3FZKB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 49
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzkB00
1UGOA 5AQJB 5AQHB 1I6ZA 4HWFA 2D9DA 5AQGB 5AQSB 1M62A 5AQRB 1M7KA 4HWIB 5AQQB 1HX1B 1UK5A 3FZHB 3FZFB 5AQTB 3LDQB 3A8YC 4HWDA 5AQUB 4HWCA 5AQVB 5AQNB 4HWHA 1T7SA 3M3ZB 5AQFB 5AQKB 3FZLB 5AQLB 5AQIB 5AQMB 3FZKB 5AQOB 3FZMB 5AQPB
chains in the Genus database with same CATH superfamily
4QH1A 3ZT7A 2R6GF 2WDVA 3HA4A 3HKEE 5HCMA 5JTGA 4DNDA 3LK2B 1MIYA 2CLYC 4DV0T 2M6BA 4PJMA 4HE8A 4DV6T 3AEBA 1S35A 5HXSA 2K3WA 4JI7T 2WQYA 1UK5A 3U3IA 2XSBA 4JI8T 2X9WA 3MXZA 4YFSA 1MNDA 3WI3A 5DJQC 4CI3B 3UFGA 5CJ5A 1LKXA 5AQUB 3H3MA 1L0VA 4X1YE 2Q9QB 2X9XA 2VVSA 3MKDA 5AQVB 5FNVE 2LSKA 2NW7A 4IE6A 4X5TA 3W15B 5J1GA 3JADA 1XDOA 3AE7A 3P4RA 4HFEA 4M1PA 5EK4A 4BJMA 1US7B 2CHOA 5DABA 2IW5B 4MFRA 4I4TE 1GQEA 5ABFB 2P9BA 3P4QA 4GYRA 1ZV4X 3RPUA 2LKHA 3B5MA 2CPTA 3CQXC 3V5UA 3ZSSA 1X9BA 3FBLA 2FUPA 3BQKA 3HI2A 4IL9A 2YINA 4JLEA 3J9X1 3ZC1A 2VK9A 4IGUA 5J2UE 3AE1A 4NXMT 4B6XA 3EDUA 2E9XA 5JR9A 3MK7C 3Q5EA 4O2BE 3CVRA 2KWIB 3KV4A 1SUMB 1UX4A 2NP9A 3QOFA 4QHOA 4GKKT 2YDQA 5HEHA 1W9RA 5E0OA 4IDNA 4QH5A 3IF8B 3JAEA 4LF5T 2IDOB 5F5WA 3AA6B 4CI1B 3J7Yq 5F8PA 1AJ3A 3UUNA 2WDRA 3ZT5A 5JDMA 1YW0A 2LE8A 2DWKA 2ZM8A 3N5LA 3B13A 2CHNA 2QYWA 2PJQA 3LJCA 4FJOA 3K1SA 2KLQA 4A56A 4YTNA 4ZHQE 3ZN1B 5FL1A 3T8OA 5HXHA 1OEDE 3G06A 4DUZT 4X64T 3FZLB 1BR0A 3NZQA 5AQLB 5LBQB 5JRCA 2BZBA 4PW8A 2WMNA 2EHOB 2YDRA 4P1NA 2W61A 1I94T 2YDSA 4L0RA 1NWMX 2M67A 2XQYA 3L39A 4ISSA 5AQPB 2D5UA 5AQHB 2E9XC 3PUZF 5JR9C 4DV4T 2DNXA 1YKHB 2ZLYA 4ILUA 1S94A 2C5KT 2WAUA 1HCIA 2WSSV 2CLYB 2KINB 2XASB 3AEDA 4TX5A 2VQET 1HX1B 1JNRA 2CA5A 3OYXA 5GONE 4EZHA 3KV9A 5L3CB 4AKGA 4H63V 2X67A 4AIUA 5L3GB 4JEUB 3E22E 4OYKA 3RIAA 1XZYA 5C8YE 4X65T 4I55E 4Z90A 4XBFB 2W67A 5AQNB 2WP9A 1OWAA 4ILCA 3UQ4A 1OEDB 2UUCT 3QB5A 3AEEA 2J47A 3N2KE 2W0GA 2YEVC 4DV2T 3ZCIA 2Y6XA 4GKJT 4ZI7E 3KV6A 4AKLA 3PDYA 5FP3A 5AQOB 5LGTB 2LSIA 4DV3T 2HPJA 2K48A 3R84B 1UGOA 2LM2A 3N9LA 2V8SV 2WZIA 2W00A 1HF8A 4H63H 4P0BA 4EEBA 4ZI3D 3RIUC 4HWFA 4DR1T 3AVSA 5JRCB 2JQKA 5IUXA 4K0KT 2XAGB 4TV8E 1M7KA 2BVLA 2V6XA 2W63A 3ZT6A 4CZZB 3UU4A 1ZKEA 4MBQA 3E0ZA 5FY1A 5H6QB 5ABEA 4DR3T 1D1AA 3A8YC 3LDQB 4PK6A 2Z6EA 2BKOA 4LF9T 2CM0A 5LOVE 4TNVA 4QXBB 3P4PA 3UUBA 2W4XA 5L3DB 3PUSA 1T7SA 2XM2A 3R6NA 3FB2A 3GMIA 2K5BB 4U31A 4GYSA 3PUQA 4A97A 1WYBA 4HFDA 5J0ZA 3NKZA 5DQWA 3RC8A 3U78A 4A5XA 2E9XB 2NWBA 1D0ZA 4IE4A 5JR9B 3KFWX 3O1JA 1IBKT 1IBLT 1SHZC 2WBLA 3KINB 1LRZA 2A3DA 5KMGP 4FI5A 1I6ZA 3N9OA 2WCAA 2JRKA 2BG9A 1IJ5A 2FBWA 2E5LT 4TWHA 2V7KA 3VHLA 3PV0F 2ZMAA 3NRYA 5LHIB 3TLUA 4LFAT 3VR9A 2XQ3A 4PK5A 1G73A 1T72A 3RIFA 3AE6A 5FY7A 3TLWA 4E7ZA 5JDQA 4HKAA 4YHJA 4XZCA 2YKSA 2NOXA 2VVNA 2LSJA 5FXVA 4DV1T 3OJAA 4KBMB 3CK6A 1KNRA 5L4HA 2ES0A 4YTPA 2XTLA 2DI4A 3VRBA 4EGWA 5LYJE 2ZM0A 1MMGA 5CA0E 2LSYA 5CA1E 4Q25A 4L9IA 2V7LA 4U74A 3UU6A 4CXYA 3OBVE 5ABGA 3P8CD 5BMVE 3GN5A 2LT3A 1HG2A 2FJEA 3PU3A 3EVYA 3RHWA 5BR8T 2KMFA 4EXTA 3MACA 5HXCA 4DUYT 3ZKRA 4O4LE 2XZEA 5JDNA 3HL6A 3C4WA 3Q5XA 4JBWF 4MALA 4IDOA 3OVUA 4TNWA 4C90A 2XQAA 3ZLIA 2XAHB 5CB4E 5LG3A 2IC9A 2B76A 4YJ2E 3ZEFB 1MMNA 1HG5A 3K3NA 3ZMSB 4H9NC 3AA1B 5J2TE 5FKYA 3BQIA 4LF8T 3AVRA 2H88A 4TN7B 5JH7E 2W62A 5KDMC 5KXJA 4P0AA 4HEAA 3TLVA 2JPFA 3OYZA 1XNRT 5FYMA 5AQFB 3RQUA 4LFCT 2F4VT 2DLRA 5EZYE 5LHGB 4LF6T 3QNUA 2YU2A 2ACXA 4H9QC 5FXZA 4ZI2D 2V5CA 2IIUA 3ZC0A 2RA1A 2A72A 2CXLA 1KF6A 4H9PC 4IT4A 4DIDB 1T8BA 1HTJF 2X0HA 3FZMB 5L2LA 2VL8A 2IUBA 3HKDE 4O4HE 4U33A 3ONLC 2HN2A 2PFVA 4BA9A 4JI1T 4J2CA 2VASA 4YXDA 1YXRA 2BG9C 2X0LB 2YOEA 3HKBE 3SS1A 3N9QA 2XQ5A 2WB5A 1D1BA 3RRWA 2CXFA 4AQGA 2H89A 1VOMA 2L3LA 2UUBT 4JV5T 1LVKA 2UXXB 4KI0F 5IHYA 3CMLA 4ZZBA 5ABFA 4AKRB 2A9UA 2CWOA 4QX8B 1BR1A 5LHHB 1HR0T 3AXJB 4LFBT 4O4IE 4DVDA 2D2SA 5L3BB 4OHFA 2C5JA 2Q9QA 4AI6A 2D0TA 2HN1A 2V5DA 2VQFT 1FJGT 2XJ7A 4U72A 3ESLA 3C4XA 2QRXA 4CXXA 5LJNA 3I0OA 2H7OA 2YK0A 1KNPA 3A7MA 3N9PA 2VKDA 4ZS3A 3FZKB 3UFEA 2N1GA 4LMKA 2VL0A 5JVDE 2CE7A 2NTYA 3ZJ1A 3AA7B 3EUHA 2XPKA 4V1Av 2PTFA 4B3TT 2JQQA 3PUVF 1MMAA 2L8KA 3X1DA 3ZYLA 4X66T 4IE7A 4NUVA 4QXCB 3GA8A 1U5PA 2D9DA 2XQ8A 2JIWA 3H3AA 4IHJE 5AQGB 3RF1A 4AISA 4G63A 4YSZA 3IBPA 4OYJA 4EAHA 4B3RT 1H7CA 4UF0B 3AAEB 3OPCA 5ABHA 2RPAA 2XQ7A 4HFBA 4KUMB 1IAPA 2N9DA 2HPLA 2ODVA 3EDVA 3Q9DA 5LB7B 1ZEEA 5C2TA 3K8PC 1XNQT 2UU9T 2MOZA 4LF4T 1YD8G 2A2FX 1ZOYA 4IDZA 4KP3C 4PJJA 4PFOA 1XDPA 2XQ9A 3H37A 2BG9E 3AE8A 3C64A 3I1AA 4UIGA 5LNKA 2UXBT 3IA3A 2H3RA 4QXHB 2K24A 1WCRA 3KVAA 4Z91A 5AQIB 5LBMA 2EHOD 4KMCA 3MA9A 2KZ7B 2JQHA 3N2OA 2C0SA 4KX6A 5L3EB 2KT9A 2BDEA 3BK9A 2JJ9A 3IHRA 4WW0A 5DQVA 3K3QC 3PUAA 1V9DA 3LSVA 4XAXB 4U3CA 4ANJA 1UUSA 2K9AA 2LLYA 4ZI3C 4X1IE 1M62A 5HWXA 3T1YT 2V7IA 1MIWA 2E2AA 2BG9B 1QLBA 2G0UA 3PUWF 3UU8A 4COFA 5LA6E 5AQTB 1VRBA 3JC6D 4JI0T 5HEJA 3KBTA 4IDPA 5L47A 1KK7A 3AEGA 4CN6A 2WZHA 5HAXA 3SRZA 4ASKA 3QUJA 5AQKB 2CXDA 4AXPA 1VCTA 2BS3A 2HHHT 5HEOA 1T98A 3MJXA 2XAJB 4H9OC 3C4ZA 3HR0A 3NVOA 4HFIA 1B7TA 3ZPOA 5ETWA 3LFMA 2UXCT 4DR5T 3PUXF 4ZOLE 5LMNT 2MAWA 2CCQA 4IE0A 2NW8A 3VU7H 5L3FB 3RYCE 5AFUL 3ZMVB 2IHR1 1OEDC 4DMWA 1IJ6A 3CWZB 4I50E 4AQYT 1N36T 2LRLA 4DBQA 3WAJA 3P50A 4JYAT 1WR0A 3Q2MA 5LJMA 1HFAA 3UULA 5FXWA 4OK0A 3RX6A 4IDQA 5HWYA 2WU2A 5H6RB 5FY0A 4UEMA 2VB6A 4DO0A 3PURA 1CUNA 1G8XA 1CHUA 1OXZA 4F6RC 2ZM2A 3T1HT 4Z8XA 2YN6A 2J62A 2PBIA 2Y48B 2BVMA 3C98B 4MHCA 2OA5A 4C91A 4LF7T 3RC3A 4UV8B 2FJBA 5JDHA 4NXNT 4OFZA 3EAMA 4JI5T 1HS7A 2EHOC 4ZXLA 2WS3A 3ZJ2A 1QSDA 3TKLB 3ETUA 5HXRA 3SOLA 4A98A 2LKGA 4U2YA 2L9QA 3PE0A 4JEHB 4EYYR 3LBXA 4YHHT 1MNEA 1MIVA 5AQSB 3ZSTA 3C50A 5KX5E 3QB5K 2X9HA 4EZ4A 1ZHCA 3FXEB 2H7VC 2VURA 2CBIA 2I6HA 2XY8B 3ONJA 3Q5DA 4UXNB 5HCJA 5FVLA 4HGAA 2UXNB 2Y8DA 4YJ3E 5LP6E 5C3JA 3AEAA 2IAKA 2AXDS 3D0TA 3I9YA 4X1KE 2NW9A 5LXTE 2LOPA 3QC9A 2NR4A 3OTOT 3M3ZB 3F31A 3UT5E 3AE9A 3KV5A 2WWUA 2E8IA 4HN9A 4O4JE 3I9WA 1Z0PA 4UV9B 3ZYKA 4ADZA 2V1DB 2X0YA 5FMNA 3ONXA 2KNDA 1Y01A 3CX7B 4ZEYA 4UVBB 1WFDA 2XAQB 1W0BA 4GK5E 4O8SA 4YT0A 4ZI2C 1N34T 4JUYA 4E7SA 3FXDB 3KBUA 1Z8UA 3SWHA 4AQFA 5LGNB 2MBGA 4AKIA 3F2EA 3CKDA 1HNXT 3GWHA 2LHNA 3QK6A 3RKGA 3ZMZB 1J5WA 4UELA 2BS2A 1IZNB 1OEDA 3SFEA 4H9RC 2X51A 4TUYE 3AEFA 4ISTA 4CN1A 3TLSA 2XQ6A 2QVAA 5TAOA 2BKPA 2X9YA 4UVAB 2E9XD 3RIUA 3PJAA 4HWDA 4TWDA 2FJDA 3UTKA 4BAYB 1JNZA 2W66A 3CPZA 2FJAA 1LVFA 3A5XA 3EABA 3WAKA 4WYVA 3P4SA 2W2UA 4HFHA 3Q5WA 4LMLA 4TZ4C 4EOZB 4PJNA 3BQLA 4EB6E 2KSRA 3P4WA 5JDGA 1XMQT 3RRCA 2V7JA 4X20E 4BJNA 1FEWA 4B3ST 3AE3A 1MMDA 4F8HA 5F3JA 2E5VA 3I0QA 2ODUA 2DWGA 2WM9A 2SPCA 2XAFB 2CEAA 2XHEB 4HTEA 2EHOA 5FVKA 4DR6T 5AQJB 1UCUA 1XWMA 2V6YA 3JAFA 2V26A 5LCYA 4YSXA 5M4YA 1UX5A 2YU1A 4NUUA 4YY3T 2IMLA 4CI2B 5JQGE 2JMHA 3JCFA 1BR2A 1NEKA 4ERRA 1SA0E 3O9XA 4NPPA 2J1DG 1J1JA 5AQQB 1E7PA 2J4GA 2OLTA 3O4XE 3VR8A 5LG4A 3CX6B 3FZFB 2UUAT 4DR7T 1SE7A 3CQCB 4O2AE 1E1HB 1KEYA 2V6YB 2XSAA 2GK9A 4PFPA 4QX7B 3ZMUB 4IIJE 4DR2T 4CN4A 5HEUA 5JDLA 1D1CA 3N9NA 4PAGA 4HWHA 5EK3A 4WBNE 5LGUB 5A1LA 5EK2A 4U7IA 2CBJA 4KHZF 3AE5A 3RLFF 2BKNA 1E2AA 3AECA 3NWIA 4L5GA 1IBMT 1D0YA 1EZ3A 4JI4T 1W0AA 3PU8A 1QUUA 2CWYA 5AQMB 2WMOA 1KNZA 2CRBA 1W09A 4HFVA 2LSGA 4PJLA 4DR4T 1HX8A 1UURA 3S4UA 4GOUA 4AQFC 5IYZE 3EHZA 2WY2A 1HNZT 1Y64B 3VKGA 1N33T 2NTXA 4QWNB 5L4EA 3RYHE 1YKEB 2X68A 3K3OA 4AKHA 4WBOA 4HWIB 3N9MA 3RYIE 3O1HA 3P7IA 3GN5B 3RH3A 3UU3A 2V7MA 4QH4A 3DJBA 4UR9A 3SFDA 3VRAA 3AE2A 4CXWA 4DV7T 3PTRB 4I0UA 4I43B 4DBRA 4JI2T 4YTMA 3F57A 3ZYMA 2BBHA 4HWCA 3PUYF 5CFBA 4JI3T 4DMVA 2VKJA 2CMRA 1YQ4A 2DL1A 3KVBA 4NIQA 5HEGA 3ANWB 3ZN0B 4H9SE 4EYUA 4LMJA 3NBXX 2QGSA 3IEEA 1VCSA 3ANWA 5HXEA 3NRXA 4IE5A 2ZM6T 2C5IT 4ZS2A 3RI5A 2IC6A 4GIWA 4PNIA 3RGLA 2LRKA 2JMKA 4EIWA 3O1IA 2WU5A 4TWFA 4IL4A 3V5SA 3RKOA 4K0UA 1R8IA 4G2AA 5FL0A 2M6IA 3ZCJA 4DV5T 3UU5A 3AA0B 3FBZA 2KXPB 2LHRA 2LEHA 2N2NA 3ABVA 2DHRA 3LBXB 3UQ7A 1U4QA 2VKHA 2XQ4A 4ILBA 5ADXL 3HKCE 2Q9QC 1KFYA 3PJAJ 5IWAT 4B3MT 3JC6C 3TLTA 4U7YA 1D0XA 4KHPT 4P09A 4CQIA 1X79A 4UVCB 5CGMA 3CX8B 3AE4A 4X62T 3VKHA 1NENA 2KWHA 2XM1A 3LK3B 2WDQA 5JREA 4OX9T 3RYFE 2Q9QD 1N32T 4U2ZA 2HH7A 3LG7A 2MTQA 2XUEA 5LMUT 1BR4A 3L8RA 3B57A 2B1EA 2RP4A 1FMWA 2AE9A 3DTOA 4N78D 3CIRA 5AQRB 5FXXA 3M65A 2PG8A 4EEDA 2OV9A 2X66A 3AAIA 3E08A 4TV9E 2VWAA 3AB3B 3RQWA 3KDSE 4WZXA 1WYCA 2QA7A 3FHNA 3L09A 2I0MA 3DP7A 4YLHA 2JQ9A 2LOSA 3MZKB 4EV6A 3AAAB 3C51A 1HNWT 3N2GE 4JI6T 2BS4A 3OKQA 3FZHB 2I59A 1FIOA 2MPKA 1WLXA 2BBJA 3AXJA 3NZPA 5HYAA 2ACZA 4IREA 1J5ET 4HFCA 1WRDA 4PK4A 2LJLA 4GK0E 2WWVA 1O3XA 4ILAA 4YSYA 4WNKA 3ETVA 4ZZCA 2UXDT 2D0UA 3UUXB 2VKOA 3LK42 3PUGA 1XMOT 2DCFA 3CQGB 2MYSA 3ZMTB 1FMVA 5JDFA 1WR6A 1YQ3A 4UF0A 3L3PA 3EI0A 4MLKA 3UUMA 1DU2A 1NAFA 4QKNA 2LM9A 1ZP0A
chains in the Genus database with same CATH topology
1UGOA 5AQJB 5AQHB 1I6ZA 4HWFA 2D9DA 5AQGB 5AQSB 1M62A 5AQRB 1M7KA 4HWIB 5AQQB 1HX1B 1UK5A 3FZHB 3FZFB 5AQTB 3LDQB 3A8YC 4HWDA 5AQUB 4HWCA 5AQVB 5AQNB 4HWHA 1T7SA 3M3ZB 5AQFB 5AQKB 3FZLB 5AQLB 5AQIB 5AQMB 3FZKB 5AQOB 3FZMB 5AQPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGO A;  5AQJ B;  5AQH B;  1I6Z A;  4HWF A;  2D9D A;  5AQG B;  5AQS B;  1M62 A;  5AQR B;  1M7K A;  4HWI B;  5AQQ B;  1HX1 B;  1UK5 A;  3FZH B;  3FZF B;  5AQT B;  3LDQ B;  3A8Y C;  4HWD A;  5AQU B;  4HWC A;  5AQV B;  5AQN B;  4HWH A;  1T7S A;  3M3Z B;  5AQF B;  5AQK B;  3FZL B;  5AQL B;  5AQI B;  5AQM B;  3FZK B;  5AQO B;  3FZM B;  5AQP B; 
#chains in the Genus database with same CATH topology
 4QH1 A;  3ZT7 A;  2R6G F;  2WDV A;  3HA4 A;  3HKE E;  5HCM A;  5JTG A;  4DND A;  3LK2 B;  1MIY A;  2CLY C;  4DV0 T;  2M6B A;  4PJM A;  4HE8 A;  4DV6 T;  3AEB A;  1S35 A;  5HXS A;  2K3W A;  4JI7 T;  2WQY A;  1UK5 A;  3U3I A;  2XSB A;  4JI8 T;  2X9W A;  3MXZ A;  4YFS A;  1MND A;  3WI3 A;  5DJQ C;  4CI3 B;  3UFG A;  5CJ5 A;  1LKX A;  5AQU B;  3H3M A;  1L0V A;  4X1Y E;  2Q9Q B;  2X9X A;  2VVS A;  3MKD A;  5AQV B;  5FNV E;  2LSK A;  2NW7 A;  4IE6 A;  4X5T A;  3W15 B;  5J1G A;  3JAD A;  1XDO A;  3AE7 A;  3P4R A;  4HFE A;  4M1P A;  5EK4 A;  4BJM A;  1US7 B;  2CHO A;  5DAB A;  2IW5 B;  4MFR A;  4I4T E;  1GQE A;  5ABF B;  2P9B A;  3P4Q A;  4GYR A;  1ZV4 X;  3RPU A;  2LKH A;  3B5M A;  2CPT A;  3CQX C;  3V5U A;  3ZSS A;  1X9B A;  3FBL A;  2FUP A;  3BQK A;  3HI2 A;  4IL9 A;  2YIN A;  4JLE A;  3J9X 1;  3ZC1 A;  2VK9 A;  4IGU A;  5J2U E;  3AE1 A;  4NXM T;  4B6X A;  3EDU A;  2E9X A;  5JR9 A;  3MK7 C;  3Q5E A;  4O2B E;  3CVR A;  2KWI B;  3KV4 A;  1SUM B;  1UX4 A;  2NP9 A;  3QOF A;  4QHO A;  4GKK T;  2YDQ A;  5HEH A;  1W9R A;  5E0O A;  4IDN A;  4QH5 A;  3IF8 B;  3JAE A;  4LF5 T;  2IDO B;  5F5W A;  3AA6 B;  4CI1 B;  3J7Y q;  5F8P A;  1AJ3 A;  3UUN A;  2WDR A;  3ZT5 A;  5JDM A;  1YW0 A;  2LE8 A;  2DWK A;  2ZM8 A;  3N5L A;  3B13 A;  2CHN A;  2QYW A;  2PJQ A;  3LJC A;  4FJO A;  3K1S A;  2KLQ A;  4A56 A;  4YTN A;  4ZHQ E;  3ZN1 B;  5FL1 A;  3T8O A;  5HXH A;  1OED E;  3G06 A;  4DUZ T;  4X64 T;  3FZL B;  1BR0 A;  3NZQ A;  5AQL B;  5LBQ B;  5JRC A;  2BZB A;  4PW8 A;  2WMN A;  2EHO B;  2YDR A;  4P1N A;  2W61 A;  1I94 T;  2YDS A;  4L0R A;  1NWM X;  2M67 A;  2XQY A;  3L39 A;  4ISS A;  5AQP B;  2D5U A;  5AQH B;  2E9X C;  3PUZ F;  5JR9 C;  4DV4 T;  2DNX A;  1YKH B;  2ZLY A;  4ILU A;  1S94 A;  2C5K T;  2WAU A;  1HCI A;  2WSS V;  2CLY B;  2KIN B;  2XAS B;  3AED A;  4TX5 A;  2VQE T;  1HX1 B;  1JNR A;  2CA5 A;  3OYX A;  5GON E;  4EZH A;  3KV9 A;  5L3C B;  4AKG A;  4H63 V;  2X67 A;  4AIU A;  5L3G B;  4JEU B;  3E22 E;  4OYK A;  3RIA A;  1XZY A;  5C8Y E;  4X65 T;  4I55 E;  4Z90 A;  4XBF B;  2W67 A;  5AQN B;  2WP9 A;  1OWA A;  4ILC A;  3UQ4 A;  1OED B;  2UUC T;  3QB5 A;  3AEE A;  2J47 A;  3N2K E;  2W0G A;  2YEV C;  4DV2 T;  3ZCI A;  2Y6X A;  4GKJ T;  4ZI7 E;  3KV6 A;  4AKL A;  3PDY A;  5FP3 A;  5AQO B;  5LGT B;  2LSI A;  4DV3 T;  2HPJ A;  2K48 A;  3R84 B;  1UGO A;  2LM2 A;  3N9L A;  2V8S V;  2WZI A;  2W00 A;  1HF8 A;  4H63 H;  4P0B A;  4EEB A;  4ZI3 D;  3RIU C;  4HWF A;  4DR1 T;  3AVS A;  5JRC B;  2JQK A;  5IUX A;  4K0K T;  2XAG B;  4TV8 E;  1M7K A;  2BVL A;  2V6X A;  2W63 A;  3ZT6 A;  4CZZ B;  3UU4 A;  1ZKE A;  4MBQ A;  3E0Z A;  5FY1 A;  5H6Q B;  5ABE A;  4DR3 T;  1D1A A;  3A8Y C;  3LDQ B;  4PK6 A;  2Z6E A;  2BKO A;  4LF9 T;  2CM0 A;  5LOV E;  4TNV A;  4QXB B;  3P4P A;  3UUB A;  2W4X A;  5L3D B;  3PUS A;  1T7S A;  2XM2 A;  3R6N A;  3FB2 A;  3GMI A;  2K5B B;  4U31 A;  4GYS A;  3PUQ A;  4A97 A;  1WYB A;  4HFD A;  5J0Z A;  3NKZ A;  5DQW A;  3RC8 A;  3U78 A;  4A5X A;  2E9X B;  2NWB A;  1D0Z A;  4IE4 A;  5JR9 B;  3KFW X;  3O1J A;  1IBK T;  1IBL T;  1SHZ C;  2WBL A;  3KIN B;  1LRZ A;  2A3D A;  5KMG P;  4FI5 A;  1I6Z A;  3N9O A;  2WCA A;  2JRK A;  2BG9 A;  1IJ5 A;  2FBW A;  2E5L T;  4TWH A;  2V7K A;  3VHL A;  3PV0 F;  2ZMA A;  3NRY A;  5LHI B;  3TLU A;  4LFA T;  3VR9 A;  2XQ3 A;  4PK5 A;  1G73 A;  1T72 A;  3RIF A;  3AE6 A;  5FY7 A;  3TLW A;  4E7Z A;  5JDQ A;  4HKA A;  4YHJ A;  4XZC A;  2YKS A;  2NOX A;  2VVN A;  2LSJ A;  5FXV A;  4DV1 T;  3OJA A;  4KBM B;  3CK6 A;  1KNR A;  5L4H A;  2ES0 A;  4YTP A;  2XTL A;  2DI4 A;  3VRB A;  4EGW A;  5LYJ E;  2ZM0 A;  1MMG A;  5CA0 E;  2LSY A;  5CA1 E;  4Q25 A;  4L9I A;  2V7L A;  4U74 A;  3UU6 A;  4CXY A;  3OBV E;  5ABG A;  3P8C D;  5BMV E;  3GN5 A;  2LT3 A;  1HG2 A;  2FJE A;  3PU3 A;  3EVY A;  3RHW A;  5BR8 T;  2KMF A;  4EXT A;  3MAC A;  5HXC A;  4DUY T;  3ZKR A;  4O4L E;  2XZE A;  5JDN A;  3HL6 A;  3C4W A;  3Q5X A;  4JBW F;  4MAL A;  4IDO A;  3OVU A;  4TNW A;  4C90 A;  2XQA A;  3ZLI A;  2XAH B;  5CB4 E;  5LG3 A;  2IC9 A;  2B76 A;  4YJ2 E;  3ZEF B;  1MMN A;  1HG5 A;  3K3N A;  3ZMS B;  4H9N C;  3AA1 B;  5J2T E;  5FKY A;  3BQI A;  4LF8 T;  3AVR A;  2H88 A;  4TN7 B;  5JH7 E;  2W62 A;  5KDM C;  5KXJ A;  4P0A A;  4HEA A;  3TLV A;  2JPF A;  3OYZ A;  1XNR T;  5FYM A;  5AQF B;  3RQU A;  4LFC T;  2F4V T;  2DLR A;  5EZY E;  5LHG B;  4LF6 T;  3QNU A;  2YU2 A;  2ACX A;  4H9Q C;  5FXZ A;  4ZI2 D;  2V5C A;  2IIU A;  3ZC0 A;  2RA1 A;  2A72 A;  2CXL A;  1KF6 A;  4H9P C;  4IT4 A;  4DID B;  1T8B A;  1HTJ F;  2X0H A;  3FZM B;  5L2L A;  2VL8 A;  2IUB A;  3HKD E;  4O4H E;  4U33 A;  3ONL C;  2HN2 A;  2PFV A;  4BA9 A;  4JI1 T;  4J2C A;  2VAS A;  4YXD A;  1YXR A;  2BG9 C;  2X0L B;  2YOE A;  3HKB E;  3SS1 A;  3N9Q A;  2XQ5 A;  2WB5 A;  1D1B A;  3RRW A;  2CXF A;  4AQG A;  2H89 A;  1VOM A;  2L3L A;  2UUB T;  4JV5 T;  1LVK A;  2UXX B;  4KI0 F;  5IHY A;  3CML A;  4ZZB A;  5ABF A;  4AKR B;  2A9U A;  2CWO A;  4QX8 B;  1BR1 A;  5LHH B;  1HR0 T;  3AXJ B;  4LFB T;  4O4I E;  4DVD A;  2D2S A;  5L3B B;  4OHF A;  2C5J A;  2Q9Q A;  4AI6 A;  2D0T A;  2HN1 A;  2V5D A;  2VQF T;  1FJG T;  2XJ7 A;  4U72 A;  3ESL A;  3C4X A;  2QRX A;  4CXX A;  5LJN A;  3I0O A;  2H7O A;  2YK0 A;  1KNP A;  3A7M A;  3N9P A;  2VKD A;  4ZS3 A;  3FZK B;  3UFE A;  2N1G A;  4LMK A;  2VL0 A;  5JVD E;  2CE7 A;  2NTY A;  3ZJ1 A;  3AA7 B;  3EUH A;  2XPK A;  4V1A v;  2PTF A;  4B3T T;  2JQQ A;  3PUV F;  1MMA A;  2L8K A;  3X1D A;  3ZYL A;  4X66 T;  4IE7 A;  4NUV A;  4QXC B;  3GA8 A;  1U5P A;  2D9D A;  2XQ8 A;  2JIW A;  3H3A A;  4IHJ E;  5AQG B;  3RF1 A;  4AIS A;  4G63 A;  4YSZ A;  3IBP A;  4OYJ A;  4EAH A;  4B3R T;  1H7C A;  4UF0 B;  3AAE B;  3OPC A;  5ABH A;  2RPA A;  2XQ7 A;  4HFB A;  4KUM B;  1IAP A;  2N9D A;  2HPL A;  2ODV A;  3EDV A;  3Q9D A;  5LB7 B;  1ZEE A;  5C2T A;  3K8P C;  1XNQ T;  2UU9 T;  2MOZ A;  4LF4 T;  1YD8 G;  2A2F X;  1ZOY A;  4IDZ A;  4KP3 C;  4PJJ A;  4PFO A;  1XDP A;  2XQ9 A;  3H37 A;  2BG9 E;  3AE8 A;  3C64 A;  3I1A A;  4UIG A;  5LNK A;  2UXB T;  3IA3 A;  2H3R A;  4QXH B;  2K24 A;  1WCR A;  3KVA A;  4Z91 A;  5AQI B;  5LBM A;  2EHO D;  4KMC A;  3MA9 A;  2KZ7 B;  2JQH A;  3N2O A;  2C0S A;  4KX6 A;  5L3E B;  2KT9 A;  2BDE A;  3BK9 A;  2JJ9 A;  3IHR A;  4WW0 A;  5DQV A;  3K3Q C;  3PUA A;  1V9D A;  3LSV A;  4XAX B;  4U3C A;  4ANJ A;  1UUS A;  2K9A A;  2LLY A;  4ZI3 C;  4X1I E;  1M62 A;  5HWX A;  3T1Y T;  2V7I A;  1MIW A;  2E2A A;  2BG9 B;  1QLB A;  2G0U A;  3PUW F;  3UU8 A;  4COF A;  5LA6 E;  5AQT B;  1VRB A;  3JC6 D;  4JI0 T;  5HEJ A;  3KBT A;  4IDP A;  5L47 A;  1KK7 A;  3AEG A;  4CN6 A;  2WZH A;  5HAX A;  3SRZ A;  4ASK A;  3QUJ A;  5AQK B;  2CXD A;  4AXP A;  1VCT A;  2BS3 A;  2HHH T;  5HEO A;  1T98 A;  3MJX A;  2XAJ B;  4H9O C;  3C4Z A;  3HR0 A;  3NVO A;  4HFI A;  1B7T A;  3ZPO A;  5ETW A;  3LFM A;  2UXC T;  4DR5 T;  3PUX F;  4ZOL E;  5LMN T;  2MAW A;  2CCQ A;  4IE0 A;  2NW8 A;  3VU7 H;  5L3F B;  3RYC E;  5AFU L;  3ZMV B;  2IHR 1;  1OED C;  4DMW A;  1IJ6 A;  3CWZ B;  4I50 E;  4AQY T;  1N36 T;  2LRL A;  4DBQ A;  3WAJ A;  3P50 A;  4JYA T;  1WR0 A;  3Q2M A;  5LJM A;  1HFA A;  3UUL A;  5FXW A;  4OK0 A;  3RX6 A;  4IDQ A;  5HWY A;  2WU2 A;  5H6R B;  5FY0 A;  4UEM A;  2VB6 A;  4DO0 A;  3PUR A;  1CUN A;  1G8X A;  1CHU A;  1OXZ A;  4F6R C;  2ZM2 A;  3T1H T;  4Z8X A;  2YN6 A;  2J62 A;  2PBI A;  2Y48 B;  2BVM A;  3C98 B;  4MHC A;  2OA5 A;  4C91 A;  4LF7 T;  3RC3 A;  4UV8 B;  2FJB A;  5JDH A;  4NXN T;  4OFZ A;  3EAM A;  4JI5 T;  1HS7 A;  2EHO C;  4ZXL A;  2WS3 A;  3ZJ2 A;  1QSD A;  3TKL B;  3ETU A;  5HXR A;  3SOL A;  4A98 A;  2LKG A;  4U2Y A;  2L9Q A;  3PE0 A;  4JEH B;  4EYY R;  3LBX A;  4YHH T;  1MNE A;  1MIV A;  5AQS B;  3ZST A;  3C50 A;  5KX5 E;  3QB5 K;  2X9H A;  4EZ4 A;  1ZHC A;  3FXE B;  2H7V C;  2VUR A;  2CBI A;  2I6H A;  2XY8 B;  3ONJ A;  3Q5D A;  4UXN B;  5HCJ A;  5FVL A;  4HGA A;  2UXN B;  2Y8D A;  4YJ3 E;  5LP6 E;  5C3J A;  3AEA A;  2IAK A;  2AXD S;  3D0T A;  3I9Y A;  4X1K E;  2NW9 A;  5LXT E;  2LOP A;  3QC9 A;  2NR4 A;  3OTO T;  3M3Z B;  3F31 A;  3UT5 E;  3AE9 A;  3KV5 A;  2WWU A;  2E8I A;  4HN9 A;  4O4J E;  3I9W A;  1Z0P A;  4UV9 B;  3ZYK A;  4ADZ A;  2V1D B;  2X0Y A;  5FMN A;  3ONX A;  2KND A;  1Y01 A;  3CX7 B;  4ZEY A;  4UVB B;  1WFD A;  2XAQ B;  1W0B A;  4GK5 E;  4O8S A;  4YT0 A;  4ZI2 C;  1N34 T;  4JUY A;  4E7S A;  3FXD B;  3KBU A;  1Z8U A;  3SWH A;  4AQF A;  5LGN B;  2MBG A;  4AKI A;  3F2E A;  3CKD A;  1HNX T;  3GWH A;  2LHN A;  3QK6 A;  3RKG A;  3ZMZ B;  1J5W A;  4UEL A;  2BS2 A;  1IZN B;  1OED A;  3SFE A;  4H9R C;  2X51 A;  4TUY E;  3AEF A;  4IST A;  4CN1 A;  3TLS A;  2XQ6 A;  2QVA A;  5TAO A;  2BKP A;  2X9Y A;  4UVA B;  2E9X D;  3RIU A;  3PJA A;  4HWD A;  4TWD A;  2FJD A;  3UTK A;  4BAY B;  1JNZ A;  2W66 A;  3CPZ A;  2FJA A;  1LVF A;  3A5X A;  3EAB A;  3WAK A;  4WYV A;  3P4S A;  2W2U A;  4HFH A;  3Q5W A;  4LML A;  4TZ4 C;  4EOZ B;  4PJN A;  3BQL A;  4EB6 E;  2KSR A;  3P4W A;  5JDG A;  1XMQ T;  3RRC A;  2V7J A;  4X20 E;  4BJN A;  1FEW A;  4B3S T;  3AE3 A;  1MMD A;  4F8H A;  5F3J A;  2E5V A;  3I0Q A;  2ODU A;  2DWG A;  2WM9 A;  2SPC A;  2XAF B;  2CEA A;  2XHE B;  4HTE A;  2EHO A;  5FVK A;  4DR6 T;  5AQJ B;  1UCU A;  1XWM A;  2V6Y A;  3JAF A;  2V26 A;  5LCY A;  4YSX A;  5M4Y A;  1UX5 A;  2YU1 A;  4NUU A;  4YY3 T;  2IML A;  4CI2 B;  5JQG E;  2JMH A;  3JCF A;  1BR2 A;  1NEK A;  4ERR A;  1SA0 E;  3O9X A;  4NPP A;  2J1D G;  1J1J A;  5AQQ B;  1E7P A;  2J4G A;  2OLT A;  3O4X E;  3VR8 A;  5LG4 A;  3CX6 B;  3FZF B;  2UUA T;  4DR7 T;  1SE7 A;  3CQC B;  4O2A E;  1E1H B;  1KEY A;  2V6Y B;  2XSA A;  2GK9 A;  4PFP A;  4QX7 B;  3ZMU B;  4IIJ E;  4DR2 T;  4CN4 A;  5HEU A;  5JDL A;  1D1C A;  3N9N A;  4PAG A;  4HWH A;  5EK3 A;  4WBN E;  5LGU B;  5A1L A;  5EK2 A;  4U7I A;  2CBJ A;  4KHZ F;  3AE5 A;  3RLF F;  2BKN A;  1E2A A;  3AEC A;  3NWI A;  4L5G A;  1IBM T;  1D0Y A;  1EZ3 A;  4JI4 T;  1W0A A;  3PU8 A;  1QUU A;  2CWY A;  5AQM B;  2WMO A;  1KNZ A;  2CRB A;  1W09 A;  4HFV A;  2LSG A;  4PJL A;  4DR4 T;  1HX8 A;  1UUR A;  3S4U A;  4GOU A;  4AQF C;  5IYZ E;  3EHZ A;  2WY2 A;  1HNZ T;  1Y64 B;  3VKG A;  1N33 T;  2NTX A;  4QWN B;  5L4E A;  3RYH E;  1YKE B;  2X68 A;  3K3O A;  4AKH A;  4WBO A;  4HWI B;  3N9M A;  3RYI E;  3O1H A;  3P7I A;  3GN5 B;  3RH3 A;  3UU3 A;  2V7M A;  4QH4 A;  3DJB A;  4UR9 A;  3SFD A;  3VRA A;  3AE2 A;  4CXW A;  4DV7 T;  3PTR B;  4I0U A;  4I43 B;  4DBR A;  4JI2 T;  4YTM A;  3F57 A;  3ZYM A;  2BBH A;  4HWC A;  3PUY F;  5CFB A;  4JI3 T;  4DMV A;  2VKJ A;  2CMR A;  1YQ4 A;  2DL1 A;  3KVB A;  4NIQ A;  5HEG A;  3ANW B;  3ZN0 B;  4H9S E;  4EYU A;  4LMJ A;  3NBX X;  2QGS A;  3IEE A;  1VCS A;  3ANW A;  5HXE A;  3NRX A;  4IE5 A;  2ZM6 T;  2C5I T;  4ZS2 A;  3RI5 A;  2IC6 A;  4GIW A;  4PNI A;  3RGL A;  2LRK A;  2JMK A;  4EIW A;  3O1I A;  2WU5 A;  4TWF A;  4IL4 A;  3V5S A;  3RKO A;  4K0U A;  1R8I A;  4G2A A;  5FL0 A;  2M6I A;  3ZCJ A;  4DV5 T;  3UU5 A;  3AA0 B;  3FBZ A;  2KXP B;  2LHR A;  2LEH A;  2N2N A;  3ABV A;  2DHR A;  3LBX B;  3UQ7 A;  1U4Q A;  2VKH A;  2XQ4 A;  4ILB A;  5ADX L;  3HKC E;  2Q9Q C;  1KFY A;  3PJA J;  5IWA T;  4B3M T;  3JC6 C;  3TLT A;  4U7Y A;  1D0X A;  4KHP T;  4P09 A;  4CQI A;  1X79 A;  4UVC B;  5CGM A;  3CX8 B;  3AE4 A;  4X62 T;  3VKH A;  1NEN A;  2KWH A;  2XM1 A;  3LK3 B;  2WDQ A;  5JRE A;  4OX9 T;  3RYF E;  2Q9Q D;  1N32 T;  4U2Z A;  2HH7 A;  3LG7 A;  2MTQ A;  2XUE A;  5LMU T;  1BR4 A;  3L8R A;  3B57 A;  2B1E A;  2RP4 A;  1FMW A;  2AE9 A;  3DTO A;  4N78 D;  3CIR A;  5AQR B;  5FXX A;  3M65 A;  2PG8 A;  4EED A;  2OV9 A;  2X66 A;  3AAI A;  3E08 A;  4TV9 E;  2VWA A;  3AB3 B;  3RQW A;  3KDS E;  4WZX A;  1WYC A;  2QA7 A;  3FHN A;  3L09 A;  2I0M A;  3DP7 A;  4YLH A;  2JQ9 A;  2LOS A;  3MZK B;  4EV6 A;  3AAA B;  3C51 A;  1HNW T;  3N2G E;  4JI6 T;  2BS4 A;  3OKQ A;  3FZH B;  2I59 A;  1FIO A;  2MPK A;  1WLX A;  2BBJ A;  3AXJ A;  3NZP A;  5HYA A;  2ACZ A;  4IRE A;  1J5E T;  4HFC A;  1WRD A;  4PK4 A;  2LJL A;  4GK0 E;  2WWV A;  1O3X A;  4ILA A;  4YSY A;  4WNK A;  3ETV A;  4ZZC A;  2UXD T;  2D0U A;  3UUX B;  2VKO A;  3LK4 2;  3PUG A;  1XMO T;  2DCF A;  3CQG B;  2MYS A;  3ZMT B;  1FMV A;  5JDF A;  1WR6 A;  1YQ3 A;  4UF0 A;  3L3P A;  3EI0 A;  4MLK A;  3UUM A;  1DU2 A;  1NAF A;  4QKN A;  2LM9 A;  1ZP0 A; 
#chains in the Genus database with same CATH homology
 1UGO A;  5AQJ B;  5AQH B;  1I6Z A;  4HWF A;  2D9D A;  5AQG B;  5AQS B;  1M62 A;  5AQR B;  1M7K A;  4HWI B;  5AQQ B;  1HX1 B;  1UK5 A;  3FZH B;  3FZF B;  5AQT B;  3LDQ B;  3A8Y C;  4HWD A;  5AQU B;  4HWC A;  5AQV B;  5AQN B;  4HWH A;  1T7S A;  3M3Z B;  5AQF B;  5AQK B;  3FZL B;  5AQL B;  5AQI B;  5AQM B;  3FZK B;  5AQO B;  3FZM B;  5AQP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...