3FZKB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 49
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzkB00
5AQJB 5AQIB 1I6ZA 5AQOB 2D9DA 1M7KA 4HWIB 5AQRB 3FZHB 1UGOA 3FZMB 5AQNB 1HX1B 1M62A 5AQKB 5AQUB 5AQGB 5AQFB 5AQTB 3M3ZB 4HWHA 3A8YC 5AQLB 5AQQB 4HWDA 5AQSB 1T7SA 5AQVB 3LDQB 1UK5A 4HWCA 3FZLB 5AQMB 5AQPB 5AQHB 3FZKB 3FZFB 4HWFA
chains in the Genus database with same CATH superfamily
3KVBA 3KFWX 4A56A 4QX8B 2A9UA 4CXWA 4JEHB 3NZQA 1BR1A 2YDSA 4MBQA 2Q9QD 3OBVE 3A7MA 1WR6A 1U5PA 1MNDA 2MPKA 4UVAB 2BG9B 4ZI2C 3HI2A 5CA0E 3FZMB 2IIUA 1YD8G 1HG5A 2L3LA 3ETVA 5LG3A 4AKIA 2YK0A 4OFZA 1VOMA 2L9QA 3N9MA 3LBXB 1XNRT 3AEBA 4JEUB 2ZM6T 5L47A 3PUWF 5CGMA 3WI3A 5AQSB 3QNUA 1AJ3A 5HWYA 3QUJA 3KV4A 1VCTA 4G2AA 2VKOA 5DQVA 4AKLA 1X79A 2CE7A 4TV8E 3N9QA 5LGUB 2YOEA 3MKDA 3L39A 1FMWA 1UK5A 2E8IA 4JI2T 2J47A 3UUNA 4LF5T 4UXNB 3ESLA 3ZMSB 4AQFA 4BJMA 3VKGA 2DCFA 3CMLA 3FB2A 4YHJA 1IBLT 5AQOB 4H9RC 2EHOC 1UUSA 3ZN0B 2VKDA 4H9OC 4X20E 2UXCT 1J1JA 1M7KA 3Q5DA 2K5BB 1WFDA 5FXWA 3TLUA 3MA9A 4TWFA 4ZS2A 4DV5T 1JNRA 2BBHA 1M62A 2XQ9A 5AQKB 3P4RA 4JI5T 3RIFA 3CIRA 3T8OA 3TLTA 2PFVA 4TZ4C 3RQUA 5ABHA 4H63V 3LK3B 4O4IE 5AQLB 1R8IA 5HCJA 3ZPOA 5LNKA 3K3NA 5J2UE 1XMOT 2KNDA 4CXYA 2K9AA 3RKGA 4DR5T 4EGWA 2RPAA 3ONXA 4QXBB 1US7B 3ZMVB 4UVBB 3RIUA 1ZKEA 5CJ5A 4ZI3C 5KX5E 1HR0T 2B1EA 4JI6T 4ILAA 4QKNA 2G0UA 1NENA 2H7OA 2HN2A 4TWHA 3VHLA 5CFBA 1J5WA 4L9IA 2LHRA 5F3JA 2D5UA 2IC6A 3UUBA 3RIAA 2IHR1 2LSIA 2FUPA 3Q5XA 5EK2A 5LMNT 3R6NA 2ZM8A 4DVDA 2D2SA 3O1HA 5AQGB 4EOZB 2FJDA 2V26A 3KVAA 4O2BE 1IJ5A 5FNVE 2UU9T 5J2TE 3E0ZA 2XM2A 1UURA 3K1SA 3B57A 4UV8B 1W0BA 3ZKRA 3JAEA 2DI4A 5DQWA 2KLQA 3O1IA 4DR4T 3IBPA 2IMLA 2KT9A 2LRKA 2VK9A 3ZCJA 1XDPA 3HA4A 1MIVA 3E08A 3TLWA 3LBXA 3RRCA 3ZYLA 1Z0PA 1D0XA 5LHGB 2LT3A 3N9LA 4EEDA 3K8PC 3KINB 3RI5A 4YT0A 3FZFB 1LRZA 2LSKA 3H3MA 3MACA 2YKSA 2C5KT 2LEHA 5L3CB 5M4YA 3PUYF 3AE3A 4H63H 1BR2A 2JRKA 5FYMA 3RKOA 2HPJA 4DBQA 2X0LB 4IDQA 1G8XA 5AQNB 1XMQT 1MMNA 1BR4A 1NAFA 1W9RA 2CM0A 1YXRA 5AQFB 2WM9A 2I0MA 5EK4A 3UUXB 4HN9A 1YKEB 2CLYB 2CWOA 3AEGA 1YQ4A 3FBZA 1HCIA 1VCSA 3CK6A 2VASA 2XAGB 5L4HA 3RX6A 4U31A 2NW7A 2RA1A 2IUBA 4PFPA 1N36T 5LB7B 3VU7H 3UFEA 4GK5E 4YFSA 4ZOLE 2XTLA 3UQ7A 2BVMA 1S94A 2JMKA 2HHHT 3NRYA 3AE8A 4IL9A 2EHOA 2FJAA 4QXHB 3MK7C 4ILCA 5AQMB 2VKHA 2V7KA 3KV6A 3LK2B 4IL4A 2BKPA 2NTYA 1HX8A 2WY2A 4QHOA 2BG9E 2E9XC 4UIGA 5FXVA 3RHWA 4ZZCA 5JH7E 1KNPA 2ZMAA 5JDFA 4ILUA 1XZYA 5FMNA 1T72A 3UFGA 4HWIB 3CX6B 3TKLB 4IE4A 4CZZB 4CN4A 2ZM0A 2WZIA 5L3EB 2JQHA 3GN5A 4P09A 3ZSSA 2XSAA 3AVRA 3ZCIA 4HFDA 5HEJA 4LFCT 1QUUA 3PU3A 3RF1A 2LOPA 4EYYR 3X1DA 4XBFB 3ONJA 4KHZF 2GK9A 2X9WA 4A5XA 4I55E 3PDYA 4B3TT 3KV5A 2NW8A 4PFOA 4PK5A 2MOZA 3SS1A 3C50A 2KWHA 2W66A 4KBMB 3O4XE 2WWVA 1OEDC 5CB4E 3U78A 4CXXA 4ZEYA 5LHIB 2V8SV 3C4XA 2HN1A 2WP9A 3ABVA 3GA8A 3PUXF 4ISTA 4U7IA 1WR0A 4AXPA 4X64T 1N32T 2WMOA 2HH7A 3IA3A 3LFMA 4HFCA 3H37A 5L4EA 3EI0A 3IHRA 4HEAA 4OYKA 4I43B 3U3IA 4B3RT 5LYJE 5FKYA 2WB5A 1OEDE 5FXZA 4MHCA 4IE7A 4L0RA 2LRLA 3PU8A 2F4VT 2V7LA 2C5JA 2BKNA 2CRBA 4O4JE 3UULA 2CA5A 2A72A 2CBJA 2X0YA 2PG8A 2W61A 3SFEA 3M65A 2WU2A 4ZI2D 1U4QA 4DV0T 4NUUA 4EXTA 4YSZA 2NOXA 4LF4T 2XSBA 3V5SA 3RC3A 1Z8UA 4A98A 3W15B 2KMFA 4CN6A 1IBKT 1FMVA 2CXDA 2WZHA 3AB3B 3P8CD 3Q5EA 5FVKA 2WDVA 1X9BA 2E9XD 1G73A 3PE0A 2N1GA 2WDQA 3G06A 2IC9A 3QB5K 3CWZB 2VKJA 3AA6B 1YQ3A 3FZKB 4IREA 4WNKA 3Q5WA 4M1PA 3EUHA 5HEUA 4AQFC 2V1DB 2E5VA 2WS3A 2XPKA 4DMWA 4ZI7E 5LJNA 4DV4T 2LKGA 1KF6A 4HFHA 3JCFA 3EABA 4YSYA 2QYWA 1D1AA 2LE8A 1LVFA 3AEAA 3UUMA 5ABFA 4JI3T 2XAJB 2DLRA 3C98B 1D1CA 3EAMA 4GKJT 3AE4A 4QXCB 4C91A 1QLBA 1QSDA 2CWYA 3AAAB 4PK6A 5HEOA 2NW9A 3OJAA 1XNQT 4AKHA 2ACZA 5JVDE 4YSXA 3AE5A 2JPFA 4HWDA 2WMNA 4MFRA 4O2AE 2K24A 1T7SA 5BMVE 2WAUA 3F31A 5ETWA 4KUMB 4I4TE 4H9NC 3AXJB 4KMCA 5FL0A 2H88A 2X9XA 4I0UA 3OTOT 5F8PA 2EHOB 4YLHA 1MMGA 5JR9A 1WLXA 3CQCB 4DIDB 1ZV4X 2X0HA 2YDQA 3N2GE 4IDPA 4C90A 3ZEFB 4YJ2E 5AQPB 4P0AA 4U72A 4DO0A 2E2AA 3I1AA 1ZEEA 2M6BA 1YW0A 2LM9A 4OX9T 2CHNA 5AQIB 3FXDB 3RGLA 3UU4A 4GK0E 3ZMZB 4ADZA 2KSRA 3VKHA 4XAXB 2XUEA 4IE6A 2B76A 1MMAA 2ZLYA 2FJBA 2LHNA 1IBMT 3RPUA 4X62T 5HEGA 3QC9A 3L3PA 3PURA 4YJ3E 4F8HA 4JI8T 4J2CA 3F57A 5J1GA 1IJ6A 2XQAA 4NXMT 4GIWA 3JAFA 4TNVA 3I0OA 4QX7B 5HYAA 5HXRA 2JMHA 1SUMB 2KXPB 4UVCB 3ZYMA 5HXCA 5HXSA 1D0ZA 2QGSA 5LA6E 3UTKA 5L3FB 4YY3T 4DR2T 5AQVB 3GN5B 3GWHA 4JI4T 2BS2A 2ZM2A 4HKAA 3AE7A 4DV1T 2WWUA 1SE7A 3LG7A 4DR7T 2OLTA 2JQQA 4IE5A 5LGNB 2IAKA 2DWGA 3AE1A 4CI2B 4TUYE 4DBRA 2IDOB 2D0UA 3PJAJ 1GQEA 3CVRA 3ZSTA 2NR4A 3CX7B 3HL6A 2VQFT 3UU8A 2YINA 2MAWA 2XQ4A 3MZKB 3DP7A 4TV9E 4JLEA 3A5XA 3VR8A 4A97A 4NXNT 1DU2A 4H9PC 2WSSV 4N78D 2OA5A 5AQUB 1FJGT 3OYXA 2V5CA 3PUQA 5FY0A 5FXXA 5L3BB 3E22E 5AQQB 4X65T 5JRCB 3EDUA 2J62A 2PTFA 4CN1A 4PW8A 3P4WA 5IUXA 5HXEA 3L09A 3WAJA 4DR3T 4K0UA 4HFEA 4H9QC 4OHFA 4U74A 3HKEE 3CKDA 3OVUA 4Z91A 3AEFA 3PJAA 5ADXL 2CXFA 1OEDB 2X9YA 5DABA 2JIWA 3LSVA 4X5TA 3R84B 3ZJ2A 1VRBA 2NTXA 2WCAA 2ODVA 4LF6T 2W00A 3NVOA 4GYSA 2M6IA 5J0ZA 5JR9B 5IYZE 3AA7B 2K3WA 3CPZA 4OK0A 1T98A 5AQRB 1SA0E 2W67A 5JDQA 4NIQA 2VURA 4YXDA 4UEMA 3ZT7A 4F6RC 3TLVA 3P7IA 2QRXA 1Y01A 2ES0A 2KINB 2V6YA 2XAQB 4QH1A 5AQTB 3RC8A 3C4WA 2H89A 3EVYA 3PV0F 2X66A 1IZNB 2AE9A 1HFAA 4GOUA 2Q9QC 4HWHA 2SPCA 5IHYA 4DV3T 1BR0A 3NKZA 4ANJA 2KZ7B 5LBMA 5ABEA 2HPLA 2M67A 3N9NA 3AE6A 3QB5A 2XQ8A 2H7VC 4DUYT 4WW0A 3UU5A 3AAIA 4DMVA 3P50A 3EDVA 4HE8A 4E7ZA 4WYVA 4HGAA 2CBIA 5LXTE 4IDZA 4ZXLA 4COFA 2CPTA 5AQHB 3C51A 2WU5A 3O1JA 3OYZA 1W09A 2LJLA 3OPCA 4QH4A 4UV9B 5CA1E 4NUVA 5L2LA 4X1IE 4MALA 5LMUT 1I6ZA 3RYFE 2WDRA 2A3DA 2IW5B 3WAKA 5E0OA 4X1KE 1HS7A 3CQGB 2YEVC 2K48A 2XASB 2W0GA 2PJQA 1UGOA 2NWBA 2YN6A 3Q2MA 4TN7B 3ZJ1A 4EZ4A 2V7MA 4LF8T 4TNWA 3T1HT 5JREA 4XZCA 1N33T 4ILBA 2YU1A 2Y6XA 4U2ZA 4V1Av 5FY7A 3EHZA 3JADA 4EV6A 4AI6A 4PNIA 5FVLA 3RYHE 5LP6E 4KP3C 3RLFF 3BQKA 4BA9A 4B3ST 4KX6A 2UXNB 3B13A 4LFAT 1LKXA 2V7JA 4MLKA 2OV9A 4U3CA 3RRWA 3O9XA 2XQ7A 3N2OA 1KNZA 5LBQB 4ZHQE 2XQYA 5EZYE 4KHPT 2LOSA 1WRDA 3AE2A 2E9XB 2V6XA 3FXEB 3UU3A 1FEWA 2JJ9A 2E5LT 2FJEA 4IGUA 4AKGA 3ZMUB 3C4ZA 3ANWB 4ZS3A 4O4HE 2LSGA 4Z8XA 5BR8T 2XHEB 4FI5A 2DNXA 2W62A 4BAYB 1HNXT 3FZHB 1D1BA 3MXZA 3VRAA 3BQLA 2LSJA 4JI7T 2V6YB 4U33A 4DR1T 4DV2T 3FBLA 3SRZA 2QA7A 3T1YT 3PTRB 2XQ6A 3TLSA 3ZMTB 5FP3A 3D0TA 1V9DA 5HXHA 2CHOA 4YTPA 5JDGA 3B5MA 3P4QA 4LF7T 3ETUA 4EEBA 4AQYT 3PUAA 4AKRB 2XJ7A 4JYAT 2YDRA 3HKCE 4JBWF 4JI0T 4CI3B 1O3XA 2Y48B 4IDNA 5HAXA 1OEDA 4YTMA 5L3DB 2XAFB 4DUZT 1YKHB 4IHJE 1FIOA 2VVNA 4KI0F 4WBOA 1KK7A 4HFBA 4CQIA 4HWFA 5C8YE 4JUYA 4O8SA 3J9X1 4L5GA 2VL0A 4GYRA 2LLYA 1KNRA 5JDNA 2X51A 2BVLA 2VB6A 3K3OA 5JRCA 4IIJE 5H6RB 1D0YA 1S35A 2XQ5A 2DWKA 2XY8B 3HKDE 2W2UA 3KDSE 4I50E 5H6QB 2J1DG 3VR9A 3UQ4A 5IWAT 2L8KA 2W4XA 1J5ET 3AA0B 4CI1B 1B7TA 3M3ZB 3HKBE 3Q9DA 5L3GB 4UELA 5JDLA 4HFIA 4Z90A 4DNDA 1NWMX 2P9BA 2PBIA 4K0KT 2UXXB 1UCUA 2KWIB 1NEKA 4IE0A 3UT5E 1LVKA 1W0AA 4IT4A 3ZT6A 3DJBA 3RYCE 3SWHA 3AECA 2C5IT 4DV7T 1HNWT 3N9PA 1CUNA 3PUSA 2ACXA 3GMIA 3S4UA 4TWDA 3DTOA 2CCQA 3JC6C 4EIWA 3CQXC 5ABFB 5JTGA 3CX8B 5LG4A 2J4GA 3RQWA 2BKOA 2X67A 4E7SA 4QH5A 3IEEA 2CLYC 3ZLIA 1E2AA 1ZHCA 4AQGA 2C0SA 3LK42 3QOFA 3ZC0A 2CMRA 1E1HB 5LHHB 4UF0A 2BG9C 5AFUL 3I0QA 3QK6A 4G63A 2N2NA 5GONE 4P0BA 1ZP0A 2FBWA 2Q9QA 1MNEA 3F2EA 4FJOA 3UU6A 2R6GF 2JQKA 3ZYKA 3BK9A 4LMJA 1UX4A 5DJQC 3PUZF 3KBTA 4JV5T 4WBNE 4YTNA 2DL1A 3K3QC 3LDQB 4PJNA 4ISSA 1HG2A 3ZT5A 2Z6EA 4B3MT 3H3AA 2MBGA 1MIYA 1IAPA 3ZN1B 2XAHB 2MTQA 2XM1A 1OXZA 4HWCA 3AA1B 5JR9C 4GKKT 2BZBA 4ZI3D 2ODUA 1WCRA 5LJMA 2CEAA 5KMGP 4PAGA 2BS4A 4ERRA 3AVSA 2N9DA 1WYCA 3SOLA 1L0VA 1HF8A 3BQIA 4EB6E 4U7YA 2H3RA 5LCYA 5JQGE 3MJXA 2D0TA 4PK4A 1N34T 4H9SE 4PJLA 5HCMA 2X68A 1T8BA 1OWAA 2AXDS 5C2TA 1HX1B 1JNZA 2VL8A 1CHUA 2CXLA 3LJCA 5F5WA 3SFDA 3VRBA 3I9YA 4AISA 2VQET 1KFYA 4B6XA 5LOVE 4Q25A 1WYBA 2JQ9A 1E7PA 3A8YC 3PUGA 4TX5A 2UXDT 2VVSA 3RH3A 2W63A 3ONLC 5ABGA 2I59A 3RYIE 2XZEA 5HEHA 4UR9A 1EZ3A 3AAEB 4HTEA 4UF0B 5EK3A 3N9OA 2YU2A 1XDOA 1MMDA 4O4LE 2EHOD 4AIUA 3AEDA 3IF8B 2Y8DA 4BJNA 2UXBT 3OKQA 3FZLB 5JDMA 2I6HA 2NP9A 2QVAA 3JC6D 4DR6T 3I9WA 5C3JA 1SHZC 3NBXX 4PJMA 2UUBT 3NRXA 3N5LA 3AXJA 4IDOA 1HTJF 2VWAA 4OYJA 5AQJB 2LSYA 4HFVA 3NZPA 5TAOA 2UUAT 3PUVF 2D9DA 4YHHT 5A1LA 2RP4A 5JDHA 2MYSA 3FHNA 3ZC1A 3J7Yq 3N2KE 4NPPA 4WZXA 4JI1T 2DHRA 4DV6T 2V7IA 3V5UA 1XWMA 3AE9A 5HWXA 2WQYA 3P4SA 5LGTB 2BDEA 3HR0A 4PJJA 4QWNB 4ASKA 1UX5A 3KBUA 3L8RA 4EAHA 4EZHA 2LM2A 4X66T 1HNZT 2V5DA 4EYUA 2UUCT 2BG9A 4LFBT 1ZOYA 3KV9A 2BBJA 4P1NA 5FY1A 4LF9T 2LKHA 4ZZBA 2WBLA 3RIUC 1H7CA 5KDMC 2X9HA 3NWIA 1KEYA 4U2YA 4X1YE 3ANWA 2BS3A 3P4PA 2Q9QB 4LMLA 4LMKA 2XQ3A 1MIWA 1Y64B 3C64A 5FL1A 5KXJA 2E9XA 1I94T 3AEEA 2A2FX
chains in the Genus database with same CATH topology
5AQJB 5AQIB 1I6ZA 5AQOB 2D9DA 1M7KA 4HWIB 5AQRB 3FZHB 1UGOA 3FZMB 5AQNB 1HX1B 1M62A 5AQKB 5AQUB 5AQGB 5AQFB 5AQTB 3M3ZB 4HWHA 3A8YC 5AQLB 5AQQB 4HWDA 5AQSB 1T7SA 5AQVB 3LDQB 1UK5A 4HWCA 3FZLB 5AQMB 5AQPB 5AQHB 3FZKB 3FZFB 4HWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQJ B;  5AQI B;  1I6Z A;  5AQO B;  2D9D A;  1M7K A;  4HWI B;  5AQR B;  3FZH B;  1UGO A;  3FZM B;  5AQN B;  1HX1 B;  1M62 A;  5AQK B;  5AQU B;  5AQG B;  5AQF B;  5AQT B;  3M3Z B;  4HWH A;  3A8Y C;  5AQL B;  5AQQ B;  4HWD A;  5AQS B;  1T7S A;  5AQV B;  3LDQ B;  1UK5 A;  4HWC A;  3FZL B;  5AQM B;  5AQP B;  5AQH B;  3FZK B;  3FZF B;  4HWF A; 
#chains in the Genus database with same CATH topology
 3KVB A;  3KFW X;  4A56 A;  4QX8 B;  2A9U A;  4CXW A;  4JEH B;  3NZQ A;  1BR1 A;  2YDS A;  4MBQ A;  2Q9Q D;  3OBV E;  3A7M A;  1WR6 A;  1U5P A;  1MND A;  2MPK A;  4UVA B;  2BG9 B;  4ZI2 C;  3HI2 A;  5CA0 E;  3FZM B;  2IIU A;  1YD8 G;  1HG5 A;  2L3L A;  3ETV A;  5LG3 A;  4AKI A;  2YK0 A;  4OFZ A;  1VOM A;  2L9Q A;  3N9M A;  3LBX B;  1XNR T;  3AEB A;  4JEU B;  2ZM6 T;  5L47 A;  3PUW F;  5CGM A;  3WI3 A;  5AQS B;  3QNU A;  1AJ3 A;  5HWY A;  3QUJ A;  3KV4 A;  1VCT A;  4G2A A;  2VKO A;  5DQV A;  4AKL A;  1X79 A;  2CE7 A;  4TV8 E;  3N9Q A;  5LGU B;  2YOE A;  3MKD A;  3L39 A;  1FMW A;  1UK5 A;  2E8I A;  4JI2 T;  2J47 A;  3UUN A;  4LF5 T;  4UXN B;  3ESL A;  3ZMS B;  4AQF A;  4BJM A;  3VKG A;  2DCF A;  3CML A;  3FB2 A;  4YHJ A;  1IBL T;  5AQO B;  4H9R C;  2EHO C;  1UUS A;  3ZN0 B;  2VKD A;  4H9O C;  4X20 E;  2UXC T;  1J1J A;  1M7K A;  3Q5D A;  2K5B B;  1WFD A;  5FXW A;  3TLU A;  3MA9 A;  4TWF A;  4ZS2 A;  4DV5 T;  1JNR A;  2BBH A;  1M62 A;  2XQ9 A;  5AQK B;  3P4R A;  4JI5 T;  3RIF A;  3CIR A;  3T8O A;  3TLT A;  2PFV A;  4TZ4 C;  3RQU A;  5ABH A;  4H63 V;  3LK3 B;  4O4I E;  5AQL B;  1R8I A;  5HCJ A;  3ZPO A;  5LNK A;  3K3N A;  5J2U E;  1XMO T;  2KND A;  4CXY A;  2K9A A;  3RKG A;  4DR5 T;  4EGW A;  2RPA A;  3ONX A;  4QXB B;  1US7 B;  3ZMV B;  4UVB B;  3RIU A;  1ZKE A;  5CJ5 A;  4ZI3 C;  5KX5 E;  1HR0 T;  2B1E A;  4JI6 T;  4ILA A;  4QKN A;  2G0U A;  1NEN A;  2H7O A;  2HN2 A;  4TWH A;  3VHL A;  5CFB A;  1J5W A;  4L9I A;  2LHR A;  5F3J A;  2D5U A;  2IC6 A;  3UUB A;  3RIA A;  2IHR 1;  2LSI A;  2FUP A;  3Q5X A;  5EK2 A;  5LMN T;  3R6N A;  2ZM8 A;  4DVD A;  2D2S A;  3O1H A;  5AQG B;  4EOZ B;  2FJD A;  2V26 A;  3KVA A;  4O2B E;  1IJ5 A;  5FNV E;  2UU9 T;  5J2T E;  3E0Z A;  2XM2 A;  1UUR A;  3K1S A;  3B57 A;  4UV8 B;  1W0B A;  3ZKR A;  3JAE A;  2DI4 A;  5DQW A;  2KLQ A;  3O1I A;  4DR4 T;  3IBP A;  2IML A;  2KT9 A;  2LRK A;  2VK9 A;  3ZCJ A;  1XDP A;  3HA4 A;  1MIV A;  3E08 A;  3TLW A;  3LBX A;  3RRC A;  3ZYL A;  1Z0P A;  1D0X A;  5LHG B;  2LT3 A;  3N9L A;  4EED A;  3K8P C;  3KIN B;  3RI5 A;  4YT0 A;  3FZF B;  1LRZ A;  2LSK A;  3H3M A;  3MAC A;  2YKS A;  2C5K T;  2LEH A;  5L3C B;  5M4Y A;  3PUY F;  3AE3 A;  4H63 H;  1BR2 A;  2JRK A;  5FYM A;  3RKO A;  2HPJ A;  4DBQ A;  2X0L B;  4IDQ A;  1G8X A;  5AQN B;  1XMQ T;  1MMN A;  1BR4 A;  1NAF A;  1W9R A;  2CM0 A;  1YXR A;  5AQF B;  2WM9 A;  2I0M A;  5EK4 A;  3UUX B;  4HN9 A;  1YKE B;  2CLY B;  2CWO A;  3AEG A;  1YQ4 A;  3FBZ A;  1HCI A;  1VCS A;  3CK6 A;  2VAS A;  2XAG B;  5L4H A;  3RX6 A;  4U31 A;  2NW7 A;  2RA1 A;  2IUB A;  4PFP A;  1N36 T;  5LB7 B;  3VU7 H;  3UFE A;  4GK5 E;  4YFS A;  4ZOL E;  2XTL A;  3UQ7 A;  2BVM A;  1S94 A;  2JMK A;  2HHH T;  3NRY A;  3AE8 A;  4IL9 A;  2EHO A;  2FJA A;  4QXH B;  3MK7 C;  4ILC A;  5AQM B;  2VKH A;  2V7K A;  3KV6 A;  3LK2 B;  4IL4 A;  2BKP A;  2NTY A;  1HX8 A;  2WY2 A;  4QHO A;  2BG9 E;  2E9X C;  4UIG A;  5FXV A;  3RHW A;  4ZZC A;  5JH7 E;  1KNP A;  2ZMA A;  5JDF A;  4ILU A;  1XZY A;  5FMN A;  1T72 A;  3UFG A;  4HWI B;  3CX6 B;  3TKL B;  4IE4 A;  4CZZ B;  4CN4 A;  2ZM0 A;  2WZI A;  5L3E B;  2JQH A;  3GN5 A;  4P09 A;  3ZSS A;  2XSA A;  3AVR A;  3ZCI A;  4HFD A;  5HEJ A;  4LFC T;  1QUU A;  3PU3 A;  3RF1 A;  2LOP A;  4EYY R;  3X1D A;  4XBF B;  3ONJ A;  4KHZ F;  2GK9 A;  2X9W A;  4A5X A;  4I55 E;  3PDY A;  4B3T T;  3KV5 A;  2NW8 A;  4PFO A;  4PK5 A;  2MOZ A;  3SS1 A;  3C50 A;  2KWH A;  2W66 A;  4KBM B;  3O4X E;  2WWV A;  1OED C;  5CB4 E;  3U78 A;  4CXX A;  4ZEY A;  5LHI B;  2V8S V;  3C4X A;  2HN1 A;  2WP9 A;  3ABV A;  3GA8 A;  3PUX F;  4IST A;  4U7I A;  1WR0 A;  4AXP A;  4X64 T;  1N32 T;  2WMO A;  2HH7 A;  3IA3 A;  3LFM A;  4HFC A;  3H37 A;  5L4E A;  3EI0 A;  3IHR A;  4HEA A;  4OYK A;  4I43 B;  3U3I A;  4B3R T;  5LYJ E;  5FKY A;  2WB5 A;  1OED E;  5FXZ A;  4MHC A;  4IE7 A;  4L0R A;  2LRL A;  3PU8 A;  2F4V T;  2V7L A;  2C5J A;  2BKN A;  2CRB A;  4O4J E;  3UUL A;  2CA5 A;  2A72 A;  2CBJ A;  2X0Y A;  2PG8 A;  2W61 A;  3SFE A;  3M65 A;  2WU2 A;  4ZI2 D;  1U4Q A;  4DV0 T;  4NUU A;  4EXT A;  4YSZ A;  2NOX A;  4LF4 T;  2XSB A;  3V5S A;  3RC3 A;  1Z8U A;  4A98 A;  3W15 B;  2KMF A;  4CN6 A;  1IBK T;  1FMV A;  2CXD A;  2WZH A;  3AB3 B;  3P8C D;  3Q5E A;  5FVK A;  2WDV A;  1X9B A;  2E9X D;  1G73 A;  3PE0 A;  2N1G A;  2WDQ A;  3G06 A;  2IC9 A;  3QB5 K;  3CWZ B;  2VKJ A;  3AA6 B;  1YQ3 A;  3FZK B;  4IRE A;  4WNK A;  3Q5W A;  4M1P A;  3EUH A;  5HEU A;  4AQF C;  2V1D B;  2E5V A;  2WS3 A;  2XPK A;  4DMW A;  4ZI7 E;  5LJN A;  4DV4 T;  2LKG A;  1KF6 A;  4HFH A;  3JCF A;  3EAB A;  4YSY A;  2QYW A;  1D1A A;  2LE8 A;  1LVF A;  3AEA A;  3UUM A;  5ABF A;  4JI3 T;  2XAJ B;  2DLR A;  3C98 B;  1D1C A;  3EAM A;  4GKJ T;  3AE4 A;  4QXC B;  4C91 A;  1QLB A;  1QSD A;  2CWY A;  3AAA B;  4PK6 A;  5HEO A;  2NW9 A;  3OJA A;  1XNQ T;  4AKH A;  2ACZ A;  5JVD E;  4YSX A;  3AE5 A;  2JPF A;  4HWD A;  2WMN A;  4MFR A;  4O2A E;  2K24 A;  1T7S A;  5BMV E;  2WAU A;  3F31 A;  5ETW A;  4KUM B;  4I4T E;  4H9N C;  3AXJ B;  4KMC A;  5FL0 A;  2H88 A;  2X9X A;  4I0U A;  3OTO T;  5F8P A;  2EHO B;  4YLH A;  1MMG A;  5JR9 A;  1WLX A;  3CQC B;  4DID B;  1ZV4 X;  2X0H A;  2YDQ A;  3N2G E;  4IDP A;  4C90 A;  3ZEF B;  4YJ2 E;  5AQP B;  4P0A A;  4U72 A;  4DO0 A;  2E2A A;  3I1A A;  1ZEE A;  2M6B A;  1YW0 A;  2LM9 A;  4OX9 T;  2CHN A;  5AQI B;  3FXD B;  3RGL A;  3UU4 A;  4GK0 E;  3ZMZ B;  4ADZ A;  2KSR A;  3VKH A;  4XAX B;  2XUE A;  4IE6 A;  2B76 A;  1MMA A;  2ZLY A;  2FJB A;  2LHN A;  1IBM T;  3RPU A;  4X62 T;  5HEG A;  3QC9 A;  3L3P A;  3PUR A;  4YJ3 E;  4F8H A;  4JI8 T;  4J2C A;  3F57 A;  5J1G A;  1IJ6 A;  2XQA A;  4NXM T;  4GIW A;  3JAF A;  4TNV A;  3I0O A;  4QX7 B;  5HYA A;  5HXR A;  2JMH A;  1SUM B;  2KXP B;  4UVC B;  3ZYM A;  5HXC A;  5HXS A;  1D0Z A;  2QGS A;  5LA6 E;  3UTK A;  5L3F B;  4YY3 T;  4DR2 T;  5AQV B;  3GN5 B;  3GWH A;  4JI4 T;  2BS2 A;  2ZM2 A;  4HKA A;  3AE7 A;  4DV1 T;  2WWU A;  1SE7 A;  3LG7 A;  4DR7 T;  2OLT A;  2JQQ A;  4IE5 A;  5LGN B;  2IAK A;  2DWG A;  3AE1 A;  4CI2 B;  4TUY E;  4DBR A;  2IDO B;  2D0U A;  3PJA J;  1GQE A;  3CVR A;  3ZST A;  2NR4 A;  3CX7 B;  3HL6 A;  2VQF T;  3UU8 A;  2YIN A;  2MAW A;  2XQ4 A;  3MZK B;  3DP7 A;  4TV9 E;  4JLE A;  3A5X A;  3VR8 A;  4A97 A;  4NXN T;  1DU2 A;  4H9P C;  2WSS V;  4N78 D;  2OA5 A;  5AQU B;  1FJG T;  3OYX A;  2V5C A;  3PUQ A;  5FY0 A;  5FXX A;  5L3B B;  3E22 E;  5AQQ B;  4X65 T;  5JRC B;  3EDU A;  2J62 A;  2PTF A;  4CN1 A;  4PW8 A;  3P4W A;  5IUX A;  5HXE A;  3L09 A;  3WAJ A;  4DR3 T;  4K0U A;  4HFE A;  4H9Q C;  4OHF A;  4U74 A;  3HKE E;  3CKD A;  3OVU A;  4Z91 A;  3AEF A;  3PJA A;  5ADX L;  2CXF A;  1OED B;  2X9Y A;  5DAB A;  2JIW A;  3LSV A;  4X5T A;  3R84 B;  3ZJ2 A;  1VRB A;  2NTX A;  2WCA A;  2ODV A;  4LF6 T;  2W00 A;  3NVO A;  4GYS A;  2M6I A;  5J0Z A;  5JR9 B;  5IYZ E;  3AA7 B;  2K3W A;  3CPZ A;  4OK0 A;  1T98 A;  5AQR B;  1SA0 E;  2W67 A;  5JDQ A;  4NIQ A;  2VUR A;  4YXD A;  4UEM A;  3ZT7 A;  4F6R C;  3TLV A;  3P7I A;  2QRX A;  1Y01 A;  2ES0 A;  2KIN B;  2V6Y A;  2XAQ B;  4QH1 A;  5AQT B;  3RC8 A;  3C4W A;  2H89 A;  3EVY A;  3PV0 F;  2X66 A;  1IZN B;  2AE9 A;  1HFA A;  4GOU A;  2Q9Q C;  4HWH A;  2SPC A;  5IHY A;  4DV3 T;  1BR0 A;  3NKZ A;  4ANJ A;  2KZ7 B;  5LBM A;  5ABE A;  2HPL A;  2M67 A;  3N9N A;  3AE6 A;  3QB5 A;  2XQ8 A;  2H7V C;  4DUY T;  4WW0 A;  3UU5 A;  3AAI A;  4DMV A;  3P50 A;  3EDV A;  4HE8 A;  4E7Z A;  4WYV A;  4HGA A;  2CBI A;  5LXT E;  4IDZ A;  4ZXL A;  4COF A;  2CPT A;  5AQH B;  3C51 A;  2WU5 A;  3O1J A;  3OYZ A;  1W09 A;  2LJL A;  3OPC A;  4QH4 A;  4UV9 B;  5CA1 E;  4NUV A;  5L2L A;  4X1I E;  4MAL A;  5LMU T;  1I6Z A;  3RYF E;  2WDR A;  2A3D A;  2IW5 B;  3WAK A;  5E0O A;  4X1K E;  1HS7 A;  3CQG B;  2YEV C;  2K48 A;  2XAS B;  2W0G A;  2PJQ A;  1UGO A;  2NWB A;  2YN6 A;  3Q2M A;  4TN7 B;  3ZJ1 A;  4EZ4 A;  2V7M A;  4LF8 T;  4TNW A;  3T1H T;  5JRE A;  4XZC A;  1N33 T;  4ILB A;  2YU1 A;  2Y6X A;  4U2Z A;  4V1A v;  5FY7 A;  3EHZ A;  3JAD A;  4EV6 A;  4AI6 A;  4PNI A;  5FVL A;  3RYH E;  5LP6 E;  4KP3 C;  3RLF F;  3BQK A;  4BA9 A;  4B3S T;  4KX6 A;  2UXN B;  3B13 A;  4LFA T;  1LKX A;  2V7J A;  4MLK A;  2OV9 A;  4U3C A;  3RRW A;  3O9X A;  2XQ7 A;  3N2O A;  1KNZ A;  5LBQ B;  4ZHQ E;  2XQY A;  5EZY E;  4KHP T;  2LOS A;  1WRD A;  3AE2 A;  2E9X B;  2V6X A;  3FXE B;  3UU3 A;  1FEW A;  2JJ9 A;  2E5L T;  2FJE A;  4IGU A;  4AKG A;  3ZMU B;  3C4Z A;  3ANW B;  4ZS3 A;  4O4H E;  2LSG A;  4Z8X A;  5BR8 T;  2XHE B;  4FI5 A;  2DNX A;  2W62 A;  4BAY B;  1HNX T;  3FZH B;  1D1B A;  3MXZ A;  3VRA A;  3BQL A;  2LSJ A;  4JI7 T;  2V6Y B;  4U33 A;  4DR1 T;  4DV2 T;  3FBL A;  3SRZ A;  2QA7 A;  3T1Y T;  3PTR B;  2XQ6 A;  3TLS A;  3ZMT B;  5FP3 A;  3D0T A;  1V9D A;  5HXH A;  2CHO A;  4YTP A;  5JDG A;  3B5M A;  3P4Q A;  4LF7 T;  3ETU A;  4EEB A;  4AQY T;  3PUA A;  4AKR B;  2XJ7 A;  4JYA T;  2YDR A;  3HKC E;  4JBW F;  4JI0 T;  4CI3 B;  1O3X A;  2Y48 B;  4IDN A;  5HAX A;  1OED A;  4YTM A;  5L3D B;  2XAF B;  4DUZ T;  1YKH B;  4IHJ E;  1FIO A;  2VVN A;  4KI0 F;  4WBO A;  1KK7 A;  4HFB A;  4CQI A;  4HWF A;  5C8Y E;  4JUY A;  4O8S A;  3J9X 1;  4L5G A;  2VL0 A;  4GYR A;  2LLY A;  1KNR A;  5JDN A;  2X51 A;  2BVL A;  2VB6 A;  3K3O A;  5JRC A;  4IIJ E;  5H6R B;  1D0Y A;  1S35 A;  2XQ5 A;  2DWK A;  2XY8 B;  3HKD E;  2W2U A;  3KDS E;  4I50 E;  5H6Q B;  2J1D G;  3VR9 A;  3UQ4 A;  5IWA T;  2L8K A;  2W4X A;  1J5E T;  3AA0 B;  4CI1 B;  1B7T A;  3M3Z B;  3HKB E;  3Q9D A;  5L3G B;  4UEL A;  5JDL A;  4HFI A;  4Z90 A;  4DND A;  1NWM X;  2P9B A;  2PBI A;  4K0K T;  2UXX B;  1UCU A;  2KWI B;  1NEK A;  4IE0 A;  3UT5 E;  1LVK A;  1W0A A;  4IT4 A;  3ZT6 A;  3DJB A;  3RYC E;  3SWH A;  3AEC A;  2C5I T;  4DV7 T;  1HNW T;  3N9P A;  1CUN A;  3PUS A;  2ACX A;  3GMI A;  3S4U A;  4TWD A;  3DTO A;  2CCQ A;  3JC6 C;  4EIW A;  3CQX C;  5ABF B;  5JTG A;  3CX8 B;  5LG4 A;  2J4G A;  3RQW A;  2BKO A;  2X67 A;  4E7S A;  4QH5 A;  3IEE A;  2CLY C;  3ZLI A;  1E2A A;  1ZHC A;  4AQG A;  2C0S A;  3LK4 2;  3QOF A;  3ZC0 A;  2CMR A;  1E1H B;  5LHH B;  4UF0 A;  2BG9 C;  5AFU L;  3I0Q A;  3QK6 A;  4G63 A;  2N2N A;  5GON E;  4P0B A;  1ZP0 A;  2FBW A;  2Q9Q A;  1MNE A;  3F2E A;  4FJO A;  3UU6 A;  2R6G F;  2JQK A;  3ZYK A;  3BK9 A;  4LMJ A;  1UX4 A;  5DJQ C;  3PUZ F;  3KBT A;  4JV5 T;  4WBN E;  4YTN A;  2DL1 A;  3K3Q C;  3LDQ B;  4PJN A;  4ISS A;  1HG2 A;  3ZT5 A;  2Z6E A;  4B3M T;  3H3A A;  2MBG A;  1MIY A;  1IAP A;  3ZN1 B;  2XAH B;  2MTQ A;  2XM1 A;  1OXZ A;  4HWC A;  3AA1 B;  5JR9 C;  4GKK T;  2BZB A;  4ZI3 D;  2ODU A;  1WCR A;  5LJM A;  2CEA A;  5KMG P;  4PAG A;  2BS4 A;  4ERR A;  3AVS A;  2N9D A;  1WYC A;  3SOL A;  1L0V A;  1HF8 A;  3BQI A;  4EB6 E;  4U7Y A;  2H3R A;  5LCY A;  5JQG E;  3MJX A;  2D0T A;  4PK4 A;  1N34 T;  4H9S E;  4PJL A;  5HCM A;  2X68 A;  1T8B A;  1OWA A;  2AXD S;  5C2T A;  1HX1 B;  1JNZ A;  2VL8 A;  1CHU A;  2CXL A;  3LJC A;  5F5W A;  3SFD A;  3VRB A;  3I9Y A;  4AIS A;  2VQE T;  1KFY A;  4B6X A;  5LOV E;  4Q25 A;  1WYB A;  2JQ9 A;  1E7P A;  3A8Y C;  3PUG A;  4TX5 A;  2UXD T;  2VVS A;  3RH3 A;  2W63 A;  3ONL C;  5ABG A;  2I59 A;  3RYI E;  2XZE A;  5HEH A;  4UR9 A;  1EZ3 A;  3AAE B;  4HTE A;  4UF0 B;  5EK3 A;  3N9O A;  2YU2 A;  1XDO A;  1MMD A;  4O4L E;  2EHO D;  4AIU A;  3AED A;  3IF8 B;  2Y8D A;  4BJN A;  2UXB T;  3OKQ A;  3FZL B;  5JDM A;  2I6H A;  2NP9 A;  2QVA A;  3JC6 D;  4DR6 T;  3I9W A;  5C3J A;  1SHZ C;  3NBX X;  4PJM A;  2UUB T;  3NRX A;  3N5L A;  3AXJ A;  4IDO A;  1HTJ F;  2VWA A;  4OYJ A;  5AQJ B;  2LSY A;  4HFV A;  3NZP A;  5TAO A;  2UUA T;  3PUV F;  2D9D A;  4YHH T;  5A1L A;  2RP4 A;  5JDH A;  2MYS A;  3FHN A;  3ZC1 A;  3J7Y q;  3N2K E;  4NPP A;  4WZX A;  4JI1 T;  2DHR A;  4DV6 T;  2V7I A;  3V5U A;  1XWM A;  3AE9 A;  5HWX A;  2WQY A;  3P4S A;  5LGT B;  2BDE A;  3HR0 A;  4PJJ A;  4QWN B;  4ASK A;  1UX5 A;  3KBU A;  3L8R A;  4EAH A;  4EZH A;  2LM2 A;  4X66 T;  1HNZ T;  2V5D A;  4EYU A;  2UUC T;  2BG9 A;  4LFB T;  1ZOY A;  3KV9 A;  2BBJ A;  4P1N A;  5FY1 A;  4LF9 T;  2LKH A;  4ZZB A;  2WBL A;  3RIU C;  1H7C A;  5KDM C;  2X9H A;  3NWI A;  1KEY A;  4U2Y A;  4X1Y E;  3ANW A;  2BS3 A;  3P4P A;  2Q9Q B;  4LML A;  4LMK A;  2XQ3 A;  1MIW A;  1Y64 B;  3C64 A;  5FL1 A;  5KXJ A;  2E9X A;  1I94 T;  3AEE A;  2A2F X; 
#chains in the Genus database with same CATH homology
 5AQJ B;  5AQI B;  1I6Z A;  5AQO B;  2D9D A;  1M7K A;  4HWI B;  5AQR B;  3FZH B;  1UGO A;  3FZM B;  5AQN B;  1HX1 B;  1M62 A;  5AQK B;  5AQU B;  5AQG B;  5AQF B;  5AQT B;  3M3Z B;  4HWH A;  3A8Y C;  5AQL B;  5AQQ B;  4HWD A;  5AQS B;  1T7S A;  5AQV B;  3LDQ B;  1UK5 A;  4HWC A;  3FZL B;  5AQM B;  5AQP B;  5AQH B;  3FZK B;  3FZF B;  4HWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...