A;  3NZQ A;  2XQ5 A;  2XQ4 A;  5LHH B;  1I94 T;  5LP6 E;  1IJ5 A;  3N2O A;  5LMU T;  3PE0 A;  4YHJ A;  4Z91 A;  3UQ7 A;  3VRB A;  2Z6E A;  3ZEF B;  4CN6 A;  4JLE A;  1UK5 A;  1SUM B;  2K3W A;  2LSJ A;  2D2S A;  2BG9 B;  2CMR A;  2HPJ A;  4DR5 T;  3GN5 A;  4JUY A;  2IDO B;  2J62 A;  3MZK B;  4ANJ A;  2KLQ A;  4X20 E;  5L4H A;  3PJA A;  5L3B B;  2CLY C;  4YSZ A;  4LFA T;  3BQK A;  3NZP A;  4IL4 A;  2XAG B;  2W00 A;  3Q2M A;  3UUB A;  2D5U A;  3AA6 B;  3L3P A;  1D0X A;  3ZCI A;  3OKQ A;  1UX4 A;  3GWH A;  3PUR A;  3R6N A;  3SRZ A;  4JEH B;  2E9X A;  5HXS A;  4ILC A;  2LKG A;  3MKD A;  4QH4 A;  4WZX A;  3KDS E;  1HX1 B;  2V5D A;  3RKG A;  4A97 A;  5C3J A;  2EHO D;  4YFS A;  2X9H A;  2V7M A;  4YHH T;  3AE3 A;  4FI5 A;  4B3R T;  4HFH A;  3OYZ A;  3A7M A;  1IJ6 A;  2XAQ B;  4K0U A;  3RI5 A;  3WI3 A;  4EYU A;  5ABH A;  3BQL A;  3KV4 A;  3U78 A;  2H89 A;  2X9W A;  2WP9 A;  4DV4 T;  3AE9 A;  3OVU A;  2V5C A;  1WLX A;  4AQF A;  2LKH A;  3AE7 A;  3FZM B;  2YK0 A;  3IF8 B;  4J2C A;  3K3N A;  4IE7 A;  2JMK A;  2UXX B;  2XJ7 A;  4TN7 B;  2E9X C;  5CA1 E;  4AI6 A;  1HNW T;  5IYZ E;  1NEN A;  2W62 A;  2LJL A;  2KIN B;  3C4W A;  5CJ5 A;  2L3L A;  4I43 B;  3F57 A;  3LSV A;  2W0G A;  4F8H A;  2RA1 A;  2XQ9 A;  4IT4 A;  4YJ2 E;  4JBW F;  3RRW A;  5FL0 A;  3NKZ A;  2MAW A;  5L3D B;  1OED B;  2CPT A;  2LLY A;  3I1A A;  5CB4 E;  2K24 A;  4AQF C;  1O3X A;  4F6R C;  2M6I A;  5HEJ A;  2FJE A;  5JR9 C;  3QNU A;  2KXP B;  4TUY E;  4C90 A;  3ZMZ B;  4UEM A;  3TLV A;  1ZEE A;  3EDV A;  1MIV A;  3O1J A;  2IIU A;  3PUZ F;  4GYS A;  4HN9 A;  3RIF A;  2XQY A;  4AQG A;  4KP3 C;  1R8I A;  3IA3 A;  2LRL A;  2VKJ A;  4X65 T;  4PAG A;  4B3T T;  2XQ3 A;  3AEC A;  4H63 H;  1FMW A;  3I9W A;  3ZCJ A;  1FMV A;  4ZI3 D;  4LFC T;  3R84 B;  2BZB A;  4U74 A;  3SS1 A;  1S35 A;  4QKN A;  4TV8 E;  5FVK A;  4DBR A;  2FJD A;  3ESL A;  3OPC A;  1D0Y A;  4EB6 E;  4DV5 T;  2KWH A;  3N9L A;  5JRC B;  4Z8X A;  5JDN A;  3LBX B;  1MMA A;  4HFD A;  1X79 A;  2IC9 A;  2N2N A;  5J2T E;  2CXL A;  2NTX A;  2XUE A;  5LOV E;  4WBN E;  2CHO A;  4UVC B;  4PFO A;  4NXM T;  3AEB A;  3FZH B;  4JI7 T;  4LML A;  3UU3 A;  4JEU B;  5IHY A;  3ZC1 A;  4AKL A;  3G06 A;  2YN6 A;  3MXZ A;  3ANW B;  3N2K E;  1QUU A;  3AXJ B;  4UR9 A;  4IRE A;  5FY0 A;  3ZN1 B;  4JI2 T;  5FKY A;  2WWV A;  4IDQ A;  2FJB A;  3H37 A;  4M1P A;  3KV5 A;  4QXH B;  2DHR A;  3PUQ A;  4IDZ A;  1FJG T;  2WU5 A;  2WDQ A;  3QUJ A;  2LOS A;  3FXD B;  5LGU B;  3RC8 A;  3F31 A;  3RIU C;  3NRX A;  4L5G A;  4ILA A;  4IDP A;  2Q9Q B;  2IAK A;  3LBX A;  3PUY F;  2HN2 A;  2WZI A;  5FL1 A;  2WS3 A;  4WYV A;  4DND A;  2IC6 A;  1BR1 A;  2LHN A;  2FJA A;  3TLU A;  3ZSS A;  4K0K T;  4YSY A;  4DV6 T;  1I6Z A;  2BKN A;  2E5V A;  3RHW A;  5BR8 T;  3ZST A;  4IDO A;  1SA0 E;  2PJQ A;  3EUH A;  1HX8 A;  3PU3 A;  4ILB A;  4XAX B;  3V5S A;  1FIO A;  3AA1 B;  4I55 E;  4NPP A;  4BJM A;  5CA0 E;  5ADX L;  1XNQ T;  1IAP A;  1ZP0 A;  2BVL A;  1OED C;  3H3A A;  4V1A v;  5AFU L;  2B76 A;  2YEV C;  4LMK A;  4BAY B;  2W2U A;  1ZV4 X;  3JAE A;  3J9X 1;  5L3E B;  2WB5 A;  2YU2 A;  2Y48 B;  3L09 A;  4UVA B;  2ZM6 T;  5HWY A;  4NUU A;  2DLR A;  3UU6 A;  1U5P A;  3BQI A;  3ZYL A;  3ZN0 B;  2OLT A;  2X68 A;  3HR0 A;  4AQY T;  4GKK T;  1YD8 G;  1FEW A;  2XQA A;  4PK4 A;  1OXZ A;  5AQU B;  4YTM A;  1CUN A;  1MIW A;  3RF1 A;  2LSI A;  2E8I A;  5ABG A;  3OBV E;  2BG9 E;  3W15 B;  2VKO A;  4OFZ A;  4PJJ A;  4EAH A;  5J0Z A;  5H6Q B;  3ANW A;  1YW0 A;  3M3Z B;  1HG5 A;  2JJ9 A;  3RIA A;  4KHP T;  1Z8U A;  4DV3 T;  4O4L E;  4U7I A;  4H63 V;  4ZXL A;  1LVF A;  2ZM8 A;  2VVS A;  2LT3 A;  5EZY E;  3RH3 A;  3RPU A;  3ZT6 A;  4PJM A;  2QYW A;  4YSX A;  2YKS A;  2I0M A;  4O4H E;  4B6X A;  5JDM A;  1D1C A;  2M6B A;  1KNP A;  3CML A;  1UUS A;  5HWX A;  4O2A E;  4KUM B;  3SFD A;  4H9S E;  4EEB A;  3ETV A;  2Q9Q D;  3K1S A;  5A1L A;  3PTR B;  5AQP B;  5AQF B;  1L0V A;  3KV6 A;  1W0B A;  5LXT E;  3FBL A;  2NW9 A;  2V8S V;  2QA7 A;  2YDR A;  3LG7 A;  2DCF A;  2CXF A;  2BKO A;  4JI5 T;  2W4X A;  3HKD E;  5M4Y A;  3CK6 A;  4PK6 A;  3ZMT B;  1T98 A;  4O4J E;  2H3R A;  4TV9 E;  4TWF A;  2C5K T;  5FY1 A;  2YDS A;  2ZLY A;  3CX7 B;  1JNZ A;  2V7I A;  4P09 A;  4FJO A;  2VKH A;  4UEL A;  5ABF A;  5AQK B;  5FP3 A;  2PBI A;  1QSD A;  1MMG A;  4UVB B;  3N9O A;  1ZOY A;  2LEH A;  4Z90 A;  5LMN T;  5HXH A;  2UUB T;  3AAI A;  2XM1 A;  2I59 A;  2XAS B;  2W61 A;  3IHR A;  2X9Y A;  1NEK A;  4HTE A;  4IE6 A;  2IUB A;  1XMO T;  4ZZB A;  4H9O C;  2X66 A;  3CX8 B;  4YJ3 E;  3SWH A;  2QVA A;  1HG2 A;  4NIQ A;  3N9M A;  4UF0 A;  4GYR A;  4TWD A;  3UFE A;  4AIU A;  5JRE A;  4AXP A;  2Y8D A;  3C64 A;  2VL8 A;  2LHR A;  4HFC A;  2DI4 A;  1WRD A;  4IE5 A;  2WM9 A;  1KF6 A;  3HI2 A;  3AE8 A;  2IW5 B;  1T8B A;  1D1B A;  3AEE A;  5JQG E;  3Q5E A;  1UX5 A;  2WQY A;  2X67 A;  2R6G F;  5AQO B;  3UFG A;  1WR6 A;  2NP9 A;  4LMJ A;  4OYJ A;  2DWK A;  3AE5 A;  4ISS A;  3E0Z A;  4PJL A;  4DV0 T;  4AKR B;  4MHC A;  4COF A;  1BR0 A;  1YKH B;  3RQW A;  2XHE B;  4QH1 A;  2UU9 T;  2BVM A;  2NW8 A;  5FY7 A;  2N9D A;  2VKD A;  1HFA A;  2W63 A;  5FXX A;  1M7K A;  4H9N C;  4ZEY A;  2RPA A;  5BMV E;  4U33 A;  5DJQ C;  4BA9 A;  2DNX A;  3WAK A;  3B57 A;  4EIW A;  3KBU A;  1DU2 A;  2ZM2 A;  4AKH A;  4AIS A;  4ASK A;  1W9R A;  2CHN A;  2LSY A;  3C4Z A;  1WFD A;  3GN5 B;  3AA7 B;  1G8X A;  3CQG B;  1LVK A;  4I0U A;  3UT5 E;  4LF4 T;  3CQX C;  4CXY A;  4PFP A;  2V7K A;  3ABV A;  4MLK A;  2H88 A;  5LB7 B;  1ZKE A;  2B1E A;  3HKE E;  4IGU A;  4TWH A;  2LM2 A;  2WDR A;  4ILU A;  2J4G A;  4ZHQ E;  3ONJ A;  1WYC A;  3LK2 B;  3VR8 A;  4PW8 A;  1UGO A;  1VOM A;  2XAF B;  4HFI A;  4IE0 A;  2WMO A;  5HXC A;  3UTK A;  4DID B;  2JRK A;  5LJM A;  3VKG A;  3PU8 A;  5HXR A;  3U3I A;  1N33 T;  1SE7 A;  3AE2 A;  3S4U A;  1QLB A;  2BBJ A;  4IDN A;  4WBO A;  1S94 A;  1N36 T;  2HN1 A;  3JC6 D;  2A3D A;  3NRY A;  2X0L B;  3T8O A;  3FZF B;  3LJC A;  4UF0 B;  5CFB A;  4HFE A;  3RIU A;  3N9Q A;  2WAU A;  2JQ9 A;  3CX6 B;  4JI1 T;  3UQ4 A;  1MMD A;  4H9P C;  4E7S A;  3KBT A;  3P50 A;  3AVS A;  2BDE A;  2H7V C;  3X1D A;  5FNV E;  4IE4 A;  4DR4 T;  3AB3 B;  4KX6 A;  4DR7 T;  5JR9 B;  2CWO A;  3UUN A;  1YXR A;  1KK7 A;  1JNR A;  4JI6 T;  3CWZ B;  4A56 A;  2FBW A;  2CE7 A;  4A98 A;  3K3O A;  3CIR A;  3UUL A;  2ODU A;  2XZE A;  1J1J A;  3CVR A;  1WCR A;  2XTL A;  4Q25 A;  3LK3 B;  1OED A;  5HEG A;  5HCM A;  2LSK A;  3ZMV B;  5LHI B;  1LKX A;  3J7Y q;  3P4R A;  3IBP A;  2PG8 A;  4MFR A;  3LFM A;  2MBG A;  2WU2 A; 
#chains in the Genus database with same CATH homology
 5AQS B;  3FZK B;  5AQR B;  4HWD A;  3A8Y C;  3FZL B;  1M7K A;  3FZF B;  3M3Z B;  5AQK B;  5AQV B;  1I6Z A;  1T7S A;  5AQG B;  1HX1 B;  5AQM B;  4HWF A;  1M62 A;  3LDQ B;  3FZH B;  4HWH A;  4HWI B;  5AQT B;  5AQJ B;  5AQF B;  5AQP B;  5AQH B;  5AQQ B;  3FZM B;  2D9D A;  1UGO A;  5AQL B;  1UK5 A;  5AQO B;  5AQN B;  5AQI B;  5AQU B;  4HWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...