3FZGA

Structure of the 16s rrna methylase arma
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
196
Chain Sequence
AYPNWDKLLKKYNQGQLSIEDLLKIHSSTNERVATLNDFYTYVFGNIKHVSSILDFGCGFNPLALYQWNENEKIIYHAYDIDRAEIAFLSSIIGKLKTTIKYRFLNKESDVYKGTYDVVFLLKMLPVLKQQDVNILDFLQLFHTQNFVISFPIKSLSEKGMEENYQLWFESFTKGWIKILDSKVIGNELVYITSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural bases for 16 S rRNA methylation catalyzed by ArmA and RmtB methyltransferases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 16S rRNA methylase
total genus 62
structure length 196
sequence length 198
ec nomenclature
pdb deposition date 2009-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3fzgA00
3BWBA 3P2IA 4E2ZA 4AZTA 1WG8A 5DTRA 2JHPA 3A26A 1R18A 2ZZNA 1F38A 2WA2A 3OZRA 4HSGA 3G2QA 1TPYA 2I62A 4XCXA 3VSEA 4PYJA 5DXJA 1Q0TA 3FPHA 5FHRA 2GLUA 2IPXA 1M0EA 1WY7A 5K09A 2JH8A 2IIPA 5DRYA 1BOOA 2ZIFA 3EGVA 1B42A 3SSOA 4C07A 1M6EX 2ZBPA 2HWKA 5DSTA 3UJAA 3DMFA 4YV0A 4U7TB 5EEHA 2JG3A 5DM4A 3OU2A 1ZGJA 3TRKA 4BLUA 3DUWA 2QY6A 2DPMA 1SUIA 1NW7A 4LG1A 2PX8A 3CKKA 4JXJA 3GWZA 4QTUB 2AOUB 4PONA 4RVGA 3BUSA 5E2AA 5FCDA 1R00A 2AOTA 2K4MA 4RVHA 4H0NA 3UA4A 4BP3A 2C7OA 1JG4A 1YF3A 5EKXA 2UYOA 2Z6QA 3BWYA 4ER0A 4AUKA 5KS2A 4O29A 4RTJA 2PGXA 1D2GA 3JWHA 4RV9A 3G2OA 1JR4A 4P7JA 4C05A 4RWZA 3GDHA 2PVCA 3BKXA 5K0EA 5LQCA 3KQMA 1U2ZA 4QVKA 5GWXA 3ELYA 4EKIA 2B78A 4X63A 2R3SA 4PCLA 1VQ1A 1P39A 5BP7A 1NV8A 2OB2A 3TFWA 1KPIA 4RTQA 3NW9A 4GC9A 2ZULA 2PT6A 5CVDA 4KIGA 2EG5A 2OO3A 1XJ5A 3G7UA 1EJ0A 2IDKA 3KQYA 3SR4A 2PY6A 5FWDA 4M38A 3A7DA 2GS9A 3DR5A 2B3TA 5EHIA 5HIIA 1JSZA 3JWGA 4HG2A 5IKMA 2QYOA 3HCDA 3SSMA 4E2YA 1H1DA 1FP1D 3LGAA 4X60A 3REOA 3FUTA 2O06A 4LWOA 1QAOA 4GC5A 3TPZA 1TW2A 4PYLA 1SQFA 5HIKA 4Z2YA 5K03A 5EZQA 4FSXA 5HIMA 2P41A 2Q41A 2QE6A 5E1MA 5CVJA 1L9KA 1P1CA 3AY0A 3EGEA 3PLAE 2AN3A 3M4XA 1XCJA 1NBHA 4QQKA 3CBGA 1EIZA 1AQIA 3RW9A 3EMBA 3CCFA 1I1NA 2G8NA 1XDUA 4G56A 3CVOA 3DMGA 4X61A 5DRTA 2HNKA 4MIKA 3SX0A 5K01A 1ZG3A 3OZTA 3FUUA 5HIJA 3PVCA 1IM8A 3HA3A 2IGTA 1VP3A 5K0NA 5U4XA 4QPNA 4EVIA 4IWNA 2WK1A 1RI1A 3LCVB 2FYTA 1N7IA 3CGGA 1BKYA 2AOUA 8MHTA 5DWQA 2ADMA 4WXHA 3MERA 4V0QA 5D1NA 3LPMA 2P35A 4LWPA 2IP2A 4RX1A 3F4KA 4E70A 2H00A 3SVZA 3P9CA 1ZKDA 3TMAA 2BR3A 4GUAA 5DT2A 3KPUA 5BW5A 3KQWA 3ME5A 5H02A 2HTEA 4L7VA 2G72A 2XBMA 2ZFUA 5M5BA 3FUVA 5LQNA 3C0KA 5FQOA 3TOSA 1DCTA 3KQQA 2P8JA 4YUYA 4RTSA 1N2XA 2ONZA 3A4TA 2YXEA 5C1IA 4F84A 9MHTA 3LX6A 5EGSA 3P9KA 1R74A 2PV0A 1QAMA 4KRGA 5CVEA 5K05A 4HTFB 4X41A 1JQDA 1SG9A 3LCCA 3M6VA 2XVMA 3UA3A 1BC5A 2VDVE 1IY9A 3M70A 3NWEA 3B5IA 2QRVA 4GOOD 3NTVA 1VP9A 3KR9A 4OQDA 4QQNA 3NVKI 3O4FA 4V0RA 4DMGA 4IV0A 4IV8A 2P7IA 2BH2A 4MWZA 5EIWA 3KPYA 4KDRA 4EKGA 1X1BA 1UFKA 2GAFA 3R3HA 5HILA 4EK9A 1KXZA 2VP3A 1N7JA 2UZ4A 1WXXA 3C3PA 5LR6A 4KVZA 3P71T 1G60A 3IV6A 3KQVA 3DMHA 1EQAA 3ELDA 2P3QA 5E8RA 5EZSA 4RYLA 5DX0A 2HV9A 3HVKA 2PSSA 2AOWA 3G8AA 2OZVA 4KDCA 2AZTA 4RTKA 1KHHA 2ZTHA 2ZCJA 1L3CA 2YXDA 2BM9A 2NXNA 3AJDA 1JG3A 3LKZA 4DZRA 3UJCA 3PTAA 1AF7A 3GXOA 4XUEA 2FPOA 3DH0A 5P8WA 3B3FA 5E8JA 3GIWA 1DUSA 3I53A 3VYWA 1WZNA 2PXAA 1OR8A 4KW7A 3UWPA 4PYKA 5K0BA 2ORED 3C6KA 1I4WA 1Z3CA 1SQGA 5T64A 4RVFA 1QAQA 5K0GA 5FQNA 1Q0SA 2H1RA 4E33A 1P91A 3AWIA 5MHTA 4QDKA 3BKWA 5E1OA 1VLMA 3CJQA 2CMHA 1XXLA 2NP7A 3OU7A 1TW3A 4PCAA 2AOTB 2I7CA 4AZWA 2NXEA 1O54A 5K0CA 5LQAA 2LD4A 4AZSA 3MHTA 3V8VA 4RVDA 3KQPA 3KU1A 3MTEA 4QDJA 3T0IA 3O31A 1HNNA 5C9ZA 2CKDA 3M6XA 5E1DA 5GIPE 4HTFA 1NV9A 1XDSA 4ER3A 3KPWA 5E1BA 3D2LA 4A6EA 3CJRA 4M37A 3K6RA 1NBIA 3A27A 2B9EA 5GP1A 2CMGA 5ERGB 5F2KA 5EQJB 4OX9Y 1KIAA 1ZQ9A 3EPPA 3M33A 2AN5A 2BR5A 4DM3A 2ZZMA 4DQ0A 2EX4A 3EEOA 3CC8A 1RI5A 2JHCA 2P1DA 2G1PA 3MQ2A 5EMJA 3BGVA 4MHTA 4GF5A 5CVVA 5FA8A 1Y8CA 1AQJA 4Y2HA 3L8DA 1X1CA 1RJDA 4PYOA 5CVUA 5E9QA 4C08A 4YMHA 3LDGA 1YZHA 4UOEA 5DTMA 2CWWA 4POOA 5DLYA 4YV2A 4RTLA 2GA9A 3FPFA 3SMQA 3BT7A 4P7KA 1AV6A 1ZHFA 4HC4A 2IBTA 5DSXA 3NJRA 3HCBA 4R05A 4RTNA 3G2PA 5EKUA 4AZVA 3AXSA 3UJ8A 3IHTA 4E2WA 3OU6A 3HCEA 5FA5A 3LBYA 5JR3A 1NKVA 5LQUA 3FPJA 4CKEA 2P3LA 5D1HA 1O9HA 3HVHA 1L1EA 4X1OA 3FUWA 3V97A 3LHDA 5EMLA 2PX2A 1PJZA 1R8YA 3G5LA 2O05A 3LBFA 5CCBA 2NP6A 2ERCA 3MCZA 3MTIA 1T43A 3PX3A 3HM2A 3MGGA 2EFJA 2N47A 2ZBRA 3TKYA 3R6TA 4PIPA 2EJTA 3E23A 1MJFA 1NW8A 4ER6A 5GINE 4YUXA 3B89A 5EC8A 2AN4A 1NT2A 2VS1A 4ATNA 1G38A 2PBFA 2YXLA 3UJDA 2IDJA 2O0LA 2V74B 4FT4A 4QVGA 1YFJA 2ZLBA 3I5UA 4E32A 1INLA 4EMSA 4F86A 5HZMA 3GJYA 2FK7A 5FUBA 5E9JA 4RTPA 3TLJA 5ICGA 2Z6UA 1O9GA 3GCZA 3KQOA 4DKJA 1FPQA 2IFTA 5FTWA 2PLWA 5ICFA 3EVGA 1MHTA 3C6MA 2OPBA 3LCUA 2YX1A 3PFHA 4PYMA 3EGIA 1XVAA 3T7SA 1RJEA 5IH3A 4PYNA 1VE3A 5CM2Z 3UJBA 1X1AA 3GNLA 3EVEA 3KPJA 5EOVA 3FTEA 2ESRA 3FPEA 4P7GA 3FUXA 1JQ3A 2IH4A 1HMYA 4MQ4A 1NW5A 1UIRA 3I64A 2VZ9A 5DTQA 2ZSUA 3QV2A 3SGLA 4EQZA 1VBFA 2P7HA 1YUBA 3MB5A 5CUQA 5CD1A 2PXCA 5KQRA 2I6GA 1G6Q1 4K6MA 1RJGA 1D2CA 2A14A 4DCGA 5DX8A 3A7EA 2OBFA 4R8RA 1NW3A 3ER8A 3NMUF 4IKPA 3UZUA 2KW5A 2ZVJA 2VDUE 2BR4A 2GB4A 2HR1A 2UYCA 1QZZA 2GH1A 3A25A 2F8LA 5EMMA 5K0FA 5DX1A 3ANXA 2JJQA 3BWMA 4GBED 1KYWA 1G8SA 1L3IA 4ISCA 5K0JA 2GPYA 5BW4A 3P9NA 1RI4A 5LQKA 2PWYA 1VL5A 2OXTA 3OE5A 4QPPA 2Y1XA 5T6BA 3SXJA 1NW6A 5FWAA 2HMYB 3I58A 4PGGA 3UFBA 3KKZA 4YUWA 5CIYA 2UYHA 2Y1WA 3EMDA 4GOMD 1YZ3A 3T7RA 4PNEA 4C4AA 3EVFA 3JWIA 4BY9E 3GRRA 1RI3A 3FRHA 2NXCA 3R0QA 5DM0A 2PKWA 2DULA 1JG2A 3LL7A 3LSTA 4YUVA 3ER9A 3S68A 1IXKA 3HCFA 4GEKA 1SUSA 2ZBQA 2O57A 3DXZA 4C04A 5LQRA 3M6UA 4FP9A 4GOND 5GM1A 2JHAA 5LQJA 3DOUA 3KR0A 4HGZA 5DPMA 5FADA 5GM2A 3QOXA 4C06A 3LDFA 1ZGAA 1D2HA 3LECA 3PS9A 4CWAA 3FYDA 1ORHA 3HA5A 4E30A 1R6AA 4AX8A 2I9KA 2G70A 1VIDA 3DULA 3G89A 4HH4A 2YVLA 1NE2A 3FTDA 4XUDA 1R8XA 3FZGA 4PWYA 4DCMA 5C0OE 3WSTA 4CKBA 5GOZA 3NVMB 3BZBA 3VC2A 4GQBA 2AR0A 5KQSA 1M6YA 5F2NA 2NXJA 1ORIA 2E5WA 3HEMA 3EVCA 3SM3A 1X19A 3UJ6A 3KQTA 5HFJA 1RJFA 3ERCA 2BZGA 3LDUA 5ICCA 5JUWA 3B3JA 3GRVA 4E2XA 5T67A 4F85A 2O07A 3KHKA 4R6WA 2FHPA 3FTFA 3CJTA 2WA1A 3I9FA 4RTOA 5ICEA 2OB1A 2ONYA 4YUZA 4PYQA 3DTNA 3SSNA 5EHGA 2VDWA 2B25A 3OE4A 5FULA 5E2BA 3Q87B 4U7PB 1DL5A 3R24A 3EVDA 3THSA 1FJXA 1QANA 4R6XA 1EJ6A 4DA4A 4HRAA 4M7RA 4KWCA 4OBXA 4CTKA 4YMGA 5LSAA 5GIOE 3GRYA 3PX2A 5G02A 2C7PA 3QOWA 3DP7A 3THRA 4BP1A 3U81A 2IBSA 3FTCA 1KYZA 4ZTBA 2PT9A 4BLWA 4LECA 1FP2A 3HCCA 3TM5A 3E8SA 3K0BA 1KPHA 3BWCA 4Y30A 2AOVA 2ZIEA 2C7RA 1YB2A 3GGDA 3GU3A 3NWBA 5EIFA 4RTRA 2NNWB 4RSRA 1PRYA 3UJ9A 1XTPA 4A6DA 2EJUA 3DXYA 3G2MA 5HOQA 5HEKA 2XYQA 4CXMA 3UBTA 3HA7A 3GO4A 3HNRA 4PIMA 1JG1A 4M36A 5DXAA 3E7PA 4P7FA 4BLVA 4E31A 2Z6AA 2FK8A 2CL5A 2OKCA 4ER5A 1WS6A 4OQEA 1KPGA 3FYCA 2ZZKA 1G55A 3P2EA 1BHJA 3IEIA 1EAMA 4FR0A 5B1SA 3G5TA 4PINA 4PGHA 3C3YA 3ELUA 2PX4A 2XYVA 4PYIA 3BGIA 3KQSA 4R8SA 1JTFA 3TM4A 1I9GA 4OA5A 4DF3A 1EG2A 2XVAA 3P97A 5KYGA 2AVDA 4FZVA 1XDZA 2FCAA 1JTEA 5EMKA 2R6ZA 2PXXA 3T7TA 3R9XB 3HVIA 5EG5A 2P3OA 3EVAA 1QYRA 3HP7A 1UWVA 3KR2A 2YTZA 1KP9A 3GRUA 5FHQA 4ER7A 2ZWAA 3DXXA 3M6WA 4KIFA 1RI2A 5E9WA 2FRXA 5DM1A 1SVUA 2ZIGA 2C7QA 4OA8A 2YR0A 1JSXA 3EEYA 3ELWA 2YQZA 2AS0A 2AVNA 2XYRA 2PX5A 4FGZA 4HGYA 2OYRA 1YFLA 2QRVB 3UJ7A 1JQEA 1SKMA 3MCTA 2IH2A 5EPEA 3OZSA 3IYLW 3B3GA 5F2OA 1VPTA 2P40A 3NDJA 4FT2A 5CCXA 3FRIA 3P8ZA 2G71A 3HTXA 4QTTB 3EVZA 3KR1A 5EEGA 3ORHA 2YUIA 2OY0A 3OFJA 4RTMA 4FSDA 3G8BA 4XUCA 3HVJA 3LKDA 4FS8A 3RODA 3PT9A 4P58A 2IH5A 3VC1A 1X1DA 4YV1A 7MHTA 2JH9A 2B2CA 3EVBA 1XCLA 1KR5A 5EVJA 1WXWA 4GOLD 3TR6A 2UYQA 5K0LA 1P1BA 3OCJA 3MAGA 4NECA 3E05A 2AOXA 4B17A 2BM8A 3AXTA 1F3LA 5KVAA 1G8AA 3TKAA 3G88A 1FBNA 3X0DA 2ZW9A 3RIEA 2ZWVA 2PJDA 3ID6C 10MHA 4WVLA 3JWJA 4MTLA 4CTJA 2NYUA 2QM3A 3P2KA 5K8VA 3DLIA 3OPNA 4C03A 3PB3A 3PFGA 2H11A 3B7PA 5DM2A 5BXYA 3BXOA 3P9IA 3DLCA 3KPVA 4CKCA 3GRZA 3O7WA 3H2BA 3TQSA 2PWPA 3OFKA 1V39A 3FPGA 3NDIA 4OBWA 2V7EA 3HCAA 3BGDA 1L3BA 3Q7EA
chains in the Genus database with same CATH superfamily
2CFCA 5I7FA 5JAPA 4GZ5A 1WABA 2JHPA 2BGJA 4H17A 1LD3A 1D8TA 3H17A 2ZEJA 1QS0A 4QGFA 5G1NA 1JIJA 3OF2A 1Z07A 4D56A 3IUNA 5EZ6B 1KOGA 1NR7A 1K2VN 2DM6A 3MRXA 4G24A 3IDZA 4UBMA 4D81A 1HYEA 1F5SA 4GVXA 4RMGA 5DYWA 4AMUA 1FFAA 4CV2A 1H93A 1DAGA 1MEEA 1Y1PA 4KNYA 3AR9A 3RFFA 3H11B 5IWCA 1NAIA 1GDDA 2VA8A 3OU2A 4E6EA 5DK4A 5KSOA 5TS2A 3WL7A 1SUIA 3Q98A 3E2PA 3ZZNA 1HRDA 3GWZA 3MMZA 1A9OA 1DVRA 4G36A 4C0JA 1X7XB 3DE4X 5LJLA 2WHPA 3NBQA 2P2YA 2ZDGA 2AK2A 2K4MA 1G3UA 3NR2A 1YFKA 2AK3A 2UYOA 1GTMA 1NI4B 4LYAA 3UK2A 4TTPA 721PA 3NV7A 5BYBA 4B6JA 3GLFE 2X77A 4UCQA 5CJJA 3TF5A 4UQLA 2INGX 3AI3A 4HPWA 4Z0TA 3RJZA 2J31A 4M1MA 2VP4A 5HR5A 2FZKA 3DEHA 1ZWLA 3JD2A 3A6LA 4MRPA 1VRCA 1GGHA 2BFOA 4RLHA 3WMFA 1XTKA 4LS3A 5FOTA 1YV9A 3KEOA 5C1DA 3IP5A 3AUXA 4GC9A 3ROXA 2EX1A 4G4SO 1G8KA 1I2CA 4X1IA 4AIRA 3SE0A 4C78A 3QVVA 2CLCX 3COJA 1O3YA 2EZ9A 3BWVA 4JJZA 5FWDA 3UOWA 2QUZA 1WM1A 1NRWA 3DMTA 5ES3A 1S9HA 4KQGA 1QGUB 1W5AA 3ZE7A 2CVPA 2QL6A 1HSOA 4X60A 5ECDA 3F1KA 2VA9A 2CNKA 2WSLA 4ARZA 4PQYA 2I29A 3QTLA 1MZPA 4C5BA 3L6BA 1WD5A 4H6XA 4JT9A 3FFWA 1MHPA 4G1VA 5FL7A 1ZUWA 2GF9A 2VJYA 3TOXA 3C97A 3R5FA 4OHBA 2TMGA 2VTEA 3JQBC 1X1SA 3KB6A 2PFSA 4TV9F 2LBPA 3N0VA 1JPJA 1PG2A 2JDID 1DI0A 1GN9A 4QU9A 3S55A 3KKQA 1V8PA 1OX6A 2XCOA 4U0KA 1XRMA 3O4VA 3CEHA 3K0EA 4AY3A 2GBIA 4J0CA 4DLTA 3L1UA 4B3HA 2HA2A 3O4HA 4D9FA 4EB3A 1ODKA 1TLLA 4HFJA 1EUCB 4QPNA 2E1PA 1J9EA 4CF5A 2Q9UA 1YKSA 3WVNA 2B35A 2OXRA 3A4YA 2FWMX 3AHHA 4HR7A 5CEEA 5IANA 5L3SB 1OHHA 2D13A 2IGBA 4TL8A 4UBLA 3UV7A 1JKXA 3A2MA 4J6FA 4K40A 4WFJA 5ECWA 1KMNA 1Y3BE 4NE9A 1QLHA 1XEXA 3ESZA 4BNIA 2AMFA 2VQ6A 1MJ5A 4E5KA 3G6WA 2CD9A 3HV0A 4YHHB 3EGDA 1RW4A 1L7XA 3KQWA 1GTJ1 2L19A 2EWWA 2G72A 4RHTA 2DU8A 1CRWG 1V1MA 4DCJA 1F6BA 3FUVA 4TKZA 2C1EA 5D7BA 2NLOA 2QU7A 2YV2A 4Y3UA 3S7ZA 4DIOA 3SF8A 1VIYA 1JKJA 2WIKA 1PGQA 4XR9A 2Z2YA 5A0FA 3ZYZA 1TC2A 2UDPA 4MQLA 3IIKA 3ZW7A 2ADFA 4G84A 1CUIA 1CZLA 2HXSA 4H7DA 4XQ9A 3U6KA 1GRCA 2W2LA 3FFAA 4BWYA 3GG9A 3RS0A 5JEDA 2GDJA 2AFIA 2VNSA 2ZWOA 3MELA 3OLXA 3V8MA 1V1RA 4G0MA 2UZ1A 2IQ5A 2PR2A 4I9FA 1CPYA 1CB7A 3IT1A 4KDRA 5GVSA 1NI3A 5HILA 3IQHX 3SLGA 3BQMB 1USUA 4LYJA 2J32A 4NCKA 2FKAA 3FLMA 5ADUS 4FU0A 3AF4A 3EFOA 4OOEA 1RACA 4LGCA 1QVVA 2ZAIA 1TX4B 2FSSA 2P5SA 1GGNA 4QWMA 3WYBA 1OX5A 4OB7A 3ILVA 1YD7A 1GTRA 3D7LA 4FZ5A 1N3YA 1NASA 2NV0A 4D6YA 4JJ4A 1G66A 4RVCA 4ZVPA 1CIJA 3MXTA 2ZYWX 2W37A 1HMPA 1NLUA 4OI1A 3RSCA 2R8PA 2ORIA 1OC2A 1IXZA 2FHSA 2CVOA 4CN8A 1KZYC 2ZSFA 5I5GA 1P9RA 4TRJA 4IIFA 5C5EA 2QMYA 3I8XA 5L8VA 2HPAA 1CY7A 3UFXB 5TQ0A 3VYWA 3VUEA 1XQ1A 2B98A 1WZNA 1DOZA 1XNGA 1YQTA 2VHYA 1B2LA 4KPUB 4M4SA 3K09C 5F4BA 4LA4A 2J6BA 3OM8A 5GONB 1BCRA 2AJLI 3BDAA 3E3OA 3V33A 2IW3A 2AXEA 2AEJA 3C43A 3W3AD 5MHTA 1V16B 3PIIA 3T4XA 2YZ7A 3ZDZB 2ZIZA 4BVKA 2X6TA 1IZ7A 5CH5A 4AZSA 3L0BA 4CMHA 1NR1A 1WUKS 3LWNA 3THOA 3IXLA 1PZEA 3GMSA 5E7MA 4MUMA 2UUBB 4ZGBA 2A0KA 4RA6A 1YHYA 3NEJA 4GX2A 4EJ0A 3ZGZA 5EIHA 1HE2A 3VPDA 2CK3A 1SBTA 1HH4A 1U8TA 3B6ZA 3TSWA 1E3MA 2I2WA 2P6RA 2ZCUA 3B1YA 4DSNA 2XJ9A 1H2RS 2PRYA 2WSMA 1JVBA 1JZTA 2BSXA 2HXYA 3PEUA 2XWJI 1ZQ9A 3QPVA 1RLOA 2C96A 3BMOA 2RGXA 3UG6A 3IQXA 1N32B 3CR8A 1TMKA 4CDRA 2WWTA 5PGMA 1SIOA 4ERNA 4BKPA 2BP7B 1YIDA 2YWRA 1AQJA 2WMNB 1MIOA 3RUEA 1UXGA 3M4ZA 3LW7A 1UINA 4YMHA 4DV6B 3O0TA 5HA5A 2WHPB 1G0OA 4CIXA 4II7A 1FUUA 3GMTA 1HXHA 1UBTS 4XW2A 4B47A 4JCOA 4UE3S 7AT1A 2QTWB 5JAHA 3BL8A 1J8DA 4OU5A 4JYBA 2QTHA 1CEYA 4JHLA 3TNJA 1PT6A 3H2IA 4LSWA 2D1QA 1X1EA 3TW0A 1PR6A 3CUTA 3WGVA 4MVJH 4XGRA 2O8EA 1CNEA 3LX4A 5BPFA 3VZSA 3KM0A 2WVAA 2N9UA 1G5QA 2X9NA 2ZTUA 1ZMXA 4Y6LA 3QUAA 5KYXB 4IVNA 4F60A 2Z2JA 3AERB 4BAGA 2VSFA 4ZZ0A 1TEZA 4RJ2A 1J1UA 2J3EA 3R3YA 1F14A 2XH8A 1ZU5A 2DOKA 3ACDA 5TVKA 2XOXA 3DC2A 1COZA 2OO5A 1TD1A 4EPVA 5J4LA 5IAKA 1JT2A 4RADA 4U9UA 4CNQA 3ORRA 2D8MA 3GJYA 2FK7A 3NBUA 3PDJA 1Y5LA 1L5VA 3PRYA 4QEDA 3CKLA 4FMBB 5I9NA 5JI3E 3PHHA 2F2TA 5T6MA 1SIBE 4S1NA 5LZ8A 1TIPA 3LCUA 4KQIA 1IN7A 4GZLA 2WWYA 1DIOB 1PDOA 4UXHA 3FFTA 2WJVA 3KXLA 4P3NA 4QXOA 4ZAVA 1IY8A 3GT0A 5ALEA 3PEWA 1TKRA 1H8EA 1DRJA 4XIGS 4RD2A 3CRQA 3MS7A 4OB6A 5AD1A 3JYLA 3QV2A 1TQ2A 2R8BA 2P7HA 3FR7A 4MO2A 4Q6BA 1M76A 1OOEA 1YMQA 1YS9A 2QD1A 4NY1A 3VUFA 2ZE8A 4XD7D 5ARCA 6NULA 3R74A 3ZQKA 3C6QA 3PA8A 1UF9A 4DREA 1DBSA 2AT1A 2ZJ7A 4YMVA 1O9BA 4J0EA 4LJ4A 4E5NA 4YA6A 4MV6A 1FJGB 4JENA 1GCOA 5EFOA 1L5HA 1XZQA 3T1VA 2GTIA 3OLYA 4LN1A 3LGXA 3L01A 5IYZB 2P0EA 4CMEC 3HDTA 4PF1A 2DFLA 3RYHA 2X22A 1M1XB 1KYWA 1FUYB 3STXA 2J30A 2EJCA 3HKBB 3CNQS 4E1AA 3TX6A 3DLTA 1M8JA 3KKMA 4NS1A 1H6CA 4WLVA 5TPWA 4BNLA 3CX4A 3GT4A 5DCYA 4O2LA 3VI4B 4DR1B 4X6UA 3ANLA 4UNSA 4PGGA 3DW3X 1VCNA 4U39A 2QLBA 3I01A 1J0AA 4YMWA 1U1IA 1XZKA 2BI8A 3T5MA 3OC0A 1ZD9A 1ZCAA 3L93A 1Z0FA 4FINA 4IP0A 4FKMA 4EP1A 2WINI 2RB4A 1CTQA 4W9RA 2C4NA 2JCGA 4ZCSA 2I6TA 1CIPA 1I0IA 2Y93A 4JBNA 4EL0A 1JDBC 1R6TA 4JELA 4C06A 3ADKA 3E5HA 1E9FA 1CY6A 2BZ0A 5DNDA 1JDUA 2D62A 1NUQA 1NYLA 2FG5A 4X1YA 1T91A 5IC5A 1EK0A 3V8PA 2B0CA 4X97A 2Z4TA 1Z0AA 4RJJA 5C35A 2BN4A 4HH4A 4OQFA 1VKHA 2YVLA 4O4JA 2DPGA 1MABA 1EBFA 2Y2VA 3I8OA 5B3AA 5EJMA 3BZBA 3VC2A 3EEQA 2WP8J 1GPUA 2PE5A 4KZKA 4QFDA 2RJNA 3ITEA 4GM1A 4R8VA 3EVCA 5FAKA 3DL0A 3SM3A 1VG1A 2C2YA 1X9GA 4X6LA 3WHKA 2OBMA 2PEYA 3C6XA 3EG9A 1T1JA 2AZMA 3F2VA 1QJ4A 3HY6A 3N6VA 3OZGA 3QLUC 4D8VA 4IIBA 2O8DB 4R8MA 2ZWPA 2Z5FA 2EWMA 5AT1A 2PGJA 3AP3A 4EDHA 2VJOA 4PGMA 1T5IA 2C5AA 4BO7A 1I6WA 5AK0A 1S3IA 3DM5A 2AFIE 4AFNA 1I7NA 4Q9IA 1ZJJA 1FQOA 5AI0A 3AI2A 3VR4D 5J63A 1KDTA 1XB2A 1GSOA 2WJYA 3IHKA 3MCUA 2BTEA 3IJPA 5FBHA 1J22A 5FPPA 2AUTA 4M7RA 5LMCA 5F77A 3ZXUB 3W8NA 1KKUA 2EKQA 4ROTA 3PBKA 2GK6A 2QV7A 3IUMA 4BQSA 2Y27A 4BZWA 1VHQA 4KXMA 5JQGF 1DUVG 4XGQA 1M74A 1OKKA 2ZDHA 2ZJ3A 3GCGA 4NFHA 1PYGA 2VCEA 2PFGA 3IVMA 3J7TA 1EFKA 1DHTA 1V8DA 3AQIA 1W2WB 4HN9A 1AZTA 3KL2A 1W5EA 3KZ1E 3QVGA 5JD6A 4KACA 1YB2A 1BVHA 1W4RA 3CNHA 1Z7BA 3IAHA 4RTRA 1PRYA 2QE7D 1L4NA 5KTSA 5LZ4A 4EGSA 2F17A 3UXYA 2ANCA 1HDZA 4AJ2A 2XYQA 4UDOA 1EVLA 1G8MA 2R97A 3HKEA 1ZO8A 2ATVA 3L7CA 3RBVA 3C1OA 3JY6A 3VZDA 2CL5A 1YB4A 4KYTA 4EO7A 3R6LA 2BHRA 3GJ6A 2QD4A 3I9LA 1EAMA 2NM0A 4C0QC 1S7CA 2WPNA 1U81A 4RNDB 3I2JA 4YQEA 5C8DA 5AJUA 3ELUA 5CDTA 2JD2A 3CPEA 4QBTA 4G65A 2E6KA 3BXGA 3GRCA 3LUKA 2E6UX 1U99A 3T61A 4WL0A 2PD3A 4X00A 1NQUA 2F48A 4ESOA 2ZROA 3A9VA 4UM7A 4FEAA 1NRXA 1XZPA 4AJJA 5DTEA 3R1IA 3C5HA 2DPYA 4LWQA 4GI5A 2RHMA 5EFZA 5ARDA 4YRMA 4PLPA 3JYHA 2B94A 1SQ5A 1U4OA 4FYKA 4ZCQA 2EV9A 3ZDEA 5B1EA 7REQB 3AY3A 3FYUC 2J9XB 2FRXA 2ZQYA 4KPFC 3A6KA 2R4TA 4Y18A 3PQCA 4WZAE 1EVIA 2UZ1B 4UEOA 4KR9A 1N6LA 1XZ8A 2R00C 2AVNA 2XYRA 1XK6A 1DAPA 1ZJ6A 3DZ8A 1GQFA 2OYRA 3UEOA 2DUUA 2J9FA 2O4CA 2A1UA 2WTXA 3CLRD 1F8UA 2ZAOA 3CONA 5EPEA 1SKMA 4QU5A 1Z2AA 3RC7A 1SD5A 4DQKA 2AF4C 2E4AA 4WSOA 3FHLA 3HSKA 2ZBVA 1Q19A 4H0FA 4XCVA 1R6DA 3ORHA 2NU7B 3ZEAA 4CDMA 1UC5B 3CE6A 4ZVTA 1K0UA 2V7UA 2VPQA 4QM7A 2XTNA 1P9WA 4PGAA 1CNMA 3PT9A 4ZDJA 2ZJFA 3U7IA 4YAUA 3LCRA 1T2UA 3QE3A 2OL4A 2OCGA 1VLJA 1AHHA 4OYLA 4WY2A 3DKPA 2FUG6 1U8EA 2UYQA 5JU6A 4ZTZB 1UXIA 1WXGA 5GY7A 3WX0A 1G2OA 1T15A 2GPBA 3WGIA 2IJGX 1TK2A 1G6OA 1NBOA 1EB9A 4BFXA 2K2QB 4ZYXA 4WDRA 1SKAA 3R40A 4R4JA 4R1UA 4BECA 1M7GA 2GZHA 1S4MA 3A11A 1G3MA 3O26A 3OMLA 1SVKA 4O2RA 1N9KA 2JLBA 5JPDA 3QVOA 1BEZA 2GWRA 3DJFA 1M1NA 1G6KA 3MBOA 4BMCA 4LBYA 2O1EA 4K46A 2WJGA 3P9IA 4ZRNA 2FPIB 2G07A 2OCPA 2PQMA 2Z8YM 3ICPA 3FI0A 1VC2A 1VKZA 4Q7MB 4TRMA 4DCCA 2GZDA 5J2UA 3BHNA 2W48A 4S1TA 2AYXA 5K3BA 3CXUA 3A26A 1PBTA 3IT3A 3V4ZA 5TV2A 4ZJUA 2JGJA 5FI0B 4UTOA 4TMFA 1Q12A 4G63A 1NVTA 2G1UA 2IPXA 4L3WA 1WY7A 5LZ7A 3U44A 2XZOA 5IM4F 3CX7A 3S2GA 3SN6A 2Y68A 3B2NA 4AY6A 3CX8A 4WLEA 4RACA 4JSYA 3WIVA 1VMAA 4HB0A 3U6BA 3AVVA 4ZVOA 7YASA 3FDXA 4EW2A 3DUWA 1EE9A 5BNIA 4TMZA 2QJOA 3LQ2A 2AOUB 1KEEB 3FBTA 2X58A 1U80A 5B57C 5JY1A 2JAXA 4EA7A 3NU1A 3A37A 4BBPA 3PFFA 4RVHA 4EZEA 4H0NA 1QTQA 1P44A 4WUTA 3RVJA 2XW6A 1QHFA 4RNCA 1UDRA 1EE1A 2F43A 4R3UC 4F3NA 3ABIA 3JPWA 2WJAA 2OVBA 3BKXA 4S12A 3WAKA 5B58C 3FR8A 4WA8A 1PJSA 1PJ4A 2B78A 3K7EA 5DYNA 2IWHA 3E7FA 4DWOA 1J99A 4UCXA 4ZMSA 2IEYA 1KPIA 2Q0SA 2ZULA 4WZ6A 2NGRA 3A9WA 3CLTC 3NLLA 3P9SA 4V0OA 5KYYA 2IDKA 2AC2A 3WIUA 3V2UA 2O8BB 3ESBA 5EIEA 1C0IA 2CEAA 1PK9A 3ZKWA 4RMNA 4R1QA 3H9EO 3O2NA 1U9IA 1MFPA 3Q6NA 3SXUB 5HTOA 2PSEA 2WYVA 4M1OA 4QUGA 3WIBA 4DABA 4YROA 3AVYA 4I50A 2VHXA 5HIKA 2C9ZA 2HA7A 5AMXA 3UAWA 4R7ZA 3DBRB 3Q7TA 1ZW1A 3JQDA 1G7CA 1XQYA 2GPTA 4CEIB 1W9MA 4L72A 3TG2A 4FYHA 2PUHA 1FXWF 5DN6A 3PFIA 2GD0A 2P6OA 4E21A 3GJRA 1CC1S 4YJDA 2JLWA 2W2QA 1H65A 1IVSA 2YFKA 1N33B 1L4EA 1L7BA 4KLZA 2RI0A 1C81A 1DT3A 1USIA 4G56A 4RZQA 1H1TA 1P61B 4ZO7A 5DRTA 3OZTA 3ZWXA 2JIBA 3B1KA 3AX6A 3EULA 3C1UA 3KT3A 1X8KA 1UL1X 1YI0A 3BJMA 3D7SA 3N28A 2FYTA 4DR3B 3AL0C 3FZNA 3OJLA 1T2AA 2ADMA 8MHTA 2K87A 4JLWA 5DO9A 4D9GA 1OB5A 4TN5A 2PQ0A 1S9DA 1FTQA 2JEZA 1GCAA 4WA7A 4LSGA 5GZ6A 3S2SA 2B8NA 3WL4A 1SB8A 1DC5A 2Y2UA 4MWCA 1ZA2A 1PK8A 3KAQA 3O2SB 3TD2A 3TRDA 2BMWA 5JD5A 2XKAA 4A0GA 4AP6A 1UJNA 1IN5A 1ZNXA 4B32A 2BFFA 3ETGA 5FA6A 3W2TA 3KQNA 3K09A 3KHTA 2FAXA 1PJ8A 1ARZA 1SBZA 2R6CA 2VRCA 5BWOA 4YRJA 4J0HA 2P67A 2RJOA 5BQPA 1XZDA 1N92A 3SG0A 4PZ9A 4YRKA 3IE2A 1UEXC 3FCCA 1JAZA 3ZCQA 5EGSA 1GILA 3BWXA 3EPRA 3JU3A 3RTBA 1IY0A 5ERYA 5CVEA 5DNYB 3IE0A 3NHKA 2PT5A 5KYXA 4M6WB 5AVOA 2AC7A 1V5WA 3KSDO 3O3NB 4FD3A 4NPAA 3KR9A 3RRFA 5IM5A 4MB6A 3EQ2A 3PYXA 4IX9A 2I55A 4BKRA 1L8OA 1MQ9A 4B3IA 3FA2A 2PS9A 3A31A 1PO7A 2CF6A 3PE4A 3ESAA 5TRTA 3CVWA 1Y6ZA 2DHQA 1SD1A 4A6PA 1DO2A 3F3YA 4KVZA 3VH1A 5LZ9A 2WMDA 2QUAA 3BH0A 2WWFA 4RV5A 1FU8A 3CR3C 5IAJA 3KQKA 1TIBA 1KI4A 4JR2A 5AHXA 4WFQA 3TVYA 3WISA 3VJKA 5C8YB 1GFIA 2PUVA 1E0KA 1ZDMA 3LUHA 5CXSA 5IVHA 3DB1A 5B4UA 1GXSB 2JGDA 2FEWB 3U1VA 4DLNA 1CR1A 9ATCA 4IIHA 3IKTA 2BCJQ 1TVEA 1AF7A 3ET4A 1AK2A 3MWJA 1MG0A 3OWOA 3MJRA 4L9SA 3USES 1CS0A 2J33A 3PGLA 3J80A 1HG0A 2IP4A 4QGAA 3MF4A 1VDZA 3QEBZ 4PYKA 2HHCA 2P65A 3LOQA 1Z15A 4IO1A 1ADJA 5AW2A 3UQZA 1SQGA 2OBXA 1V7ZA 2ODBA 3D8RA 3QP9A 3ZKAA 2HDOA 3L7YA 4CVNA 4TXMA 1R88A 3JAKA 3LZDA 2X0IA 2G06A 3R7BA 1DXHA 4PXSA 4LMBA 1KVSA 2EZUA 1PTJA 1Q74A 2MSKA 1NWHA 4WECA 3U9LA 2L17A 4AG6A 1KSHA 2CUZA 4R83A 3E5NA 2J3JA 4MA0A 5HUJA 2JAPA 5C9ZA 3CLSC 5A9TA 2LCFA 3NHPA 2ZYRA 4HTFA 3OUUA 2IYXA 2XLBA 3I8SA 4L8GA 4QNNA 3RGGA 3ITKA 3KPWA 1DJPA 1ZEMA 2YHIA 3D2LA 3LPDA 4ER3A 3RIYA 4DV3B 1O0BA 2DERA 2IXGA 1EE2A 2ZJ4A 3EY4A 3NRBA 3O9ZA 3J7AC 3RF7A 2FXVA 3MWEA 4OKNA 4XVHA 1STOA 3I5AA 4J0KA 1GLGA 3ZQJA 4ODIA 3ZDXB 1ZUNA 3OPXA 4LVCA 3SQDA 3OD5A 3KBBA 5EWJA 4ZGGA 4J7UA 1JEYA 1Y8CA 2YDYA 1KI9A 4Y2HA 5CVUA 1B0PA 3S1AA 5U4QA 1C8VB 1CJVC 4OP2A 1OF1A 2XX3A 3NCHA 2HX1A 4CL2A 4EA6A 2QLFA 5KIAA 1ICEA 2NZXA 1FK8A 2YASA 4IHJB 5JT1A 3I4CA 2J5XA 3HL0A 3RIGA 4IZHA 4F72A 2A4MA 1KEUA 4ZQHA 1AV6A 5I7WA 3GFPA 2Q3DA 4YP0A 3V48A 4HDRB 4J7CA 2M1XA 4XQGA 3RVKA 4AZVA 1VYUA 2KI5A 3P4YA 3GEEA 4QODA 4WGFA 5D86A 3VR6A 3UBMA 3HVHA 2HCJB 2D4AA 3CUKA 3BICA 2CBXA 3DAFA 1RC8A 4MVJI 2CNLA 3HYLA 4TV9A 1NYQA 1A9XA 2DUWA 2VHZA 3MCZA 3AU9A 3TKYA 5ILOA 1UPFA 3WJAA 3R6TA 1SD2A 3ENQA 2GPJA 2KBFA 1DKOA 4G5FA 3T3HA 3T41A 2I1LA 3DFKA 1NT2A 3ZY3A 3MA0A 3MFYA 3QM1A 4YJ2A 3KB1A 3BN3A 3PGA1 4ND4A 2BI7A 4AXBA 1EEXB 2IDJA 2Z30A 3ONFA 3QYFA 2WJHA 4B3BA 4RS3A 3B85A 1UFQA 3NBFA 5CITA 4OAQA 4DSTA 3ZH2A 2VI5A 2EIHA 3W4JA 4MQUA 4Q9DA 2QVCA 4PG5A 1XZGA 4IDPA 3RM3A 4S05A 2J0VA 3O4RA 3OLCX 1F12A 4C22A 4QPZA 1OYWA 4LQLA 4MS3B 5HXAA 3FOEC 5HUQA 5AKZA 2PLNA 3UJBA 1G8YA 3I6MA 9GPBA 2GEFA 4RORA 3D1LA 5KREA 3DO8A 4MJ3A 4X20B 2IH4A 1V2HE 3VNQA 1IEQA 4DJAA 2G7MC 3L7DA 4UVIA 1X1RA 3D4NA 2P2LA 4BWVA 1KEPA 4W7HA 4EQZA 3CW9A 3C1AA 4US2R 3C3WA 2QLJA 2XUFA 1GQ2A 4RK1A 1G6Q1 2H1CA 4A16A 4DCGA 3FMIA 4GR9A 2LNDA 4XD2A 1E18A 3T1YB 4KX3A 4EPRA 3U56A 1FP7A 2VDRB 1GITA 4HUJA 4LMPA 5EIBC 2KW5A 1M2OB 2N1BA 2P2ZA 1E3WB 3NTOA 1U0HC 2BR4A 2AQIA 2HT1A 1WKCA 1GL3A 2FEPA 1VPDA 4JYPA 5LWHA 4P34A 3L8ZA 2FTKE 2VUSA 5LYJF 4O4IF 5J2UB 4HBZA 4MR8A 1M6NA 4B4VA 5JC8A 1KEEA 2QTTA 3BK7A 5L3RA 1KMIY 2KWIA 4PO8A 2E4VA 1RJWA 1A7JA 2GPYA 3ITNA 3MHPA 4IVPA 4B79A 5JZ9A 5L3QB 2HQBA 2FW7A 3DV0B 1LZKA 4PZDA 1DKQA 4C3UA 5KUTA 2HV8A 4P4GA 4MKIA 3OQNA 1E3SA 4PLWA 1KEKA 3ZY6A 1IONA 1TCBA 1WP4A 2AEEA 1E9AA 4PCVA 4POAA 4QT4A 1Z82A 1UZMA 2DWUA 2WLTA 2XOEA 3GZ4A 1C4XA 2FFBA 2LW7A 1LI7A 2X0JA 4A0FA 1DOAA 3Q9NA 4YJFB 621PA 1BXZA 4MUEA 4NZPA 5D84A 4JS0A 1YA8A 3IPRA 4AUEA 5IXJA 2V4MA 3BHMA 4D9JA 3HPRA 3ENKA 4MINA 5IASA 2CHGA 5AH0A 4TUYA 4HN2A 3FYDA 5DE3A 2IHUA 3LYUA 3WKEA 1JIKA 3HBFA 1NVXQ 3ONNA 4F4FA 2I2AA 1B6SA 4AJHA 3MGKA 5I4IA 2KYRA 5I4BA 1Z5VA 3QITA 1QYDA 4ZEWA 3A4MA 4KKVA 5KQSA 3NVMB 5KX5A 1DAIA 4Z1MD 2VYVA 1WPQA 1O8CA 3ICCA 3C70A 4MAFA 3G8YA 5IKEA 3HEMA 4X45A 3U49A 4BVGA 1N2BA 1WL8A 1ZM4A 2IZ6A 3IQGX 1TJ5A 4QX6A 2FGKA 3G82C 2QQFA 1KU0A 2ZQ5A 4P83A 4PBSA 1ZNYA 3AFHA 4ALLA 4Z3DA 2BTOA 2PTGA 3CJTA 1FF9A 2AE2A 4Q12A 1I24A 3HHPA 2V7BA 4GICA 2BGMA 4FMCF 2ODPA 4GPZA 3VR2D 3KT0A 1Z5NA 4ZA2A 4PC3A 5FPSA 4HLQB 2M6SA 3O93A 5FULA 2HA5A 2YZKA 2I78A 3R24A 1QMGA 1XJQA 1MXHA 2E4ZA 5ALSA 3TRJA 5JVDF 1EJ6A 4KN6A 4FGLA 1EUDA 1E2FA 2OM6A 3TIGA 4I5EA 1J9GA 2YYSA 3HBAA 3M0EA 5AFSA 5LSAA 1A04A 3AWDA 1E2JA 3TGLA 5AW5A 1GVHA 4JC0A 4ZTBA 1FW6A 5L6MB 3HS3A 2NO7A 1JILA 4F2WA 4KX5A 2OHXA 4OJNA 1NVVR 5M3BA 2CB0A 2ZYVX 1OBOA 1SEPA 3HCCA 4GNKA 1HURA 2BFFB 3CU5A 3IB6A 1A97A 4KLAA 1G291 1EBBA 3S81A 2AHRA 1DU4A 1U8YA 2HUPA 2P5YA 2P9EA 2W2LD 2ECOA 2Q4RA 1ORDA 3UWOA 5IZCA 1J00A 3B70A 4C7OA 3UJ9A 3CNNA 1CY2A 3NM5A 2QU8A 4UHHA 2E4UA 5EUMA 1G21E 1T24A 1UBKS 1Y7LA 3N2KB 2X1MA 1WOMA 4KE9A 2QX7A 4RPCA 3L7NA 4CPDA 3CIOA 5J2UF 5TPZA 2HU2A 3IJ5A 3JQ8B 4OAOA 3VKVA 2HA6A 6AT1A 2BGGA 2JIDA 4BPRA 1L5YA 3LU1A 1L4KA 2UXBB 3VSBA 4FXPA 4R9SA 3K0FA 5EXTA 1SPXA 4R1LA 1Z7EA 4X3CA 1YGYA 4R8SA 5K3SA 1GZ6A 1WXFA 5TMEA 3T6KA 3CHYA 4LE2A 2XVAA 4KO3S 4DDUA 5FH9A 1MAWA 2AVDA 3LXMA 2Q4DA 3JVIA 4G4JA 4EGJA 3ZLTA 5JLJA 1SUEA 2UAGA 3F98A 1MU0A 4ZT6A 3BE8A 2R6ZA 3H19A 5TF0A 3TCKA 4DA0A 3DVRX 3IVRA 2J9ZB 4C6TB 4N49A 4NXMB 1Z3IX 3AVTA 3L7MA 3EVAA 3R2JA 5FBZA 2YZNA 4AYXA 3C8UA 2ODWA 1N9GA 4PNPA 3U1TA 3ZBPA 2YTZA 5CD9A 7ADHA 4RMIA 1NY5A 3L02A 1MGOA 2QTVB 3RDPA 2J59A 3HWSA 1XTTA 1BYIA 2B82A 3DXXA 3R6GA 3OZWA 3GYGA 4LRUA 4URXR 2FP4B 1NTOA 2ST1A 1DPFA 4Q1BA 5JNWA 2QD3A 3MPOA 4NDNE 4R71A 1YA6A 2YHUA 3W3AA 4LZZA 3BTOA 3K70C 1G1AA 1BU5A 5FP0A 1K4YA 5T4EA 6REQA 2WKQA 3U1BA 5LL6P 3OZSA 3VMMA 2HHHB 1OJLA 1PX2A 5ULLA 5J47A 3GFQA 1XMPA 3LQYA 1KY3A 4JEHA 3VZPA 2AFHE 4QTTB 1W94A 3L7OA 3HTXA 4TKVA 5JJCA 1JNYA 1G2IA 3GELA 4IUBS 4LY9A 3ZBTA 5E3IA 1Q0UA 1W4BA 2P0AA 2RCYA 3A3YA 2HTFA 4LGYA 5EPOA 4JXXA 2IKSA 2CK3D 2IOYA 5T4FA 3KB2A 2D2EA 2XKKA 2NMVA 3RNLA 1C3VA 4BC0A 3UCEA 2GHIA 5DF1A 5EVJA 5EINA 4DG9A 1DBVO 1GKUB 1COWD 2LWIA 2QGNA 2JCVA 2VDKB 3IKLA 4QO7A 5F78A 3RU9A 1P19A 1SUPA 3SKYA 1T5TA 2IIBA 2OLEA 2W2PA 4RAQA 1N1DA 2F3QA 4ZP1A 3C7AA 1AQYA 1E58A 4OQNA 2GBPA 3NTXA 3FHOA 4WCFB 3EDOA 3PTZA 3CZ4A 2J46A 2V7PA 4TKUA 3SHVA 2OXEA 3VHXA 3WLKX 1ZN2A 2VAWA 2ZWVA 3P2OA 3Q1KA 1OWLA 4DUGA 10MHA 1BTOA 1YQDA 4ZT7A 4C03A 3B7GA 4UPVA 1MIOB 2RIPA 2A35A 4P80A 1Z28A 5IS2A 4DXHA 1LWOA 1V9LA 3FCOA 4AUMA 5A04A 3TQSA 3ZE6A 4JUAA 1BXGB 3L07A 4GSYA 4IHJA 1ZGBA 1GZVA 2D74A 3NDIA 4YP6A 3ZE0B 3BSFA 2IUEA 3EAFA 1AUPA 4AZTA 2BBWA 4J7AA 2ZZNA 1GPYA 2WA2A 4IDEA 1W34A 3MTAA 3NT4A 1RBQA 2P9JA 3FPHA 3P9QA 3ZTTA 2M98A 4ZI7B 3LX5A 1JJVA 2ZTSA 2IZZA 5CM8B 1ZS9A 4RV4A 4EYEA 2ZIFA 3GXBA 4AMVA 4HYQA 3QE9Y 1RM5A 1YMUA 3V32A 5BUCA 4FQ5A 1VMIA 1Z37A 2EQBA 5DM4A 2R79A 2CZGA 3BBPA 5JMPA 1K0FA 2PMFA 3T15A 4MXDA 3FETA 2OVFA 2WOOA 4LYFA 1A8IA 1MW9X 1UDAA 3PUZA 2FZEA 2Y4NA 5GADl 4HNSA 4HNTA 5TVGA 2IDZA 5JQGB 3F5FA 4RVGA 3HZOA 1UM9B 4HNGA 1GNPA 1H6AA 4FLEA 5CM9C 4PICA 3KYDA 3MYRA 4B33A 2ZIAA 3MGBA 3WO1A 4KBYA 1ZM7A 3HL4A 1H9CA 3PNBA 4IJUA 4S35A 2V7QA 4GPIB 2B1RA 5DNAA 2PVCA 1ZD5A 2YOHA 2YYAA 4XD7A 2C82A 4KPYA 3X43A 2PD4A 2Y0DA 3T12A 3UFXA 4Y1GA 4E7PA 2H4JA 2Q1WA 3Q10A 2OAP1 1W1IA 4KFRA 1HI9A 3WYNA 1MAAA 1X87A 1UKEA 2X5OA 2OO3A 3SBDA 3TB6A 4DLLA 4Z2AA 3MTDA 4WOCA 3WGQA 3DL4A 4DKXA 1RHKA 1XFDA 1UMDB 2NUPA 1PZGA 2HNBA 3IIJA 5BUZA 4Q7QA 1Y5RA 5KQMA 1E5TA 3RIMA 2R44A 4DANA 3NFRA 2GCEA 1JHYA 4PC7A 3Q2OA 3V80A 1O94A 5HIMA 5IJ0A 1S8OA 2OECA 3CZPA 1ZK4A 1KVTA 1XRSB 5BWMA 3AHJA 4OXQA 3ZWKA 2YVUA 2VH2A 3TE6A 5BSHA 2VXOA 4B3FX 1JHRA 1H2YA 4KOEC 1ORRA 3ZQ4A 1I1NA 2XXBA 1JB1A 4OMDA 3B53X 1XMIA 1OI4A 3FUUA 1PWYE 3IRVA 1CFZA 1D1SA 1I4LD 2QK4A 4S2EA 5JJKA 1PI3A 1XD8A 3HCPA 1QHEA 4IPTA 2ZSJA 1VRVA 5G53C 3RHFA 5IVKA 1O95C 1J2EA 3GVPA 2G25A 4LOLA 1HDCA 1ZM3A 2B3DA 2F8MA 4N5IX 3ZC3A 1RKBA 3SEZA 1PZXA 4XYMA 3UMRA 3GJ5A 3RU2A 4FFOA 2GX6A 4YV7A 3K9BA 6LDHA 2GARA 2OP0A 2QTAA 4QFBA 2BYTA 5E7JA 1Z16A 3W1EA 2HJRA 2AZ4A 2BMVA 4G0PA 1V5EA 3TMAA 3KXKA 4GXQA 4WOPA 5KWSA 4GUAA 1VJRA 3IP3A 5TPWB 1I80A 2ODQA 1L8LA 4BO3A 3PFKA 3LWDA 1V7CA 1Z6AA 5BN1A 1I4EB 1Z63A 4JC5A 1LVGA 3BHJA 1RLUA 1PT9A 1K6EA 2PZ8A 3V8RA 1ENZA 2WUFA 3W06A 1SBQA 2J3HA 4RTSA 3HO6A 5KYVA 1NMZA 1VKJA 1Y1SA 4FDUA 1CU1A 4IOJA 3VR4A 1P7ZA 1ESDA 1R74A 3ECCA 1QAMA 1U02A 1C7EA 2PLFA 3DOIA 4PLZA 1D4ZA 4UU8A 2D1RA 1K7CA 2WSSD 2XVMA 3DM9B 3SJ7A 4E22A 4NDZA 2V98A 3QBEA 1SCAA 4D4GA 4NRDA 4DAEA 2QRVA 1VTKA 4OQDA 2XCUA 4PFSA 1VBNA 5HBGA 4CR7A 1XYVA 2FX2A 4FCTA 2P4HX 4U3JA 5DU2A 4IV8A 3M89A 5LJIA 2P7IA 2XGGA 1H2FA 5HGXA 1FLNA 1QBKC 1EXDA 4NBLA 2B8JA 4HLUC 4PHGA 4OKSA 5EE9A 1LGYA 1X86B 3P0EA 1I4DD 4YYEA 1R5NA 3L84A 1CZOA 1WXXA 1E7SA 3AU8A 3FRJA 1A4XA 2PMCA 2QRZA 4AJKA 2BGIA 3RRMA 4CRWB 4DDKA 4D0LB 4YRAA 3DMHA 5LXTA 2I76A 4J0GA 4C6TA 2W2OA 1EHYA 1HT1E 2HH9A 2W0SA 5EZSA 1GNSA 2IY7A 3CX3A 4EUKA 4TYWA 1M72A 4LY3A 5EJ7A 3HGQA 2RH5A 4HAUA 2GHRA 3L9WA 1U0TA 1H2HA 3PITA 2NO9A 2QP9X 4ZIRB 1TU4A 3ZOKA 1KJIA 4BVJA 3C5WP 3QMWA 4F9TA 2KLHA 2MSWA 1TTQB 4P3PA 2X4IA 3H7IA 4KYIB 4X92A 5A3QA 1U9ZA 4L76A 3L1HA 2BIFA 1EG7A 1VHLA 1GPAA 1CEQA 5H0IA 3S70A 1J25A 1ENOA 4F1WA 2CVHA 3E18A 1LPAB 4OPMA 4Z9FA 1DKMA 5AUOB 2Q0XA 1YCDA 4Y1RB 3WTCA 1UWKA 1I4TD 1CKEA 4QYXA 4WD3A 4FFDA 3VHQA 1EINA 1KARA 2BKAA 4D02A 4D9MA 3JASB 1PHRA 2PMDA 5CP8A 3HFJA 3VKFA 5ALUA 3ND6A 1FDIA 1OIVA 2GYVA 1KJ9A 2HMTA 3C4JA 3ND9A 3TMYA 1Y9JA 1JQAA 1YZGA 4A73A 2FMHA 1M2EA 2XLCA 2A1IA 2Q5FA 4BE4A 3AJEA 3SFZA 3NOVA 1UFVA 2B9EA 1KIAA 4ZWNA 2IF2A 3CRMA 1U0JA 4L8VA 1OFGA 4CCAA 3LQRA 3SYRA 4JUBA 5BRJA 5CVVA 2QMUA 1SVIA 4Z9AA 3MK31 4Q0MA 4B3TB 1EGAA 5KNBD 2L18A 4I8XA 3A32A 4EKYA 2WKPA 2X0DA 3FTQA 2VAMA 1YMVA 4JJ6A 1ETUA 5CTAA 3F3MA 1WDMA 2ZQZA 4X85A 4DC0A 5ED4A 1HDGO 5JHHB 1TI7A 1NYTA 3MRTA 1W36C 1MC1A 2NU6B 5CT8A 4RELA 5FOVA 2A0YA 4ZT4A 3T3DA 3TZCA 1DJOA 1XD2A 1OT3A 2VJCA 3M2TA 3BWEA 3P9PA 3WKAA 1QSGA 3R0ZA 1H2EA 1U3WA 3BF7A 3BG5A 4TMXA 5K7SA 1CEEA 3AF5A 1T43A 4UQOA 2AQHA 2EJTA 1IZ0A 4RHEA 3K15A 4ATNA 1CE8B 2PX3A 2VS1A 2F8SA 2ZSAA 3GB9A 3ZI4A 5KSWB 1KI1A 5LBIA 1YJXA 4EPYA 2SKCA 1IHOA 4E4RA 4DG8A 1G1MA 1Q1QA 2IPOA 3I34X 4N65A 1E2QA 3MAJA 2PGOA 4NV1A 4QVGA 3RU7A 2OTCA 4F86A 1KEVA 1NUPA 2BUAA 3QELA 3VH3A 3OEWA 3CTMA 5FUBA 2ILTA 1WXDA 1KI2A 3FNBA 2AA3A 3I2GA 3P9RA 3ZGXA 4D8TA 3AF2A 3RROA 2NO0A 3VVBA 1IXYA 2IFTA 1N4DA 1DOHA 1JIUA 4IIVA 2P69A 3C14C 4D8XA 1F8FA 2GZ1A 2IHZA 4YS6A 5KDLA 5IJXA 1RJEA 2O2ZA 4C9BA 5DHRA 5EE5B 4CFSA 3U19A 2YZMA 2XMRA 4WKOA 3COPA 5K0ZA 2LZ0A 5AM1A 1HMYA 1A76A 1X92A 1UIRA 4K1LA 4D3FA 4QWWA 1TYAE 4LHVA 4QXQA 3WJ7A 4ASUA 4CTNA 5IN5A 3W6NA 5E4TA 4EYGA 5IDYA 1D0IA 2IE0A 3N5CA 5A0TA 1IWPB 5EP1A 4EM6A 1VI2A 5GZ1A 4ZO4A 3GFTA 5ANRB 1IOWA 4WNAB 5F12A 5IVPA 4R8RA 1HLGA 2MOKA 2QYHA 1NW3A 5KTMA 3RTAA 1IE3A 1YS2X 3CVXA 1YC5A 5ER6A 2QAGA 3R76A 2WHYA 1F20A 1Z12A 2PMKA 4ZT3A 2OHHA 4CMGA 4RK4A 4W5HA 5THXA 4DZZA 1W5TA 3L7JA 5KTNA 4WKGA 1KI8A 3VU3A 2AXQA 5A0VA 3CE9A 1U0FA 4PM4A 4FDMA 4LQ4A 1CFJA 4MLDA 3JVVA 4JI6B 1KEZA 4C4PA 1SXJB 5D3QA 2ZAYA 3UUEA 3KLPX 3W05A 1ZLYA 2V7WA 4CV3A 1MX5A 1MPXA 3C7CB 4MRMA 1YI1A 2QTVA 2HBYA 4BY9E 3GRRA 1CP2A 1RI3A 2JCXA 3K72B 4EX6A 1T5BA 2BHSA 5CW2A 2EEPA 2IS2A 3HCFA 2YNMD 5E0KB 2JL1A 1I30A 1ZIDA 5K3DA 2O2SA 3ZV6A 3D43A 1I7SB 3IUSA 4WVFA 1PV4A 4ABYA 1XKQA 3HP4A 4MIEA 3UK0A 2AJ8A 4CWAA 1T9AA 3I61A 1J97A 2OP1A 3TQFA 4FBGA 2O1WA 1L4UA 3DTVB 3KYDB 4FWTA 3K8YA 4J1QA 4GLOA 1LSSA 1XZHA 4W9NC 2YUTA 2OPHA 4BZQA 4PWYA 2GN8A 1W75A 3RTDA 4JGGA 3DUFA 5C0OE 1G64A 4RH0A 1POXA 3KWFA 4WGGA 3H9BA 1XRQA 2FJUA 3I45A 4WK6A 3ZWPA 3GLUA 2BW0A 2XRFA 1ID1A 4U8HA 2CDCA 2WFAA 3DAHA 3IAAA 4BQPA 2VQFB 3VU9A 1AURA 3FYSA 2HMVA 1GQRA 1BVRA 1H6BA 2QIPA 3PHJA 5TT1A 2ATXA 1CYDA 3DE1X 1XXHE 1YCGA 4JB0A 1IEWA 1LQTA 1DFIA 4H31A 4C29A 2I9PA 4M0KA 3QEOA 3TNLA 1M2JA 1KERA 2Z5LA 4RD0A 1EPUA 2RHRA 4AMZA 1MX1A 4LFBB 3JAWA 2VDWA 1GUFA 1QYCA 1R8JA 1I8TA 4OUDA 4U7PB 5C5DA 4G97A 4JD5A 2YQ4A 1CQPA 4KWCA 3GRYA 5GVRA 1RVDA 1W0KD 2WE8A 3B1XA 3S7TA 2JIQA 2AG6A 2LTAA 3FTCA 4WZAA 4CEHA 4Q7JB 5T8KA 3WA6A 1T0IA 1QF9A 4CFZA 4RQBA 3OCYA 2A58A 3OE1A 4FW9A 2JFNA 2PKEA 1IYZA 4Y30A 3IB3A 3ZDRA 3UYLA 1RHQA 1QWSA 3FBGA 1DIAA 2JI7A 4N3AA 5HCUA 3ZCRA 5LDDC 1ODLA 3GP5A 4GXNA 1OXXK 2VXCA 5A03A 3OLZA 1ETHA 2ZPTX 4IXWA 1B23P 3SPXA 5HOQA 4OLFA 4TL6A 1EDEA 2CLIB 4MCIA 3D5QA 2DWOA 5HFAA 2PZLA 1HTBA 3E7PA 4JJIA 3HI4A 2G76A 3IERA 1VI6A 2A88A 5BSTA 5HS4A 3KYJB 2EBUA 3FWZA 1GGJA 3TLBA 2EF1A 1UANA 1NA5A 2YJ6A 4JNKA 5JLAA 2O59A 4MWEA 1V6CA 1LPOA 2CCGA 4JYZA 1TO1E 2C2MA 3KSRA 5EZYA 3TM4A 4BB5A 2D0IA 1UJ4A 1LSUA 1KVQA 3EWNA 5KOJA 2GK4A 3AEUA 4IG9A 5CW1A 3G49A 2Z98A 5ESRA 1FNCA 2PL9A 3A06A 4L0QA 4MW0A 1RS0A 2IYRA 1Y9ZA 3B8HA 2GXQA 3RSFA 2HY7A 4ZOEA 5CYGA 2JRCA 1TCVA 3L8EA 3OX3A 2VT3A 5CGZA 4IW3B 2XTAA 2WLSA 4ER7A 2CUKA 1T9GS 1TGVA 5E2IA 3DAGA 5JHGB 2JB9A 3HLTA 1GJRA 1SVUA 3DAOA 2PZBA 3HJAA 1ABFA 2Y99A 3I04M 1Y1QA 1Q83A 4C5AA 4PR3A 2YS7A 2NU8B 3QA3E 3SZ3A 2YOFA 2QRVB 5H82A 2SECE 1JQEA 1TK3A 3KC2A 3MCTA 2CMKA 2KJQA 1YRQA 4Y1EA 4BP8A 1WQ1R 4ZZIA 3B3GA 3RC3A 2WD8A 4NHEA 2YMPA 3DZFA 1XMJA 3IPAA 1N4AA 4AN0A 4Z7QB 5AJYA 1X8LA 1XC7A 5CPFA 1B0AA 3BRCA 3BRQA 3KS9A 2C97A 4G81A 2FF7A 3DOHA 4OOFA 2CCKA 1TM7E 5HFNA 1M1YE 1B3BA 3ROKA 3EZLA 4GVPA 2B2CA 3G9QA 4QUHA 4L75A 4TRNA 1J07A 1QONA 1JHAA 1GN8A 1XA3A 3G3EA 5CNMA 1FSGA 1C4WA 1U0BB 4YWHA 3UQYS 1DX4A 2AX4A 3H84A 1I7LA 1CDZA 4O1MA 2IW1A 3AXTA 4B17A 2XNCA 4HCJA 4KNVA 4IDQA 2TSYB 4LC1A 2C3MA 3DNMA 5EHNA 3IQWA 4FFPA 1GUYA 4TT3D 2IELA 1P62B 3FD8A 3JWPA 1H4VB 3B9PA 1M2NA 2QM3A 4G9GA 2J4FA 4UTPA 1ZOOA 4GBGA 5ARBA 1RRMA 1XVVA 1U2EA 4NPCA 5IJWA 3M1IA 1YBFA 4IINA 3QLVA 4NABA 5L7YA 4WDQA 1U5BB 3P2MA 3OOWA 3W5DA 4EY4A 3H1PA 2YJ5A 4R7GA 2JJ2A 4TLAA 1LFDB 2GOYA 4Q05A 1GUZA 3R7AA 4DY4A 3CR7A 1G9TA 1NPYA 4TOIA 4CM4A 3CF4G 3WIEA 1V3VA 4PZYA 2CFRA 3LK7A 1LUAA 2WQZA 4MRRA 3RNOA 3BIJA 1U1EA 1M0EA 2QTLA 4Q21A 1GRVA 1X77A 4ZIRA 3K73O 3F9RA 1P0QA 2JH8A 1EFRA 1Z8FA 2VJAA 1IPEA 3DOJA 4G2TA 3MWDB 1OX4B 2ZBPA 1ZOLA 3KT8A 3ZZ0A 3TSAA 1J8MF 3OPYI 1KBQA 3EAQA 1Q3HA 5EZ5A 2QN6A 4O4HA 4O63O 3DHWC 2ZUUA 3HADA 3F2IA 1YT5A 4KXFB 5E4JA 3VU1A 5IMBA 3HYTA 1Z0IA 2ZRJA 3TEMA 1SXJC 1Y8QB 3RRYA 1JZSA 1ULZA 1YRHA 2WSYB 3DMDA 3NG1A 1Z74A 3ODPA 1JKIA 4H3KB 2XADA 4IRUB 4MYUA 3WYFA 3DHVA 5CHEA 5AM4A 2V1UA 1CJUC 1DCKA 3QEJA 3BSWA 5IKOA 3FPKA 4BP3A 3A1VA 2RAVA 4HLUA 1BD4A 4XKJA 2HEGA 4FIDA 5HDQA 5JALA 3HR8A 3JX9A 1UBFA 4DV7B 1QB8A 2CDRA 5JRZA 1CJMA 1HDIA 1UKZA 2QVYX 3B5JA 1KK2A 3V7NA 4RJTA 1Y3CE 4NENA 3OI7A 2C2KA 4AYTA 2ZB4A 4ZCPA 1FYXA 3KYCA 3JQ7A 2YC2C 4RXTA 3TSOA 2B9VA 1C1DA 1JQLB 1ZVJA 4EL5A 3J81A 3GPDG 4M3NA 2ZATA 3A6GA 2DQSA 2RG7A 2ZJ1A 1J0EA 4FKZA 1CF4A 3WDKA 3I9V6 3KYBA 2O2HA 3H86A 2DPLA 1Z6ZA 1ZD1A 3OCUA 4Q3LA 5LM3A 3K2EA 5E95A 3D7RA 2RHDA 5A7FA 2KHZA 2E18A 1GAXA 1RPJA 1H2AS 1KGDA 2JKYA 3IOBA 1G8HA 4O8ZA 4EG0A 3LIPA 3O5AA 4CW7A 1XJCA 4LWOA 1OZFA 4NBNA 3KUUA 4C21A 3WAJA 3OG9A 4UHCA 4PYLA 3BL5A 3UT5A 3ROMA 4XIFA 4E12A 2QZZA 3LUAA 3QU2A 3I1YA 4JQZA 1LPSA 2P41A 1M2VB 3C16C 3RKUA 4PV7A 1VIVA 5FX2A 3SIPA 4KG7A 2V3VA 3PLAE 1CRPA 3FSJX 2AN3A 4OU4A 5WRFA 1L1FA 5C1PA 7GPBA 3FOFC 2VN8A 2CBGA 1GPNA 4DNQA 1WMFA 4I9UA 3N0RA 2O8EB 1RWKA 3K6SA 2BISA 2ZJOA 1Y7HA 2BMEA 2VOEA 3CNLA 3PD1A 4I4NA 4IDGA 4L08A 5TMBA 3SX0A 3WB0A 1IWBB 3DWGA 1U7TA 3OX4A 1ILWA 2WK1A 2NVBA 2PA3A 1M8GA 2GRUA 2PG3A 1I1QB 1VG9B 3BH7A 1GDTA 1F51E 1Z5ZA 3RI3A 1L8XA 2Y0EA 3G02A 3GCXA 1G4HA 2HSWA 5PNTA 2H65A 3QY9A 4E70A 2VYVD 4W8GA 2H00A 3K9LA 5E6UA 2ZRBA 5H9WA 2EC5A 2X2FA 1I4OA 1YJ8A 3QU7A 4MCHA 4R2WA 3GUZA 4BB0A 2D59A 4KYUA 1LBEA 1QZUA 1GPMA 1JI3A 1XXHB 1GCGA 1G63A 4RJKA 3KJZA 2O7RA 4WKCA 3PPIA 2AMLA 3L4SO 3KE9A 3WQBA 3HV2A 1TA0A 5K05A 4BVFA 3LCCA 3TJRA 2IS4A 3HU3A 3UA3A 2AW5A 1FVHA 1N6HA 2QTCA 2ZDQA 4X7BA 4YO8A 2OSVA 1P1RA 3ICWA 5GGYA 1KIMA 2ODTX 5A3VA 4IV0A 3DLBA 3AL2A 5IPFA 3ZIAD 4MIOA 3ETCA 2GNAA 4KRXA 4DB4A 2PUFA 2ZR8A 1AKYA 3M49A 5KJ6A 4RXMA 3GLKA 3RFXA 1MO5A 3WYAA 5DHPA 2XQFA 1IMJA 4KLCA 2GDZA 1IPFA 3JQRA 1SU6A 4D4HA 4B3MB 2F4VB 3VNUA 1P4SA 1JQJC 4ND1A 4CL8A 1WLSA 4FOTA 1Y42X 4RLFA 2CLHB 4BV3A 4EO4A 5I4CA 2OV3A 3DUFB 2I5PO 1II0A 3OY2A 2PSHA 4KDCA 1O6FA 2HF2A 2ZXEA 5TPZD 2YXDA 2J1LA 3NYIA 1FYFA 5ESWA 4DLYA 2IA5A 4NG5A 2A8YA 2BFNA 3OKFA 2FPOA 3SEQA 4QXAA 2YBEA 1E63A 3FCSB 3H13A 3RKSA 1MZVA 3O84A 1ZEJA 2WTMA 2F8TA 1A7UA 1KAQA 1KJQA 2EGHA 1W76A 1ZMBA 1ZZEA 3IVCA 2J6CA 3OM1A 4MUYA 4B8ZA 2J48A 1QZTA 4HWGA 5EJAA 4FHCA 4IXDA 4RFVA 4P32A 3TLAA 4K8OA 4CG3A 4CQLB 1NUHA 4E33A 5CMLA 4PY2A 4EO9A 3M3DA 4Y2XA 3PFNA 3MS2A 4CM3A 4DVGA 1JA1A 1M2WA 3VKGA 1TW3A 8GPBA 1W9HA 1O54A 1D2RA 4V24A 1LBQA 2B1IA 3BE6A 3MTQA 1U3DA 2CMFA 3ND7A 1EXNA 3MIIA 3QVLA 1JPUA 4XJXA 3O31A 4EEXA 3VOSA 1VCMA 4F3RA 3FE2A 4Q3CA 1APBA 1VSTA 3R5JA 1KYVA 2HRQA 3EXAA 3I32A 4Z7JA 2YWDA 4YY3B 1Z6QA 1QU3A 4Q3NA 3CJRA 3S4YA 4A6EA 4MJ7A 1NBIA 3LP5A 1E89A 2CMGA 2OYSA 2Z9CA 4EB6A 3FNGA 3MUNA 4MPPA 5KSPA 5IZCC 4FEYA 2JCSA 3RO7A 4YCDA 3V2HA 1YAHA 3ZZ1A 1VPLA 4YXWD 5JARA 4QVIA 2FZWA 3PI6A 1Y4DE 2ZT7A 3FCEA 3TXYA 4G5OA 4WESA 3VNBA 3ZW9A 1UK6A 4Q4HB 2EL7A 4ZYTA 2WUWE 3SOPA 4HS4A 1M34E 4PPQA 5KTPA 4LNUB 1RJDA 2VRWA 4QIHA 1JFLA 2REOA 2RIRA 4J16A 5CDFE 2H7XA 4CQMB 4UOEA 1PVDA 3TAUA 4HPXB 2GK3A 4RZ2A 3W7BA 1IG3A 4DJ5X 1BRTA 4WOKA 1UJ2A 2HA3A 2QXTA 2E3JA 4FHDA 1C5KA 1CBUA 3BEDA 1WMAA 4TV8B 1PJLA 2GAIA 1JMYA 1JXAA 3CUYA 3HA2A 4BJ3A 3B2QA 4C4TA 2XYHA 5DSXA 3Q7IA 3AXSA 3UJ8A 3IHTA 1NNEA 1N34B 4HNQA 2VUTA 2NYRA 1O9HA 2CUNA 2QL5A 3BM5A 4N3GA 4NMHA 5DNWA 3FUWA 1RZUA 2IV2X 3UC5A 1C1YA 2OGZA 5I7AA 2D7CA 3VV2A 5F7XA 3ZW8A 4RM2A 1Q84A 4PIPA 3OZBA 4JBXA 2E48A 4OF4A 4BNUA 2DQZA 3I9NA 3TTVA 3BXPA 3RQSA 3TTTA 3LX8A 4YC7A 4ZFNA 3HWWA 3R20A 1AZLA 3DG9A 4M1KA 3ESYA 1A3CA 1E2UA 3UJDA 1V8ZA 2O3RA 3VM6A 4DBLC 4HD8A 4TQ9A 3A6HA 1RYYA 1NKSA 1KO4A 4U6NA 5DGTA 1RLIA 1Q0HA 1AS2A 1MEOA 1Z4OA 2PH7A 3R41A 4QICA 5D87A 3IUQA 4QOGA 1WZCA 5DI3A 5FT9A 4UAVA 3TQQA 4Z5XA 2OFOA 5HMLA 3VO8A 3WNQA 2DJ5A 3EZNA 1Q91A 3CLKA 2QN9A 4PEVA 3GVIA 1G5FA 2J3IA 3M7IA 1PG5A 1W6UA 1IC6A 1NJ6A 1NW5A 3OKPA 2B8TA 5KKCA 1JBKA 1DCMA 5CU7A 5DTQA 4M83A 1DTSA 2C77A 5FUVA 4I6EA 3ZD7A 4KI7A 1D2CA 2AQ8A 3ZE1B 2XHEA 2H5JA 1KZ9A 3O7MA 3CURA 3DD5A 3OIUA 5M04A 5JPIA 1J2TA 1Q1BA 3VNSA 3GLVA 1MTOA 2XD4A 2W2MA 1WUHS 2VDUE 1T3HA 3GFVA 3HBJA 3UYKA 3ZQ6A 1YDHA 1YUMA 2MT9A 3IDOA 4E5MA 4RESA 2F8LA 2Q6VA 4UJ5A 3ZN2A 3PJFA 1ECLA 4D3SA 3GJSA 4EMTA 5AJZA 2YZ2A 3TRHA 1L3IA 5DBGA 1RR6A 4C01A 2I4MA 1VL5A 1QFZA 1UXHA 3K71B 1VCHA 1KEWA 1Z0SA 3V3KA 2JLZA 1VJ5A 4E5SA 4P5EA 3UFBA 1RZVA 2A9PA 2UYHA 1LA2A 4BTLA 2W2KA 4KAFA 4IJ5A 1BNCA 3EMDA 3G7NA 3CSDA 3FOZA 2ASEA 3ZWAA 2ARKA 5LZ2A 4KIUA 4EJ6A 1GHTA 3FFXA 4WCFA 3EOBI 4DJDC 2C7GA 2QGFA 1K5GA 3WQQA 4EFDA 1XMVA 1FSFA 4XYBA 3ZWNA 4ZQFA 1CUCA 4CEJB 5AK3A 4HGZA 1ZK0A 1E66A 5FADA 4EY3A 5HKBA 3V7YA 4MKHA 4NOMA 2IYYA 4V1CB 1SA0A 4LY6A 2GJ9A 2I9KA 1FXUA 4K9LA 2ZT6A 1SXIA 2H4FA 2NTEA 3HDVA 5DJ5A 3RTGA 3ZDYB 1Y0BA 4EFKA 5KWEA 4KR3A 4B81A 3GP8A 1QTNA 2D0OB 2N0SA 2O3UA 3NTRA 1DJMA 1B2RA 2VLBA 3RASA 3RLIA 3V46A 1VMKA 3AUUA 1UOEA 3INRA 1DKPA 1LW6E 1PL7A 2VP5A 3EUFA 4PG6A 4BLRA 4UUPA 4DY6A 3K70D 1RPZA 4A9AA 4BGEA 4KUHA 3UJ6A 3HK2A 1QUEA 1ZNQO 3IAEA 4GQAA 1RJFA 521PA 3ERCA 2B69A 2FSVC 2P9QA 4YDSA 3W5IA 3IHWA 4DLXA 2UUOA 2QL9A 1XD9A 5LBTA 4XUGB 4AKEA 4IIYA 4RTOA 1GAQA 1TAHA 4ITVA 4K88A 5C7IO 2O20A 3L8CA 1A4UA 4IF4A 3UN1A 3FOBA 4HZGA 4NULA 4NARA 3N74A 3UTDA 3U3JA 4BLTA 4B7UA 4V1CI 3R8FA 3WLAA 4DWWA 5EXPA 4EKEA 1PWZA 4AZ0A 2E4WA 3O9VA 5AM5A 4OD0A 5CFPA 1EIWA 3PNMA 1Y3DE 3QOWA 2JGFA 1L1QA 2G5PA 5JFGA 1Y98A 2IOHA 3QQPA 1H4TA 3NV9A 4BGVA 2JBWA 5JBNA 2FUCA 3M2PA 3Q8KA 2ZIVB 1X9IA 3E1KA 3TM5A 4A15A 3FPCA 5K3EA 1XVTA 2QT1A 5SY4A 2ZOSA 2AOVA 5JYCA 2GK7A 3GPIA 3QMVA 3OF3A 1ZM2A 1RRKA 1AIPA 5K3CA 3UW1A 5BN4A 4PC1A 1T35A 5IEBA 4Z6KA 1NBEA 8ADHA 2A92A 2P8SA 4HXFB 3I9MA 4BLSA 2RHCA 1ZSNA 3ECSA 2DR0A 4BLVA 1NN5A 4L95C 4B80A 3VH4A 3H87A 4IIXA 1T1RA 1ULBA 2FV8A 2HPHA 4ND7A 4P54A 3MB8A 2WAXA 3P45A 2R00A 3OPQA 4FBMA 1KZGB 2QRUA 3HWRA 4HHEA 4ZO8A 1GZUA 4PINA 5DB4A 3AJRA 3WHLA 4MVJP 1JHQA 4PGHA 2C3YA 2HYIC 5HM8A 1K6XA 3AUTA 1DAHA 4Q47A 1CUYA 5D85A 1H0SA 5DP2A 4EY8A 1FFBA 4OH7A 2WP0A 3LXRA 1MFZA 5EMKA 3QU9A 3MQFA 2H0AA 1ZM9A 1OBFO 3TSCA 5AI4A 2G5GX 2ID8A 3AK4A 5B3JA 4Q4LA 1DNPA 5IBCA 1GR1A 1V5GA 1FS5A 1A9ZA 3IKJA 5L4LA 4LRWA 3U3XA 1XTVA 3OJOA 4D45A 3DR3A 5ALFA 4LQDA 4L2IA 4W6ZA 1V25A 5JMWA 3CM0A 2ECPA 4JWTA 3MMPA 2JA1A 4IFTA 3RAJA 1UMDA 3N2LA 3BULA 3MWYW 1BVUA 1UBUS 2NQTA 3H5NA 5U9CA 1EP1B 1RRPA 3ADPA 4P22A 4OGWA 4TLBA 1YFLA 3TW8B 2YVKA 1TVMA 2ZE7A 4V2IA 4NJEB 2QAJA 5LZ5A 2BHLA 1JSCA 1M8PA 1SUAA 2ZR9A 2C9YA 3Q3EA 1M83A 4BBAA 1BJKA 3K2IA 5JAQA 3KQLA 1YDFA 3IBTA 2HSGA 4TVSA 4L57A 4FW8A 1XALA 2CJWA 2JIOA 1C41A 3U4DA 3R44A 1C7QA 3CZQA 2NSLA 1YACA 1PFKA 1ZK3A 1NGSA 2WTNA 1B6GA 3EMVA 1X1DA 3CUUA 4I1IA 3W9BA 1UR5A 1HQKA 4D5EA 1WXQA 2FSGA 3L7KA 2D5IA 3LWBA 2VZ8A 1OROA 1Z5GA 3VTKA 4CKXA 1X1TA 4F4JA 1P8JA 5EXDA 1W2HA 3EGOA 2BWJA 1Z2NX 3OURA 4EHNA 1NMQA 4LEIA 4BL5A 3BZUA 1E5XA 1Q95A 4XDZA 2VWQA 4WVLA 5HZGA 4HPJB 4WLUA 5K8VA 1SC4A 4YT4A 5CDYA 3GAZA 4AJ9A 5CXUA 3R8XA 3ZX5A 3ZXSA 2JI9A 4U3JB 3B7PA 5IZ4A 3B6EA 3FHTA 2KSQA 2R7NA 4PRZA 4YAOA 2Z5GA 4CQNA 1GG9A 4HYYA 2W6PA 2A6PA 1KH2A 2V7GA 3A6PC 3KO8A 2D1YA 2QMOA 4WEQA 5BMVF 2V7EA 1KHTA 1Q6ZA 2BGWA 4XM0A 3NKFA 4ZRDA 1P9LA 3Q3IA 1KZ1A 2DKFA 3Q4GA 2RB5A 1GXSA 1BA3A 3LAWA 1PL8A 1EVEA 2HCRA 1VMEA 5KYNA 2H57A 3KVVA 1E1DA 1DQPA 2PH3A 1B42A 3AW9A 3U4MA 2X6RA 4NYJR 4Y2VA 2NU9A 3VNRA 1RD4A 3ZKWB 4URHA 2JG3A 1L0BA 1OFVA 3TZ6A 5I7EA 2C9DA 3D6NB 1ZGJA 2X9QA 2IXFA 4WXMA 3QTTA 4XLZA 5E7IA 3AIOA 3AUKA 3TQRA 3K16A 2VHWA 3F6BX 4KUGA 4OHOA 4RUKA 2J5RA 4KO8A 1TTTA 1CUJA 3WMEA 4KFUA 3O74A 2NPFA 2AX3A 1TUGA 2XB8A 1DMSA 5GV7A 1E61A 4JR0A 4FM9A 2C7OA 1EMDA 1IN1A 2Z2IA 3VR3D 1Q1GA 4ER0A 3EGXA 4AJ4A 1K6MA 3SAJA 3I3SR 4RTJA 3VZQA 4M46A 2H4XA 4IX1A 1TUBB 3G2OA 1V35A 4G41A 2KLBA 3G7SA 5IUKC 1DHRA 4G0YA 2GR9A 3AI7A 3KTOA 5CDGA 1KJ8A 5ITZA 5GWXA 5IBQA 4NK5A 1C8KA 3TPFA 1OE0A 3VH2A 1KI6B 2ZCVA 1GY8A 5FNVF 3EYAA 2HGZA 4PZ0A 4L22A 1OZAA 1KP2A 2OBNA 2DYKA 4FGJA 4X93A 3RYIA 1DIGA 3RGWS 2QPLA 2EG5A 2QP4A 5TJ9A 3O8RA 4RVSA 4JSRA 4JUCA 3TNDA 1JR3A 4P5DA 3V4RA 3DR5A 3HSYA 3LG2A 3CXRA 4I99A 2Q1XA 3H7AA 5JXHA 5T3YA 2R8OA 4CIAA 3N70A 4D96A 2O54A 4DEXA 2FEAA 4Q1VA 1RXSA 3I9KA 1XAGA 4KGVA 1ZLXA 3IBFA 1ULHA 2I2FA 3P7MA 2B0JA 3O38A 1WDWB 2YMQA 3HY4A 4HH3C 4NF2A 4Y1RA 4YASA 4EUHA 4YRIA 4IFEA 1M34B 2EHDA 5BSKA 4AKGA 1NURA 1UMCA 1XELA 2X3YA 1KZ7B 4H1TA 5KDOA 3R7DA 1U0GA 3EF1A 5LU9A 2E0IA 3JD1A 4TWBA 3B6KA 1NULA 4RWEA 1CV2A 5B36A 1A9XB 5CK4A 4Z4HA 1IUNA 2CLMB 3P0FA 2GEKA 1VI5A 2XODA 3AFGA 3TTUA 1SCKA 3PVCA 5HZHA 1NVUQ 5CT9A 3WMXA 4Z8XA 3WTBA 2Q5HA 3LCVB 4W8OA 1N5OX 4LJ7A 3YASA 5CPBA 1BKYA 2Q4BA 3DDHA 1CYEA 4BWGA 2JVKA 2VDWB 4V0QA 4EBBA 3C15C 3L6UA 4PRLA 2K2WA 3SYLA 4ARZB 4EUFA 4TTRA 1YCHA 2PSDA 3DE0X 3F4KA 4BKUA 1QGUA 3LMKA 1JDNA 3GBPA 3JW8A 5EQTA 1CQIB 4FX5A 1JLMA 1TXGA 2XOKD 4JUDX 2I3GA 5H9VA 2YRXA 4IIEA 4LJAA 4RK7A 2AD5A 3F8TA 1W581 5H02A 1JFRA 2ZJYA 5FTKA 3ZZTA 1SIWA 1TAGA 3HRIA 3AGQA 2CJFA 3NAMA 5KYTA 1EP3B 1NYRA 4WASA 2FWAA 3UB4A 4PBTA 1QKJA 2HU7A 1Z26A 4H2DA 5C1IA 2P6UA 4A27A 4NCXA 4UXIA 2JGEA 2H1VA 3KJGA 5HMMA 3SF8B 3G5AA 3DOFA 4FFRA 4HTFB 1E3JA 3S2UA 1ZCZA 3M6VA 4R1OA 5KNDH 1EFCA 4W5JA 3S8EA 1R8QA 3MW8A 1QB7A 4AY5A 3OKAA 5DHAA 1ZITA 2C92A 2XNSA 3GFSA 5B7GA 2JLVA 1GQQA 3L0OA 4IYRA 8OHMA 2R7AA 2W42A 1KIFA 1IY1A 2WWGA 4ZO9A 3CBQA 4OQMA 5IYZA 2UXDB 1TF2A 3R3HA 2ZE5A 3V34A 2X7XA 4DJTA 1R0SA 1KDOA 1UC8A 2WV9A 4N4AA 2OV4A 4KWIA 3C3PA 3ELBA 2J9YB 2XMSA 5IWAB 3TZKA 3GN2A 4MR9A 4AQ7A 1J8FA 1G60A 2NTYC 2QHXA 3IV6A 4XZ3A 1I3MA 1V5FA 2P27A 3ESCA 4I3HA 3VAYA 4DN6A 1VM6A 5E8RA 2QJRA 4C4OA 2EFDB 3I4FA 1UDXA 1AKMA 3VJLA 2IIQA 4L4RA 1FMTA 1OI7A 1SOVA 1L7VC 1YI8A 3BRWA 1RABA 4Q93A 2JGDB 2Q5QA 1B7GO 1O94C 4QUDA 4Y2GA 3LQQA 4MYSA 1TGYA 4B71A 3RWMB 5CA1B 2VYQA 1U94A 1QG0A 5P8WA 3X1WA 1A1VA 2XR1A 1LRKA 3QPDA 2PAAA 2IXEA 4LF7B 4EHFA 3FSRA 1ZH8A 1YB6A 4JI2B 1B0UA 3OP4A 2W43A 4ZK2A 4MGHA 2ZM6B 4W63A 1WCIB 1R8SA 5HP4A 1AB6A 1U9IC 4D9HA 4GGPA 1UT8A 4OQLA 3VPHA 2ORVA 3R5TA 3REQA 2B4AA 3H1TA 3H42B 4CLEA 3K35A 2WG1A 4FJ1A 2GCOA 2GM3A 2BTQA 1A2QA 4FI3C 3WFIA 5ADHA 4HGOA 5LQAA 5K3AA 3DKVA 2NU6A 4CKZA 3TZBA 3KQPA 5TE9A 3TD9A 3T0IA 3VU9B 3IUYA 1X38A 2PKQO 4PQRA 4BTEA 4D9BA 4ZDIA 1HNNA 1OXTA 3MJSA 2O8CA 4FCWA 3IHLA 3LT0A 3ETHA 4IM7A 3AKCA 1C29B 1U1CA 4I19A 4JJ7A 4J1TA 3TI9A 1J2UA 4B6QA 3QKIA 2O5EA 4EY6A 2WVJA 3OQ6A 1IVYA 2IKQA 5J5CA