3FZKB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
111
structure length
111
Chain Sequence
b'GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 49
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzkB00
5AQPB 1M62A 5AQMB 3FZLB 5AQRB 4HWFA 3FZHB 5AQSB 5AQHB 3A8YC 1UGOA 3FZFB 5AQGB 1UK5A 5AQTB 4HWDA 2D9DA 5AQKB 1I6ZA 5AQQB 5AQVB 4HWCA 1M7KA 3FZMB 5AQFB 5AQIB 1T7SA 4HWHA 5AQNB 3LDQB 3FZKB 3M3ZB 4HWIB 5AQUB 5AQJB 5AQOB 1HX1B 5AQLB
chains in the Genus database with same CATH superfamily
2IAKA 1VCTA 2DHRA 2MTQA 3K8PC 2V8SV 3FZFB 3AE9A 3AEGA 3NKZA 3NZPA 3OVUA 1OEDE 4CXYA 1S35A 3PJAA 2CXLA 1UGOA 3I0QA 2V6YB 5AQQB 2JQ9A 5LBMA 3AE1A 3SOLA 3ZEFB 5KDMC 1UCUA 2LOPA 1M62A 4FJOA 2W67A 5FMNA 2JMKA 2BVLA 2DWGA 4EV6A 5H6RB 3FXDB 4WBOA 1EZ3A 4ZZBA 5CA0E 1T7SA 2WZHA 3RQWA 3UQ7A 3HR0A 5AQOB 1IZNB 3CX7B 5JDLA 2W62A 2IC6A 3EDUA 1SHZC 1J5ET 5CGMA 4GKKT 5AQGB 4KMCA 4PK4A 4UVAB 4M1PA 4CI1B 4UXNB 3LDQB 5J1GA 3RYHE 5H6QB 3Q9DA 5HXSA 3N9QA 2X9XA 4UV9B 3L09A 4JI4T 4H63V 3C64A 3ZSSA 4DV5T 3M65A 3CK6A 3C4ZA 5HXHA 3PU8A 3ZSTA 4KHZF 2WS3A 1YXRA 4QWNB 2LSIA 2X0YA 3ETUA 3ANWB 3R84B 4A98A 2XJ7A 3TLUA 2BG9E 3RIUA 1BR2A 2J47A 3CVRA 1SE7A 3R6NA 4GYRA 1KNZA 2LHRA 2YINA 4YTPA 4GIWA 3L3PA 4NUUA 3ZT5A 3AEAA 3S4UA 4A5XA 5DQVA 2ZM0A 5J0ZA 2XY8B 2E9XA 4TUYE 1WLXA 2QA7A 3QC9A 4HFBA 5IHYA 5AQTB 1YD8G 4YT0A 4Z90A 1W0BA 2QGSA 1IJ6A 2Y48B 4CN1A 3HL6A 4ISSA 3N2OA 3PUVF 5HWXA 3UU6A 1GQEA 2LJLA 1XMOT 5L3GB 2V5CA 2XQ4A 2J4GA 2KINB 2WY2A 3B5MA 4LFAT 2RPAA 4PW8A 2MAWA 2CHOA 4JYAT 5LHHB 3ZN1B 2KMFA 2BS2A 4DMVA 2CWYA 3K1SA 5FYMA 2Y6XA 2IMLA 3KBTA 3TKLB 1DU2A 1FMVA 1ZP0A 3AXJA 4X1KE 1Z0PA 3T1YT 4ADZA 5LNKA 5GONE 5LHGB 5CFBA 2KLQA 1XNRT 1WR6A 2XSBA 5E0OA 2CE7A 5TAOA 4ZZCA 2VKHA 3OPCA 5ADXL 2W2UA 2K24A 5JREA 3RX6A 4ASKA 4DIDB 3O4XE 2XM2A 4QHOA 3MKDA 2VKOA 3CPZA 4MBQA 2PJQA 4UR9A 1LRZA 3BQIA 4O4HE 4E7SA 3GMIA 4EEBA 2OA5A 3AA0B 2WAUA 2XSAA 2V7MA 4OYJA 3ZC1A 4HWDA 2HPJA 2X9WA 2D5UA 5LCYA 1FIOA 1D1AA 3GN5A 3UTKA 4HWIB 2X67A 2XZEA 2NW9A 3OTOT 2XUEA 5JDGA 4A97A 4LF6T 2XAFB 3KBUA 2DNXA 3RQUA 2HHHT 2HH7A 4UELA 4DV6T 1NAFA 4ERRA 5JVDE 3A5XA 3RPUA 4JI8T 5LYJE 3EVYA 4Z8XA 3QB5K 4GYSA 3FB2A 5JDNA 2PBIA 2A72A 3V5SA 2UXDT 4IHJE 5BMVE 2A9UA 4IIJE 1S94A 3P8CD 4NIQA 3N9LA 2M6IA 5FVKA 3OYZA 3CKDA 4QXBB 4EB6E 3I1AA 5AQHB 1OEDB 1VCSA 4IE6A 3T8OA 4ZHQE 3H37A 1IBLT 3MA9A 3AEBA 4AXPA 2NR4A 4XZCA 2CMRA 3F31A 3A7MA 3MZKB 3AEDA 5JTGA 1N33T 1R8IA 1QUUA 1W0AA 2CA5A 4JI2T 5C2TA 3MK7C 2XQ6A 2KWHA 4OX9T 3UU5A 3WAJA 4X1IE 5L3EB 4TV8E 4HFIA 4TV9E 2LSKA 4C91A 1M7KA 3Q5WA 1UUSA 3F2EA 3RIFA 2WM9A 2LRLA 3NRXA 2QRXA 3LK42 4X64T 2N9DA 2LEHA 2N1GA 2WWVA 2YDRA 4ZOLE 4IDZA 4KI0F 1E7PA 1XWMA 4ZI7E 4COFA 3AA1B 4ZEYA 3CQGB 1U5PA 3PUGA 3SRZA 4JV5T 4UVCB 5FXVA 1T98A 1W09A 1YW0A 1ZKEA 2VB6A 1MIYA 3ZCJA 2CRBA 3LBXA 2VKJA 2XAJB 3Q2MA 5HEOA 2WDQA 4LMJA 3NBXX 3RRWA 2BG9B 2NOXA 2J62A 3LFMA 5AQPB 1U4QA 1VRBA 3HKDE 4AISA 4HWFA 5FXXA 2K9AA 2DCFA 1ZHCA 3UU3A 4HWCA 4AKIA 3F57A 2CHNA 4IDNA 3IA3A 1HNWT 4DR2T 3PUYF 3M3ZB 3N2GE 2WZIA 4DUZT 4DV3T 1MMDA 4U7IA 4TX5A 2BZBA 1I94T 3T1HT 1MMAA 5JRCA 3ZYMA 1OEDC 3JCFA 4U7YA 4I55E 2I59A 3RC3A 2LHNA 1YQ3A 4L9IA 1L0VA 5L4EA 5LOVE 4X20E 2UXNB 3AE6A 2Q9QA 4CXWA 3KINB 3L8RA 3TLSA 5HEGA 2EHOA 3NWIA 3VRAA 1E2AA 1BR0A 2CLYB 2CXDA 1XDOA 2FJAA 5BR8T 1WCRA 3RRCA 2YU2A 2V7LA 1N34T 4GOUA 4UF0B 3FZHB 3ZT7A 5IYZE 3PU3A 3WAKA 4G63A 1HS7A 1H7CA 3DJBA 4H9OC 2BBHA 5AQJB 2XQ9A 1JNRA 4HKAA 3UFEA 1MMNA 1D1BA 2E9XB 4WW0A 2L9QA 4JEUB 5FP3A 1ZEEA 2XAGB 3FHNA 4X65T 2D9DA 3RF1A 4YXDA 2FJEA 2UU9T 2UXCT 2BBJA 4JI7T 3SFDA 2ZMAA 1BR1A 2LT3A 2H7OA 4IDOA 4GKJT 2MPKA 5L3BB 3CWZB 1SA0E 4LF5T 4P09A 5LMUT 3K3OA 4C90A 3P4SA 5CB4E 5DJQC 2P9BA 4LMLA 2BG9C 3PURA 3NVOA 2BS4A 3EI0A 2LE8A 4XAXB 2W66A 2UXBT 2XM1A 3VHLA 2ZM6T 5CA1E 4CZZB 4O4JE 2FUPA 3QOFA 2QYWA 2WDRA 3ONXA 5HWYA 4CN4A 3L39A 4H9SE 3BQLA 1CUNA 3UUXB 4KUMB 3H3MA 1WR0A 4HGAA 4DR5T 1KNPA 5LGNB 3AXJB 2LM9A 3NZQA 1WRDA 2JQKA 3Q5EA 4PK5A 2M67A 4KP3C 4HEAA 3I0OA 1CHUA 2PG8A 4XBFB 1QSDA 1XMQT 4IE0A 4EZHA 1G8XA 2QVAA 3U78A 2DWKA 3IF8B 1N36T 1XZYA 5EZYE 1T8BA 4ILBA 3KV6A 4PNIA 4QX8B 3RIUC 3FZKB 2CLYC 1BR4A 4KX6A 3ZMZB 5ABFA 2BKNA 4WZXA 1D0YA 5FNVE 1ZV4X 5LP6E 1ZOYA 1X9BA 2PFVA 3LG7A 2Y8DA 3B57A 3ZN0B 2WWUA 4TWFA 3KDSE 4PAGA 4YSYA 3P4PA 1WFDA 3PDYA 3GN5B 2E9XD 4ZI2C 4LF4T 3AE3A 2PTFA 5KX5E 3N9PA 2E9XC 5JQGE 2A3DA 4YHHT 2WU2A 2HN2A 2L8KA 2NW8A 4YFSA 4I4TE 4EOZB 3UUNA 4O4IE 4EYYR 3X1DA 4WYVA 4ZS3A 4JBWF 2H3RA 4ZI3C 1US7B 4JI3T 1FMWA 4P0AA 4CI2B 3ZPOA 5AQMB 5LGTB 5FY1A 5C8YE 3VR8A 5HYAA 4AQFA 2I0MA 5FL0A 4JI0T 2WDVA 4BJNA 2XQAA 3VU7H 3ZMSB 2VL0A 3HI2A 3ESLA 2X9HA 2BKPA 2FJDA 3AB3B 3DTOA 4X62T 4YLHA 2ACXA 5J2UE 4X5TA 4IDQA 1OWAA 2KT9A 3MACA 2IW5B 4B3TT 2XAHB 4UV8B 5JDFA 2V6XA 3AA6B 2OLTA 2LSGA 3AE7A 5EK4A 3CIRA 3OKQA 2IHR1 2BS3A 2K48A 4YSZA 3N9NA 2BVMA 3QUJA 4WNKA 4CXXA 4UEMA 3RYIE 2X66A 3PUXF 4G2AA 5L3DB 2W4XA 1NWMX 2ZLYA 3UUBA 1OXZA 2NW7A 5LGUB 3HA4A 2WQYA 4DMWA 2WP9A 3N9MA 2UUBT 2YOEA 4GK5E 5LJMA 5HCMA 1HX8A 3C4WA 4PK6A 1WYCA 3ABVA 5ABHA 4DR7T 2HN1A 3KV5A 4IGUA 3UT5E 2DLRA 4ZXLA 3RGLA 4NPPA 3O1HA 4DV4T 5F5WA 2LKGA 2VQFT 4H9QC 4MHCA 4I43B 2LSYA 3AVSA 2C5IT 3BK9A 2IDOB 5JR9A 4MLKA 4U3CA 1B7TA 3LBXB 2WB5A 4U2ZA 5EK2A 4NUVA 4U72A 3ZCIA 5LJNA 4IE5A 3WI3A 2LSJA 3TLVA 5LXTE 2C5JA 5L47A 2BKOA 4HFDA 1NEKA 4YTMA 1X79A 4MFRA 3UULA 2UUCT 2SPCA 4LF7T 4QH5A 1MIVA 4HFCA 3DP7A 1KNRA 4X1YE 2X0LB 5L3FB 3ONLC 4H9NC 4P0BA 2CXFA 4YHJA 2W61A 3ZMVB 5HXRA 3RC8A 4F8HA 4YSXA 3VR9A 5JDMA 4IL9A 5L2LA 3ZJ1A 5J2TE 3C4XA 1HR0T 4TWHA 4MALA 4DV0T 2LM2A 5AQKB 4K0KT 2Q9QB 4OK0A 4JI5T 3UU4A 3RIAA 4BJMA 2EHOB 2CWOA 2VASA 3ZJ2A 4ILUA 1IAPA 3HKCE 4O4LE 3K3QC 2DI4A 2YKSA 2ZM8A 4CQIA 5F3JA 1MNEA 2I6HA 4AKRB 1FEWA 3K3NA 1J1JA 1XDPA 2YK0A 4DVDA 4ANJA 3JAEA 4ZS2A 2RP4A 3N2KE 2K5BB 2MYSA 2CPTA 4U74A 3KV9A 5FXZA 4AKLA 3FXEB 2B76A 1I6ZA 2X51A 3E08A 4PJJA 5AQFB 1YQ4A 3EUHA 3VRBA 1HX1B 2LOSA 3V5UA 4AKHA 5LMNT 3UUMA 2WU5A 1JNZA 2W00A 3RI5A 2FJBA 5HCJA 2LLYA 1D1CA 2ACZA 3AAEB 2VKDA 1HF8A 2V26A 1LKXA 1HTJF 3GA8A 2J1DG 1E1HB 3D0TA 3AECA 3PUAA 4ILAA 3ETVA 2D0TA 5FY0A 4QKNA 2CM0A 2R6GF 4E7ZA 2Z6EA 1YKHB 4B6XA 3CMLA 1HNZT 2E5VA 4L5GA 2JPFA 1IJ5A 3AVRA 2WMOA 1IBMT 2W0GA 3HKEE 4TWDA 3N9OA 4DR6T 2IUBA 3KVAA 3J7Yq 4K0UA 3QB5A 3KVBA 3W15B 4JUYA 5KMGP 5L4HA 2VWAA 4AIUA 2Q9QD 4PFOA 3MXZA 3PUQA 2EHOD 2Q9QC 2BG9A 4U2YA 1YKEB 4J2CA 3ZKRA 2EHOC 4ILCA 4CI3B 1KK7A 3SS1A 4BA9A 4O2AE 2HPLA 5FVLA 5CJ5A 3EAMA 4A56A 3KFWX 3FZLB 5ABFB 4Z91A 2NTXA 1UX5A 2KSRA 3LK2B 5JDHA 3ZC0A 2JMHA 4TZ4C 2L3LA 3G06A 4L0RA 4OHFA 3EHZA 4I50E 4YTNA 4DV1T 2ZM2A 1LVKA 3Q5DA 4OYKA 1FJGT 4EXTA 4FI5A 3IEEA 4U33A 2XHEB 2FBWA 5DABA 5C3JA 4N78D 3MJXA 5AQUB 1T72A 4IDPA 5HAXA 5JH7E 3U3IA 3PUSA 2UXXB 2V6YA 4AQYT 1KF6A 4QH4A 3AE8A 4B3ST 4DR4T 5HEUA 2NWBA 3P4RA 4IREA 3ONJA 4PJMA 2V5DA 4DUYT 5ABGA 1O3XA 1D0ZA 4UF0A 2CBJA 3CX6B 4PJNA 4QXHB 4B3MT 4TNVA 3AAAB 2E2AA 3QNUA 3FZMB 2X0HA 5EK3A 2XQ8A 4X66T 4HE8A 5AQNB 3E22E 2XQ3A 2CCQA 4EAHA 4EGWA 2XQ5A 4JI1T 3EABA 2CEAA 5AFUL 3ZYLA 3LSVA 4QH1A 2KNDA 3LJCA 2XPKA 4HTEA 4ZI2D 5HEJA 1NENA 3RHWA 2X68A 5LG3A 2NTYA 1N32T 1MMGA 4TNWA 2C5KT 1VOMA 2X9YA 1XNQT 5A1LA 5LB7B 3AE4A 2BDEA 4DR3T 2DL1A 2LRKA 4ZI3D 4V1Av 5IWAT 5KXJA 3UQ4A 3AE2A 2XAQB 4DBRA 3ANWA 4Q25A 1HFAA 1UURA 5FL1A 2XQYA 3LK3B 1WYBA 4JLEA 5F8PA 2ES0A 4JEHB 3P50A 1SUMB 2JQQA 4UIGA 3ZMTB 3RKOA 4CN6A 5L3CB 4LFCT 2D2SA 1HG2A 3QK6A 1J5WA 5IUXA 4EIWA 2VQET 2XTLA 3RYFE 2ODUA 2V7JA 5FXWA 3C98B 1IBKT 3RLFF 3AAIA 5JR9B 1MIWA 2UUAT 1UX4A 2YEVC 3VKGA 5AQSB 3FBLA 3A8YC 3GWHA 4QXCB 4EEDA 3O9XA 4AQFC 5JDQA 3RH3A 3KV4A 3O1IA 4HWHA 3NRYA 3TLTA 3J9X1 3AEEA 5DQWA 4TN7B 2G0UA 4DR1T 3PUZF 4AQGA 3ZYKA 4HN9A 4IE4A 3AE5A 1HCIA 5LBQB 2VL8A 2NP9A 3E0ZA 4U31A 4YY3T 2V1DB 1LVFA 2V7KA 1Z8UA 5HEHA 2ODVA 2VK9A 4LF9T 3Q5XA 2IIUA 1UK5A 5HXEA 4DNDA 4KBMB 2H89A 2C0SA 4NXNT 2E5LT 4LFBT 4GK0E 2JIWA 2WSSV 1KFYA 3AEFA 2KZ7B 2OV9A 3H3AA 5M4YA 3EDVA 3ZMUB 2WCAA 3JADA 2LKHA 4BAYB 2H7VC 3JAFA 3JC6D 4ISTA 2YDQA 1KEYA 3PTRB 4H9RC 3JC6C 4OFZA 2XASB 3OBVE 2D0UA 3SWHA 3ZLIA 5HXCA 2V7IA 2MBGA 3P7IA 2MOZA 5ABEA 1HG5A 4H9PC 4DO0A 2H88A 4EYUA 5FKYA 3PE0A 2N2NA 4F6RC 5AQRB 4LF8T 3VKHA 3O1JA 4PJLA 2E8IA 2VVSA 3I9YA 4H63H 5JRCB 4HFEA 3UU8A 1Y01A 5AQIB 3PV0F 3OYXA 1W9RA 5JR9C 1MNDA 3P4QA 4YJ2E 3CQCB 4JI6T 4KHPT 4EZ4A 2AE9A 2WBLA 3N5LA 5ETWA 2W63A 1AJ3A 3ZT6A 3IHRA 2AXDS 3RKGA 4YJ3E 3PUWF 3CX8B 1V9DA 2B1EA 4QX7B 5LHIB 5FY7A 4PFPA 2JQHA 4IL4A 4I0UA 4IT4A 2XQ7A 4UVBB 3HKBE 4AKGA 4DV2T 2M6BA 4DBQA 4P1NA 2VVNA 3OJAA 4O2BE 1D0XA 2KXPB 2VURA 4HFVA 5AQLB 4B3RT 4WBNE 4AI6A 1OEDA 2JJ9A 2JRKA 2F4VT 3I9WA 1G73A 3C50A 5LG4A 5AQVB 2YDSA 2CBIA 3P4WA 3CQXC 1QLBA 2YN6A 2KWIB 1HNXT 3PJAJ 3UFGA 3FBZA 3SFEA 2YU1A 3TLWA 4HFHA 3IBPA 4NXMT 2K3WA 2GK9A 3AA7B 3RYCE 3C51A 2RA1A 2IC9A 4IE7A 3BQKA 4LMKA 1Y64B 2WMNA 4DV7T 5LA6E 3B13A 4O8SA 2A2FX
chains in the Genus database with same CATH topology
5AQPB 1M62A 5AQMB 3FZLB 5AQRB 4HWFA 3FZHB 5AQSB 5AQHB 3A8YC 1UGOA 3FZFB 5AQGB 1UK5A 5AQTB 4HWDA 2D9DA 5AQKB 1I6ZA 5AQQB 5AQVB 4HWCA 1M7KA 3FZMB 5AQFB 5AQIB 1T7SA 4HWHA 5AQNB 3LDQB 3FZKB 3M3ZB 4HWIB 5AQUB 5AQJB 5AQOB 1HX1B 5AQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQP B;  1M62 A;  5AQM B;  3FZL B;  5AQR B;  4HWF A;  3FZH B;  5AQS B;  5AQH B;  3A8Y C;  1UGO A;  3FZF B;  5AQG B;  1UK5 A;  5AQT B;  4HWD A;  2D9D A;  5AQK B;  1I6Z A;  5AQQ B;  5AQV B;  4HWC A;  1M7K A;  3FZM B;  5AQF B;  5AQI B;  1T7S A;  4HWH A;  5AQN B;  3LDQ B;  3FZK B;  3M3Z B;  4HWI B;  5AQU B;  5AQJ B;  5AQO B;  1HX1 B;  5AQL B; 
#chains in the Genus database with same CATH topology
 2IAK A;  1VCT A;  2DHR A;  2MTQ A;  3K8P C;  2V8S V;  3FZF B;  3AE9 A;  3AEG A;  3NKZ A;  3NZP A;  3OVU A;  1OED E;  4CXY A;  1S35 A;  3PJA A;  2CXL A;  1UGO A;  3I0Q A;  2V6Y B;  5AQQ B;  2JQ9 A;  5LBM A;  3AE1 A;  3SOL A;  3ZEF B;  5KDM C;  1UCU A;  2LOP A;  1M62 A;  4FJO A;  2W67 A;  5FMN A;  2JMK A;  2BVL A;  2DWG A;  4EV6 A;  5H6R B;  3FXD B;  4WBO A;  1EZ3 A;  4ZZB A;  5CA0 E;  1T7S A;  2WZH A;  3RQW A;  3UQ7 A;  3HR0 A;  5AQO B;  1IZN B;  3CX7 B;  5JDL A;  2W62 A;  2IC6 A;  3EDU A;  1SHZ C;  1J5E T;  5CGM A;  4GKK T;  5AQG B;  4KMC A;  4PK4 A;  4UVA B;  4M1P A;  4CI1 B;  4UXN B;  3LDQ B;  5J1G A;  3RYH E;  5H6Q B;  3Q9D A;  5HXS A;  3N9Q A;  2X9X A;  4UV9 B;  3L09 A;  4JI4 T;  4H63 V;  3C64 A;  3ZSS A;  4DV5 T;  3M65 A;  3CK6 A;  3C4Z A;  5HXH A;  3PU8 A;  3ZST A;  4KHZ F;  2WS3 A;  1YXR A;  4QWN B;  2LSI A;  2X0Y A;  3ETU A;  3ANW B;  3R84 B;  4A98 A;  2XJ7 A;  3TLU A;  2BG9 E;  3RIU A;  1BR2 A;  2J47 A;  3CVR A;  1SE7 A;  3R6N A;  4GYR A;  1KNZ A;  2LHR A;  2YIN A;  4YTP A;  4GIW A;  3L3P A;  4NUU A;  3ZT5 A;  3AEA A;  3S4U A;  4A5X A;  5DQV A;  2ZM0 A;  5J0Z A;  2XY8 B;  2E9X A;  4TUY E;  1WLX A;  2QA7 A;  3QC9 A;  4HFB A;  5IHY A;  5AQT B;  1YD8 G;  4YT0 A;  4Z90 A;  1W0B A;  2QGS A;  1IJ6 A;  2Y48 B;  4CN1 A;  3HL6 A;  4ISS A;  3N2O A;  3PUV F;  5HWX A;  3UU6 A;  1GQE A;  2LJL A;  1XMO T;  5L3G B;  2V5C A;  2XQ4 A;  2J4G A;  2KIN B;  2WY2 A;  3B5M A;  4LFA T;  2RPA A;  4PW8 A;  2MAW A;  2CHO A;  4JYA T;  5LHH B;  3ZN1 B;  2KMF A;  2BS2 A;  4DMV A;  2CWY A;  3K1S A;  5FYM A;  2Y6X A;  2IML A;  3KBT A;  3TKL B;  1DU2 A;  1FMV A;  1ZP0 A;  3AXJ A;  4X1K E;  1Z0P A;  3T1Y T;  4ADZ A;  5LNK A;  5GON E;  5LHG B;  5CFB A;  2KLQ A;  1XNR T;  1WR6 A;  2XSB A;  5E0O A;  2CE7 A;  5TAO A;  4ZZC A;  2VKH A;  3OPC A;  5ADX L;  2W2U A;  2K24 A;  5JRE A;  3RX6 A;  4ASK A;  4DID B;  3O4X E;  2XM2 A;  4QHO A;  3MKD A;  2VKO A;  3CPZ A;  4MBQ A;  2PJQ A;  4UR9 A;  1LRZ A;  3BQI A;  4O4H E;  4E7S A;  3GMI A;  4EEB A;  2OA5 A;  3AA0 B;  2WAU A;  2XSA A;  2V7M A;  4OYJ A;  3ZC1 A;  4HWD A;  2HPJ A;  2X9W A;  2D5U A;  5LCY A;  1FIO A;  1D1A A;  3GN5 A;  3UTK A;  4HWI B;  2X67 A;  2XZE A;  2NW9 A;  3OTO T;  2XUE A;  5JDG A;  4A97 A;  4LF6 T;  2XAF B;  3KBU A;  2DNX A;  3RQU A;  2HHH T;  2HH7 A;  4UEL A;  4DV6 T;  1NAF A;  4ERR A;  5JVD E;  3A5X A;  3RPU A;  4JI8 T;  5LYJ E;  3EVY A;  4Z8X A;  3QB5 K;  4GYS A;  3FB2 A;  5JDN A;  2PBI A;  2A72 A;  3V5S A;  2UXD T;  4IHJ E;  5BMV E;  2A9U A;  4IIJ E;  1S94 A;  3P8C D;  4NIQ A;  3N9L A;  2M6I A;  5FVK A;  3OYZ A;  3CKD A;  4QXB B;  4EB6 E;  3I1A A;  5AQH B;  1OED B;  1VCS A;  4IE6 A;  3T8O A;  4ZHQ E;  3H37 A;  1IBL T;  3MA9 A;  3AEB A;  4AXP A;  2NR4 A;  4XZC A;  2CMR A;  3F31 A;  3A7M A;  3MZK B;  3AED A;  5JTG A;  1N33 T;  1R8I A;  1QUU A;  1W0A A;  2CA5 A;  4JI2 T;  5C2T A;  3MK7 C;  2XQ6 A;  2KWH A;  4OX9 T;  3UU5 A;  3WAJ A;  4X1I E;  5L3E B;  4TV8 E;  4HFI A;  4TV9 E;  2LSK A;  4C91 A;  1M7K A;  3Q5W A;  1UUS A;  3F2E A;  3RIF A;  2WM9 A;  2LRL A;  3NRX A;  2QRX A;  3LK4 2;  4X64 T;  2N9D A;  2LEH A;  2N1G A;  2WWV A;  2YDR A;  4ZOL E;  4IDZ A;  4KI0 F;  1E7P A;  1XWM A;  4ZI7 E;  4COF A;  3AA1 B;  4ZEY A;  3CQG B;  1U5P A;  3PUG A;  3SRZ A;  4JV5 T;  4UVC B;  5FXV A;  1T98 A;  1W09 A;  1YW0 A;  1ZKE A;  2VB6 A;  1MIY A;  3ZCJ A;  2CRB A;  3LBX A;  2VKJ A;  2XAJ B;  3Q2M A;  5HEO A;  2WDQ A;  4LMJ A;  3NBX X;  3RRW A;  2BG9 B;  2NOX A;  2J62 A;  3LFM A;  5AQP B;  1U4Q A;  1VRB A;  3HKD E;  4AIS A;  4HWF A;  5FXX A;  2K9A A;  2DCF A;  1ZHC A;  3UU3 A;  4HWC A;  4AKI A;  3F57 A;  2CHN A;  4IDN A;  3IA3 A;  1HNW T;  4DR2 T;  3PUY F;  3M3Z B;  3N2G E;  2WZI A;  4DUZ T;  4DV3 T;  1MMD A;  4U7I A;  4TX5 A;  2BZB A;  1I94 T;  3T1H T;  1MMA A;  5JRC A;  3ZYM A;  1OED C;  3JCF A;  4U7Y A;  4I55 E;  2I59 A;  3RC3 A;  2LHN A;  1YQ3 A;  4L9I A;  1L0V A;  5L4E A;  5LOV E;  4X20 E;  2UXN B;  3AE6 A;  2Q9Q A;  4CXW A;  3KIN B;  3L8R A;  3TLS A;  5HEG A;  2EHO A;  3NWI A;  3VRA A;  1E2A A;  1BR0 A;  2CLY B;  2CXD A;  1XDO A;  2FJA A;  5BR8 T;  1WCR A;  3RRC A;  2YU2 A;  2V7L A;  1N34 T;  4GOU A;  4UF0 B;  3FZH B;  3ZT7 A;  5IYZ E;  3PU3 A;  3WAK A;  4G63 A;  1HS7 A;  1H7C A;  3DJB A;  4H9O C;  2BBH A;  5AQJ B;  2XQ9 A;  1JNR A;  4HKA A;  3UFE A;  1MMN A;  1D1B A;  2E9X B;  4WW0 A;  2L9Q A;  4JEU B;  5FP3 A;  1ZEE A;  2XAG B;  3FHN A;  4X65 T;  2D9D A;  3RF1 A;  4YXD A;  2FJE A;  2UU9 T;  2UXC T;  2BBJ A;  4JI7 T;  3SFD A;  2ZMA A;  1BR1 A;  2LT3 A;  2H7O A;  4IDO A;  4GKJ T;  2MPK A;  5L3B B;  3CWZ B;  1SA0 E;  4LF5 T;  4P09 A;  5LMU T;  3K3O A;  4C90 A;  3P4S A;  5CB4 E;  5DJQ C;  2P9B A;  4LML A;  2BG9 C;  3PUR A;  3NVO A;  2BS4 A;  3EI0 A;  2LE8 A;  4XAX B;  2W66 A;  2UXB T;  2XM1 A;  3VHL A;  2ZM6 T;  5CA1 E;  4CZZ B;  4O4J E;  2FUP A;  3QOF A;  2QYW A;  2WDR A;  3ONX A;  5HWY A;  4CN4 A;  3L39 A;  4H9S E;  3BQL A;  1CUN A;  3UUX B;  4KUM B;  3H3M A;  1WR0 A;  4HGA A;  4DR5 T;  1KNP A;  5LGN B;  3AXJ B;  2LM9 A;  3NZQ A;  1WRD A;  2JQK A;  3Q5E A;  4PK5 A;  2M67 A;  4KP3 C;  4HEA A;  3I0O A;  1CHU A;  2PG8 A;  4XBF B;  1QSD A;  1XMQ T;  4IE0 A;  4EZH A;  1G8X A;  2QVA A;  3U78 A;  2DWK A;  3IF8 B;  1N36 T;  1XZY A;  5EZY E;  1T8B A;  4ILB A;  3KV6 A;  4PNI A;  4QX8 B;  3RIU C;  3FZK B;  2CLY C;  1BR4 A;  4KX6 A;  3ZMZ B;  5ABF A;  2BKN A;  4WZX A;  1D0Y A;  5FNV E;  1ZV4 X;  5LP6 E;  1ZOY A;  1X9B A;  2PFV A;  3LG7 A;  2Y8D A;  3B57 A;  3ZN0 B;  2WWU A;  4TWF A;  3KDS E;  4PAG A;  4YSY A;  3P4P A;  1WFD A;  3PDY A;  3GN5 B;  2E9X D;  4ZI2 C;  4LF4 T;  3AE3 A;  2PTF A;  5KX5 E;  3N9P A;  2E9X C;  5JQG E;  2A3D A;  4YHH T;  2WU2 A;  2HN2 A;  2L8K A;  2NW8 A;  4YFS A;  4I4T E;  4EOZ B;  3UUN A;  4O4I E;  4EYY R;  3X1D A;  4WYV A;  4ZS3 A;  4JBW F;  2H3R A;  4ZI3 C;  1US7 B;  4JI3 T;  1FMW A;  4P0A A;  4CI2 B;  3ZPO A;  5AQM B;  5LGT B;  5FY1 A;  5C8Y E;  3VR8 A;  5HYA A;  4AQF A;  2I0M A;  5FL0 A;  4JI0 T;  2WDV A;  4BJN A;  2XQA A;  3VU7 H;  3ZMS B;  2VL0 A;  3HI2 A;  3ESL A;  2X9H A;  2BKP A;  2FJD A;  3AB3 B;  3DTO A;  4X62 T;  4YLH A;  2ACX A;  5J2U E;  4X5T A;  4IDQ A;  1OWA A;  2KT9 A;  3MAC A;  2IW5 B;  4B3T T;  2XAH B;  4UV8 B;  5JDF A;  2V6X A;  3AA6 B;  2OLT A;  2LSG A;  3AE7 A;  5EK4 A;  3CIR A;  3OKQ A;  2IHR 1;  2BS3 A;  2K48 A;  4YSZ A;  3N9N A;  2BVM A;  3QUJ A;  4WNK A;  4CXX A;  4UEM A;  3RYI E;  2X66 A;  3PUX F;  4G2A A;  5L3D B;  2W4X A;  1NWM X;  2ZLY A;  3UUB A;  1OXZ A;  2NW7 A;  5LGU B;  3HA4 A;  2WQY A;  4DMW A;  2WP9 A;  3N9M A;  2UUB T;  2YOE A;  4GK5 E;  5LJM A;  5HCM A;  1HX8 A;  3C4W A;  4PK6 A;  1WYC A;  3ABV A;  5ABH A;  4DR7 T;  2HN1 A;  3KV5 A;  4IGU A;  3UT5 E;  2DLR A;  4ZXL A;  3RGL A;  4NPP A;  3O1H A;  4DV4 T;  5F5W A;  2LKG A;  2VQF T;  4H9Q C;  4MHC A;  4I43 B;  2LSY A;  3AVS A;  2C5I T;  3BK9 A;  2IDO B;  5JR9 A;  4MLK A;  4U3C A;  1B7T A;  3LBX B;  2WB5 A;  4U2Z A;  5EK2 A;  4NUV A;  4U72 A;  3ZCI A;  5LJN A;  4IE5 A;  3WI3 A;  2LSJ A;  3TLV A;  5LXT E;  2C5J A;  5L47 A;  2BKO A;  4HFD A;  1NEK A;  4YTM A;  1X79 A;  4MFR A;  3UUL A;  2UUC T;  2SPC A;  4LF7 T;  4QH5 A;  1MIV A;  4HFC A;  3DP7 A;  1KNR A;  4X1Y E;  2X0L B;  5L3F B;  3ONL C;  4H9N C;  4P0B A;  2CXF A;  4YHJ A;  2W61 A;  3ZMV B;  5HXR A;  3RC8 A;  4F8H A;  4YSX A;  3VR9 A;  5JDM A;  4IL9 A;  5L2L A;  3ZJ1 A;  5J2T E;  3C4X A;  1HR0 T;  4TWH A;  4MAL A;  4DV0 T;  2LM2 A;  5AQK B;  4K0K T;  2Q9Q B;  4OK0 A;  4JI5 T;  3UU4 A;  3RIA A;  4BJM A;  2EHO B;  2CWO A;  2VAS A;  3ZJ2 A;  4ILU A;  1IAP A;  3HKC E;  4O4L E;  3K3Q C;  2DI4 A;  2YKS A;  2ZM8 A;  4CQI A;  5F3J A;  1MNE A;  2I6H A;  4AKR B;  1FEW A;  3K3N A;  1J1J A;  1XDP A;  2YK0 A;  4DVD A;  4ANJ A;  3JAE A;  4ZS2 A;  2RP4 A;  3N2K E;  2K5B B;  2MYS A;  2CPT A;  4U74 A;  3KV9 A;  5FXZ A;  4AKL A;  3FXE B;  2B76 A;  1I6Z A;  2X51 A;  3E08 A;  4PJJ A;  5AQF B;  1YQ4 A;  3EUH A;  3VRB A;  1HX1 B;  2LOS A;  3V5U A;  4AKH A;  5LMN T;  3UUM A;  2WU5 A;  1JNZ A;  2W00 A;  3RI5 A;  2FJB A;  5HCJ A;  2LLY A;  1D1C A;  2ACZ A;  3AAE B;  2VKD A;  1HF8 A;  2V26 A;  1LKX A;  1HTJ F;  3GA8 A;  2J1D G;  1E1H B;  3D0T A;  3AEC A;  3PUA A;  4ILA A;  3ETV A;  2D0T A;  5FY0 A;  4QKN A;  2CM0 A;  2R6G F;  4E7Z A;  2Z6E A;  1YKH B;  4B6X A;  3CML A;  1HNZ T;  2E5V A;  4L5G A;  2JPF A;  1IJ5 A;  3AVR A;  2WMO A;  1IBM T;  2W0G A;  3HKE E;  4TWD A;  3N9O A;  4DR6 T;  2IUB A;  3KVA A;  3J7Y q;  4K0U A;  3QB5 A;  3KVB A;  3W15 B;  4JUY A;  5KMG P;  5L4H A;  2VWA A;  4AIU A;  2Q9Q D;  4PFO A;  3MXZ A;  3PUQ A;  2EHO D;  2Q9Q C;  2BG9 A;  4U2Y A;  1YKE B;  4J2C A;  3ZKR A;  2EHO C;  4ILC A;  4CI3 B;  1KK7 A;  3SS1 A;  4BA9 A;  4O2A E;  2HPL A;  5FVL A;  5CJ5 A;  3EAM A;  4A56 A;  3KFW X;  3FZL B;  5ABF B;  4Z91 A;  2NTX A;  1UX5 A;  2KSR A;  3LK2 B;  5JDH A;  3ZC0 A;  2JMH A;  4TZ4 C;  2L3L A;  3G06 A;  4L0R A;  4OHF A;  3EHZ A;  4I50 E;  4YTN A;  4DV1 T;  2ZM2 A;  1LVK A;  3Q5D A;  4OYK A;  1FJG T;  4EXT A;  4FI5 A;  3IEE A;  4U33 A;  2XHE B;  2FBW A;  5DAB A;  5C3J A;  4N78 D;  3MJX A;  5AQU B;  1T72 A;  4IDP A;  5HAX A;  5JH7 E;  3U3I A;  3PUS A;  2UXX B;  2V6Y A;  4AQY T;  1KF6 A;  4QH4 A;  3AE8 A;  4B3S T;  4DR4 T;  5HEU A;  2NWB A;  3P4R A;  4IRE A;  3ONJ A;  4PJM A;  2V5D A;  4DUY T;  5ABG A;  1O3X A;  1D0Z A;  4UF0 A;  2CBJ A;  3CX6 B;  4PJN A;  4QXH B;  4B3M T;  4TNV A;  3AAA B;  2E2A A;  3QNU A;  3FZM B;  2X0H A;  5EK3 A;  2XQ8 A;  4X66 T;  4HE8 A;  5AQN B;  3E22 E;  2XQ3 A;  2CCQ A;  4EAH A;  4EGW A;  2XQ5 A;  4JI1 T;  3EAB A;  2CEA A;  5AFU L;  3ZYL A;  3LSV A;  4QH1 A;  2KND A;  3LJC A;  2XPK A;  4HTE A;  4ZI2 D;  5HEJ A;  1NEN A;  3RHW A;  2X68 A;  5LG3 A;  2NTY A;  1N32 T;  1MMG A;  4TNW A;  2C5K T;  1VOM A;  2X9Y A;  1XNQ T;  5A1L A;  5LB7 B;  3AE4 A;  2BDE A;  4DR3 T;  2DL1 A;  2LRK A;  4ZI3 D;  4V1A v;  5IWA T;  5KXJ A;  3UQ4 A;  3AE2 A;  2XAQ B;  4DBR A;  3ANW A;  4Q25 A;  1HFA A;  1UUR A;  5FL1 A;  2XQY A;  3LK3 B;  1WYB A;  4JLE A;  5F8P A;  2ES0 A;  4JEH B;  3P50 A;  1SUM B;  2JQQ A;  4UIG A;  3ZMT B;  3RKO A;  4CN6 A;  5L3C B;  4LFC T;  2D2S A;  1HG2 A;  3QK6 A;  1J5W A;  5IUX A;  4EIW A;  2VQE T;  2XTL A;  3RYF E;  2ODU A;  2V7J A;  5FXW A;  3C98 B;  1IBK T;  3RLF F;  3AAI A;  5JR9 B;  1MIW A;  2UUA T;  1UX4 A;  2YEV C;  3VKG A;  5AQS B;  3FBL A;  3A8Y C;  3GWH A;  4QXC B;  4EED A;  3O9X A;  4AQF C;  5JDQ A;  3RH3 A;  3KV4 A;  3O1I A;  4HWH A;  3NRY A;  3TLT A;  3J9X 1;  3AEE A;  5DQW A;  4TN7 B;  2G0U A;  4DR1 T;  3PUZ F;  4AQG A;  3ZYK A;  4HN9 A;  4IE4 A;  3AE5 A;  1HCI A;  5LBQ B;  2VL8 A;  2NP9 A;  3E0Z A;  4U31 A;  4YY3 T;  2V1D B;  1LVF A;  2V7K A;  1Z8U A;  5HEH A;  2ODV A;  2VK9 A;  4LF9 T;  3Q5X A;  2IIU A;  1UK5 A;  5HXE A;  4DND A;  4KBM B;  2H89 A;  2C0S A;  4NXN T;  2E5L T;  4LFB T;  4GK0 E;  2JIW A;  2WSS V;  1KFY A;  3AEF A;  2KZ7 B;  2OV9 A;  3H3A A;  5M4Y A;  3EDV A;  3ZMU B;  2WCA A;  3JAD A;  2LKH A;  4BAY B;  2H7V C;  3JAF A;  3JC6 D;  4IST A;  2YDQ A;  1KEY A;  3PTR B;  4H9R C;  3JC6 C;  4OFZ A;  2XAS B;  3OBV E;  2D0U A;  3SWH A;  3ZLI A;  5HXC A;  2V7I A;  2MBG A;  3P7I A;  2MOZ A;  5ABE A;  1HG5 A;  4H9P C;  4DO0 A;  2H88 A;  4EYU A;  5FKY A;  3PE0 A;  2N2N A;  4F6R C;  5AQR B;  4LF8 T;  3VKH A;  3O1J A;  4PJL A;  2E8I A;  2VVS A;  3I9Y A;  4H63 H;  5JRC B;  4HFE A;  3UU8 A;  1Y01 A;  5AQI B;  3PV0 F;  3OYX A;  1W9R A;  5JR9 C;  1MND A;  3P4Q A;  4YJ2 E;  3CQC B;  4JI6 T;  4KHP T;  4EZ4 A;  2AE9 A;  2WBL A;  3N5L A;  5ETW A;  2W63 A;  1AJ3 A;  3ZT6 A;  3IHR A;  2AXD S;  3RKG A;  4YJ3 E;  3PUW F;  3CX8 B;  1V9D A;  2B1E A;  4QX7 B;  5LHI B;  5FY7 A;  4PFP A;  2JQH A;  4IL4 A;  4I0U A;  4IT4 A;  2XQ7 A;  4UVB B;  3HKB E;  4AKG A;  4DV2 T;  2M6B A;  4DBQ A;  4P1N A;  2VVN A;  3OJA A;  4O2B E;  1D0X A;  2KXP B;  2VUR A;  4HFV A;  5AQL B;  4B3R T;  4WBN E;  4AI6 A;  1OED A;  2JJ9 A;  2JRK A;  2F4V T;  3I9W A;  1G73 A;  3C50 A;  5LG4 A;  5AQV B;  2YDS A;  2CBI A;  3P4W A;  3CQX C;  1QLB A;  2YN6 A;  2KWI B;  1HNX T;  3PJA J;  3UFG A;  3FBZ A;  3SFE A;  2YU1 A;  3TLW A;  4HFH A;  3IBP A;  4NXM T;  2K3W A;  2GK9 A;  3AA7 B;  3RYC E;  3C51 A;  2RA1 A;  2IC9 A;  4IE7 A;  3BQK A;  4LMK A;  1Y64 B;  2WMN A;  4DV7 T;  5LA6 E;  3B13 A;  4O8S A;  2A2F X; 
#chains in the Genus database with same CATH homology
 5AQP B;  1M62 A;  5AQM B;  3FZL B;  5AQR B;  4HWF A;  3FZH B;  5AQS B;  5AQH B;  3A8Y C;  1UGO A;  3FZF B;  5AQG B;  1UK5 A;  5AQT B;  4HWD A;  2D9D A;  5AQK B;  1I6Z A;  5AQQ B;  5AQV B;  4HWC A;  1M7K A;  3FZM B;  5AQF B;  5AQI B;  1T7S A;  4HWH A;  5AQN B;  3LDQ B;  3FZK B;  3M3Z B;  4HWI B;  5AQU B;  5AQJ B;  5AQO B;  1HX1 B;  5AQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...