3FZKB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 49
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzkB00
5AQMB 3LDQB 4HWCA 3FZHB 5AQGB 2D9DA 3FZMB 5AQVB 5AQHB 5AQKB 5AQFB 3A8YC 5AQIB 3FZLB 3FZKB 3M3ZB 5AQOB 4HWHA 1UK5A 1I6ZA 1UGOA 5AQJB 5AQRB 4HWIB 5AQSB 5AQUB 1M7KA 5AQNB 5AQTB 5AQQB 4HWDA 1HX1B 5AQPB 4HWFA 3FZFB 1T7SA 1M62A 5AQLB
chains in the Genus database with same CATH superfamily
3O1HA 3CX6B 3PURA 2ACXA 5HCJA 5C3JA 4DV2T 2WZHA 3PUZF 2J1DG 4HFEA 5AQUB 2XAFB 3W15B 4WZXA 2WMNA 3RLFF 4MLKA 2QA7A 4LMLA 2KINB 4AKGA 2XQ4A 4EV6A 1YW0A 2UXXB 1HCIA 2XQ9A 3KBUA 3P4RA 3E08A 3ZPOA 5FKYA 2UXCT 3OKQA 4AKHA 4O8SA 5LP6E 1FMVA 4YY3T 4HGAA 3ZEFB 3IEEA 2WM9A 4JI5T 3DTOA 1KNRA 5JRCB 2VVNA 2XM1A 3E0ZA 1JNRA 3WI3A 4AQYT 2V6XA 1UURA 3GMIA 2N9DA 2BG9B 5FXVA 3RHWA 2VK9A 4DMWA 1YXRA 3SFDA 5JR9A 4N78D 2OV9A 3AXJB 4U72A 4UF0B 3AVRA 5FY7A 4AKRB 4DR2T 1YQ3A 4M1PA 1HG2A 2LOPA 4H9RC 3CMLA 4HEAA 5LHGB 5LG3A 4QH5A 4QX7B 2XQ3A 5AQLB 5L47A 1WYCA 2ES0A 1MNEA 4U7IA 4A56A 3ZSSA 2A9UA 4YHHT 3O9XA 3OJAA 5FP3A 4L5GA 5AQRB 5FXZA 2QYWA 2VKJA 4JYAT 5FL1A 1OEDA 4HFVA 5CFBA 4TNWA 2XQ8A 2DLRA 3ESLA 4X20E 4DR7T 3ONLC 2JRKA 1BR1A 2WY2A 2LEHA 1T8BA 1BR4A 4WNKA 4ZHQE 4LF7T 2ODVA 3CX8B 2XAJB 1Z0PA 2JQKA 4L9IA 3Q5EA 4TZ4C 3ANWB 3ZN0B 5FL0A 2SPCA 1IAPA 2XUEA 4PFPA 1WCRA 4EXTA 2CHOA 3PUVF 4YHJA 3ZT6A 4EYYR 2L8KA 4NUVA 2ACZA 4Q25A 4ILUA 4TWFA 2XASB 3N5LA 3N9NA 4KMCA 3AE5A 4OX9T 1KNZA 3RQUA 4LF4T 5LCYA 3ZJ2A 2E8IA 1B7TA 4HWHA 2HH7A 4PJLA 4DV0T 2XQAA 5LJMA 2C5IT 4YTMA 2XSBA 2LSIA 5KX5E 5HWXA 1J5WA 2Q9QB 4UR9A 5JRCA 3ZMSB 3VHLA 2LJLA 5CGMA 4HWCA 2WDRA 5HEOA 5AFUL 2BG9A 5LMNT 1G8XA 1W0BA 2X9HA 2VB6A 2VL0A 4OYJA 2Y8DA 3AXJA 4UF0A 5LB7B 2LSYA 4DR5T 3NRYA 1AJ3A 4F6RC 3FZMB 5HXRA 2V7IA 2YDRA 2XQYA 4EEBA 1WFDA 1T98A 3AA1B 5HEHA 4QXBB 3VR8A 3RIFA 3IBPA 2MTQA 2UUAT 1NAFA 2KNDA 3HKBE 2BKPA 1QUUA 3AB3B 1FEWA 5KMGP 4C91A 3TLUA 2V7LA 2V7JA 3DP7A 4AIUA 4WYVA 2BBHA 2E9XB 4IREA 5L2LA 4DV5T 2D0UA 4DO0A 3LBXB 1MMGA 4HWIB 3X1DA 1O3XA 4A97A 1U4QA 3ANWA 3RX6A 1BR2A 4JI2T 4EB6E 2X9WA 3ZMZB 3UUMA 4I43B 3M65A 3AA6B 5AQHB 1FJGT 4UVAB 4PW8A 3OPCA 2VASA 3NRXA 5FXWA 4ANJA 2YKSA 3BK9A 2X0LB 2XPKA 5EK3A 3MKDA 1HNWT 3AE8A 2XZEA 3NKZA 2CLYC 4TWHA 2WWUA 5EZYE 2KLQA 5ABEA 4CN4A 5AQFB 4P0BA 4X62T 1XNQT 4ZZCA 5L3BB 1S94A 1HS7A 4LF9T 3SWHA 2V6YB 2XJ7A 4UVCB 5LGTB 4HWFA 3MA9A 3FXDB 5AQMB 4A5XA 3K8PC 3WAJA 3O1JA 2Q9QA 2LSGA 2WBLA 2E2AA 2XTLA 4O4IE 5DJQC 2CA5A 4TUYE 4UIGA 2LOSA 1KK7A 1LRZA 4HKAA 4DR3T 4DBRA 2OLTA 5C2TA 5J2UE 1OWAA 1KEYA 3JC6C 4BJMA 3LDQB 2NP9A 1WLXA 2HHHT 4E7SA 5LNKA 3VRAA 2VL8A 3NWIA 4EAHA 3IHRA 4ZI2C 1GQEA 2YU2A 3KVAA 1VCSA 4IE4A 3AEDA 2KWHA 3ZT5A 2VVSA 3GA8A 3PE0A 3B57A 1X79A 2K9AA 4OFZA 1WR6A 2KZ7B 2LKHA 4DUYT 4U3CA 4UVBB 4QWNB 4HTEA 5CJ5A 2YDSA 3KBTA 3ZYKA 3LJCA 3UFGA 3C4XA 2E9XA 1IJ5A 4KX6A 3LBXA 3RRWA 2CWYA 4U2ZA 2R6GF 3P7IA 2I6HA 4WW0A 2NTXA 3CX7B 3AAAB 2DWGA 4BA9A 5HXSA 1OXZA 2NR4A 2LSJA 3L09A 2N1GA 2X67A 5HEUA 4COFA 3HA4A 3FZFB 1XDPA 3RKGA 2V8SV 1W0AA 5L3FB 3JAFA 3SOLA 5IYZE 2WP9A 4DR4T 3N9LA 3F57A 5ADXL 2MYSA 4IL9A 1S35A 2VQFT 2CBJA 2A2FX 2J62A 4Z8XA 2DNXA 1US7B 2V6YA 5TAOA 3ZMTB 2ZMAA 4AI6A 3OTOT 3CWZB 4B6XA 2ZM6T 2CBIA 5JDGA 3C51A 2H89A 2W0GA 3MZKB 1SA0E 4DIDB 3EI0A 1W09A 4JV5T 4PK6A 4IL4A 3J9X1 2IMLA 3T1YT 5L3EB 4LMKA 2E9XD 2PJQA 5DQWA 4ZI7E 5A1LA 3UU3A 4YTNA 3FBLA 1YKHB 4NIQA 3UQ7A 1XMOT 3FB2A 4B3MT 4GIWA 1E2AA 3ZYLA 3H37A 3I0OA 4C90A 3ZMUB 3L39A 2YDQA 4KP3C 3KV5A 4F8HA 4X66T 2CE7A 5JDFA 3HKEE 2LT3A 4IDQA 3NZQA 1J1JA 2AXDS 4TWDA 4MFRA 4WBNE 2XHEB 4DV4T 4IHJE 1NENA 4H9SE 4IDOA 1WR0A 1J5ET 1V9DA 3V5UA 2VKHA 1N36T 2EHOC 3F31A 2RPAA 4H9NC 3M3ZB 4HFIA 5LGUB 5FVLA 2VKOA 4QKNA 3FBZA 3KV4A 1ZHCA 1UX5A 1CHUA 3UFEA 3Q5DA 3O4XE 4Z91A 2FJDA 4CXYA 2IDOB 3JADA 4CXWA 4BAYB 2W67A 4GOUA 3AEEA 4HE8A 4KI0F 2F4VT 3V5SA 4V1Av 3SRZA 4TV9E 5LHHB 2G0UA 5LHIB 3UU5A 3TLWA 2C5JA 3IA3A 3KFWX 2NTYA 4O4JE 1UK5A 2V7MA 4PAGA 5JH7E 1MIYA 1JNZA 3RPUA 3UUBA 2CLYB 4P1NA 1IBMT 5KXJA 2UUCT 2KT9A 3PUGA 1N32T 1I94T 3NZPA 3T1HT 5J0ZA 2LSKA 1CUNA 3RYCE 2DI4A 3ONJA 1N34T 1M7KA 4CZZB 3LFMA 1HF8A 3HKDE 5LG4A 3LSVA 3C4ZA 1XMQT 1X9BA 2K5BB 3AE7A 5F5WA 2OA5A 1E1HB 3A8YC 4JEHB 2WDVA 3C64A 4EIWA 4ASKA 2LLYA 3CQCB 3AE6A 2FJAA 5AQSB 4NXMT 4TV8E 5J2TE 1U5PA 3VR9A 2W66A 1M62A 3B5MA 4AKIA 2CMRA 1Z8UA 4IE6A 2UXDT 3PUYF 4XAXB 2X9YA 4H9QC 2WSSV 4CN1A 3TKLB 3RKOA 3N2KE 3RRCA 2V1DB 1XDOA 4MBQA 3RYHE 3ETUA 1MMNA 4IE5A 4U33A 2WU2A 4FJOA 4DV3T 4XZCA 4PJJA 3NBXX 3AEGA 4H9PC 5LBQB 4PNIA 2WS3A 5ABGA 2A3DA 4MALA 2M6BA 3MXZA 2V7KA 2JQHA 2XAQB 5HCMA 4EYUA 4GK5E 2H7VC 4EZHA 3P4WA 2BS4A 2ZM8A 3P50A 4LF6T 2DWKA 4ZI3C 4ERRA 3TLVA 1KNPA 4B3ST 2IC6A 1IZNB 3CQXC 5JDMA 4HFCA 2YK0A 4UEMA 2ODUA 1HX1B 2PBIA 1BR0A 1DU2A 5L3DB 4PK5A 3H3MA 4TN7B 4YSYA 2YU1A 2IUBA 3L8RA 3HKCE 3NVOA 4YT0A 3TLSA 4U2YA 1D0ZA 2AE9A 3SFEA 3AE3A 3CIRA 1D1BA 3KINB 2JJ9A 4JLEA 3PU8A 3JAEA 3P4PA 5CA1E 1T72A 1HNZT 5FY0A 4I0UA 3O1IA 2KWIB 5JTGA 3VKGA 3K1SA 4IGUA 5FYMA 4OHFA 4LFAT 2IAKA 2LRLA 1HX8A 1ZKEA 5JDLA 4HWDA 5EK4A 3MK7C 4ZS3A 2D5UA 4O4LE 4H9OC 1ZEEA 4LF8T 2LRKA 4IDNA 3N2GE 2YEVC 3RH3A 3AE1A 1H7CA 4YSXA 2JMKA 4JI3T 3QNUA 3WAKA 3PUSA 1XZYA 4AXPA 4YJ2E 2W4XA 3UU4A 2CPTA 4ZI3D 4DV7T 3UTKA 4XBFB 4ZEYA 3BQIA 3EHZA 3OYXA 1Y64B 2RP4A 3R6NA 2BKNA 5HAXA 3QB5A 4GYSA 2JQQA 2UU9T 3RQWA 2A72A 1I6ZA 2VWAA 2ZLYA 1G73A 2B76A 2WAUA 1HG5A 4X1YE 2WMOA 4X64T 4DNDA 2FBWA 2H3RA 3UULA 4CXXA 1UGOA 3GN5B 3C4WA 3RYIE 5JDQA 2HPLA 3AECA 3RF1A 3P4SA 2EHOB 4IT4A 1ZV4X 2GK9A 3UQ4A 5JDHA 2BBJA 3AAEB 2IC9A 3PJAJ 3AEFA 5C8YE 4H63V 2PG8A 1XWMA 3EABA 3ETVA 2Y48B 3FZHB 5DABA 4QX8B 2CRBA 2KMFA 5IUXA 4IDZA 3D0TA 4CI1B 4GKKT 3ZCIA 5L3CB 3KVBA 2W2UA 2C0SA 1D1CA 3JC6D 4O2AE 3EDUA 3J7Yq 3ZC1A 4IIJE 3EAMA 3FZLB 2XQ7A 2XQ6A 4ADZA 4NUUA 4ZI2D 2WB5A 1QSDA 4X5TA 2D0TA 3K3QC 3K3OA 2XQ5A 4JUYA 5AQTB 4NXNT 3PUXF 1HNXT 5FXXA 5EK2A 3AAIA 3VU7H 5AQIB 3OVUA 3U3IA 1NWMX 3F2EA 2Z6EA 4KHPT 1SHZC 4CQIA 2W63A 2MBGA 3PDYA 4BJNA 4JI8T 4U31A 2L3LA 4H63H 4QH4A 3QB5K 1FMWA 1FIOA 3N9PA 1YD8G 2MPKA 2Y6XA 3VKHA 3FXEB 4K0KT 5BMVE 3PV0F 1YKEB 5HWYA 3RC3A 2XAHB 4P09A 3PUQA 4EOZB 2D9DA 2PFVA 1KF6A 2HN1A 3C98B 4QH1A 3N9OA 3HR0A 4ILCA 1EZ3A 5ABFB 1WYBA 4I50E 2LHNA 5L3GB 2LKGA 1WRDA 1LKXA 4X1IE 4ILBA 5IWAT 1LVKA 3Q5XA 3GN5A 2K3WA 4HN9A 4LFCT 2YINA 2BVLA 4QXHB 3ZC0A 4HFBA 2X66A 2NW9A 5FMNA 2EHOA 3RGLA 3KV9A 5LMUT 2WU5A 2YN6A 2WZIA 3UT5E 3HL6A 5H6QB 4ILAA 5JR9C 2RA1A 4U74A 3MJXA 4O4HE 4LF5T 3PU3A 5E0OA 1UX4A 2M6IA 2W61A 4L0RA 2DCFA 2FJEA 4EEDA 2WCAA 2J47A 2BVMA 3Q2MA 5DQVA 4DR6T 2VURA 1IBLT 3LK42 4JEUB 3CQGB 2I59A 4P0AA 4IE7A 2QGSA 3UUXB 4DMVA 2LM2A 5CA0E 3ZLIA 1VRBA 2KXPB 4JI7T 2CXFA 3VRBA 2N2NA 1HFAA 1OEDC 3LG7A 3P8CD 2I0MA 2CXLA 3UUNA 2J4GA 4YJ3E 4B3RT 5AQJB 3EUHA 2QVAA 2NW7A 3LK2B 2E5LT 4IDPA 4CN6A 4DV6T 3RIUA 4JI6T 4YSZA 3ZCJA 5AQGB 3KV6A 2DHRA 4AISA 4QHOA 3FZKB 3RIUC 3AEBA 2NWBA 2DL1A 2IHR1 2EHOD 4CI2B 5JREA 2V5DA 3N9QA 3PUWF 3AE4A 4B3TT 3ZMVB 3FHNA 2PTFA 4ISTA 1ZOYA 3RI5A 3DJBA 2CWOA 2JMHA 3T8OA 4UXNB 2UXBT 5CB4E 3ZN1B 1MMAA 3GWHA 2JIWA 3MACA 2HN2A 5ABFA 2KSRA 3ZKRA 3PJAA 3R84B 1VOMA 3ZYMA 3QUJA 2BDEA 3LK3B 3AE2A 2X0HA 2X9XA 5HEGA 2K24A 1MIWA 2V5CA 3I9YA 2BZBA 3KDSE 3CKDA 3ABVA 5AQVB 5LBMA 4HFHA 2FUPA 4WBOA 1Y01A 5KDMC 2HPJA 4J2CA 5M4YA 2BG9C 1UCUA 2XAGB 2XM2A 4LFBT 3RYFE 4DBQA 2BKOA 2QRXA 3BQLA 4OYKA 2IIUA 4Z90A 4GK0E 4OK0A 4KBMB 4G63A 4U7YA 3UU6A 5JDNA 5LXTE 2L9QA 2W00A 4FI5A 4PJNA 4JI0T 3PUAA 4JI1T 5HYAA 2W62A 3H3AA 3ZJ1A 2C5KT 5F3JA 2YOEA 1LVFA 5AQNB 4DUZT 4PK4A 5JQGE 4X1KE 1HR0T 1T7SA 3OYZA 4PJMA 4JBWF 4A98A 1OEDE 1NEKA 1UUSA 2CXDA 1L0VA 5AQOB 3HI2A 2X68A 3AE9A 1YQ4A 1QLBA 4NPPA 4YLHA 2VQET 4EGWA 2D2SA 2JQ9A 2H88A 4TX5A 3AVSA 3ZSTA 2VKDA 3AEAA 2UUBT 3ONXA 3ZT7A 2XY8B 4KUMB 4ISSA 2FJBA 3EVYA 2BS3A 3A7MA 3QK6A 5AQQB 4ZZBA 4ZXLA 4GYRA 1IJ6A 4IE0A 5HXEA 3N9MA 5HXHA 2K48A 1VCTA 1XNRT 2ZM0A 3AA7B 5LJNA 4AKLA 3P4QA 5FVKA 1W9RA 4I4TE 4DVDA 5LGNB 2UXNB 4ZS2A 5BR8T 3L3PA 5L4HA 2WWVA 2CM0A 3UU8A 3K3NA 4QXCB 1MNDA 3TLTA 3S4UA 5J1GA 2Q9QC 3Q9DA 3JCFA 2P9BA 3OBVE 3RIAA 4E7ZA 3I9WA 4GKJT 5LOVE 1D0XA 4TNVA 4I55E 4LMJA 4UV8B 1D1AA 2NOXA 2B1EA 2V26A 4KHZF 2BG9E 1D0YA 1N33T 2M67A 5AQPB 4YXDA 2WDQA 5LA6E 4DR1T 4AQFA 4G2AA 4UELA 3IF8B 5JR9B 2LE8A 3EDVA 4EZ4A 2E5VA 3E22E 1MIVA 4O2BE 4AQFC 5F8PA 1MMDA 4MHCA 2ZM2A 5HXCA 3B13A 3RC8A 4UV9B 3QOFA 5GONE 3QC9A 4YTPA 2X0YA 1ZP0A 5LYJE 3G06A 5IHYA 1SUMB 2CHNA 2WQYA 1R8IA 2H7OA 4K0UA 3N2OA 2LM9A 1HTJF 2CEAA 2MAWA 3CVRA 5JVDE 1SE7A 1E7PA 3CPZA 2E9XC 2LHRA 2CCQA 5L4EA 2NW8A 3I0QA 3U78A 2X51A 1OEDB 4X65T 2Q9QD 5ETWA 4CI3B 5FNVE 5FY1A 4AQGA 4JI4T 1KFYA 5ABHA 3I1AA 3BQKA 2MOZA 2BS2A 4YFSA 4HFDA 3SS1A 3A5XA 2JPFA 5AQKB 4PFOA 3AA0B 5H6RB 4ZOLE 4DV1T 3PTRB 3Q5WA 3C50A 3CK6A 2IW5B 2XSAA 1IBKT 5HEJA
chains in the Genus database with same CATH topology
5AQMB 3LDQB 4HWCA 3FZHB 5AQGB 2D9DA 3FZMB 5AQVB 5AQHB 5AQKB 5AQFB 3A8YC 5AQIB 3FZLB 3FZKB 3M3ZB 5AQOB 4HWHA 1UK5A 1I6ZA 1UGOA 5AQJB 5AQRB 4HWIB 5AQSB 5AQUB 1M7KA 5AQNB 5AQTB 5AQQB 4HWDA 1HX1B 5AQPB 4HWFA 3FZFB 1T7SA 1M62A 5AQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQM B;  3LDQ B;  4HWC A;  3FZH B;  5AQG B;  2D9D A;  3FZM B;  5AQV B;  5AQH B;  5AQK B;  5AQF B;  3A8Y C;  5AQI B;  3FZL B;  3FZK B;  3M3Z B;  5AQO B;  4HWH A;  1UK5 A;  1I6Z A;  1UGO A;  5AQJ B;  5AQR B;  4HWI B;  5AQS B;  5AQU B;  1M7K A;  5AQN B;  5AQT B;  5AQQ B;  4HWD A;  1HX1 B;  5AQP B;  4HWF A;  3FZF B;  1T7S A;  1M62 A;  5AQL B; 
#chains in the Genus database with same CATH topology
 3O1H A;  3CX6 B;  3PUR A;  2ACX A;  5HCJ A;  5C3J A;  4DV2 T;  2WZH A;  3PUZ F;  2J1D G;  4HFE A;  5AQU B;  2XAF B;  3W15 B;  4WZX A;  2WMN A;  3RLF F;  4MLK A;  2QA7 A;  4LML A;  2KIN B;  4AKG A;  2XQ4 A;  4EV6 A;  1YW0 A;  2UXX B;  1HCI A;  2XQ9 A;  3KBU A;  3P4R A;  3E08 A;  3ZPO A;  5FKY A;  2UXC T;  3OKQ A;  4AKH A;  4O8S A;  5LP6 E;  1FMV A;  4YY3 T;  4HGA A;  3ZEF B;  3IEE A;  2WM9 A;  4JI5 T;  3DTO A;  1KNR A;  5JRC B;  2VVN A;  2XM1 A;  3E0Z A;  1JNR A;  3WI3 A;  4AQY T;  2V6X A;  1UUR A;  3GMI A;  2N9D A;  2BG9 B;  5FXV A;  3RHW A;  2VK9 A;  4DMW A;  1YXR A;  3SFD A;  5JR9 A;  4N78 D;  2OV9 A;  3AXJ B;  4U72 A;  4UF0 B;  3AVR A;  5FY7 A;  4AKR B;  4DR2 T;  1YQ3 A;  4M1P A;  1HG2 A;  2LOP A;  4H9R C;  3CML A;  4HEA A;  5LHG B;  5LG3 A;  4QH5 A;  4QX7 B;  2XQ3 A;  5AQL B;  5L47 A;  1WYC A;  2ES0 A;  1MNE A;  4U7I A;  4A56 A;  3ZSS A;  2A9U A;  4YHH T;  3O9X A;  3OJA A;  5FP3 A;  4L5G A;  5AQR B;  5FXZ A;  2QYW A;  2VKJ A;  4JYA T;  5FL1 A;  1OED A;  4HFV A;  5CFB A;  4TNW A;  2XQ8 A;  2DLR A;  3ESL A;  4X20 E;  4DR7 T;  3ONL C;  2JRK A;  1BR1 A;  2WY2 A;  2LEH A;  1T8B A;  1BR4 A;  4WNK A;  4ZHQ E;  4LF7 T;  2ODV A;  3CX8 B;  2XAJ B;  1Z0P A;  2JQK A;  4L9I A;  3Q5E A;  4TZ4 C;  3ANW B;  3ZN0 B;  5FL0 A;  2SPC A;  1IAP A;  2XUE A;  4PFP A;  1WCR A;  4EXT A;  2CHO A;  3PUV F;  4YHJ A;  3ZT6 A;  4EYY R;  2L8K A;  4NUV A;  2ACZ A;  4Q25 A;  4ILU A;  4TWF A;  2XAS B;  3N5L A;  3N9N A;  4KMC A;  3AE5 A;  4OX9 T;  1KNZ A;  3RQU A;  4LF4 T;  5LCY A;  3ZJ2 A;  2E8I A;  1B7T A;  4HWH A;  2HH7 A;  4PJL A;  4DV0 T;  2XQA A;  5LJM A;  2C5I T;  4YTM A;  2XSB A;  2LSI A;  5KX5 E;  5HWX A;  1J5W A;  2Q9Q B;  4UR9 A;  5JRC A;  3ZMS B;  3VHL A;  2LJL A;  5CGM A;  4HWC A;  2WDR A;  5HEO A;  5AFU L;  2BG9 A;  5LMN T;  1G8X A;  1W0B A;  2X9H A;  2VB6 A;  2VL0 A;  4OYJ A;  2Y8D A;  3AXJ A;  4UF0 A;  5LB7 B;  2LSY A;  4DR5 T;  3NRY A;  1AJ3 A;  4F6R C;  3FZM B;  5HXR A;  2V7I A;  2YDR A;  2XQY A;  4EEB A;  1WFD A;  1T98 A;  3AA1 B;  5HEH A;  4QXB B;  3VR8 A;  3RIF A;  3IBP A;  2MTQ A;  2UUA T;  1NAF A;  2KND A;  3HKB E;  2BKP A;  1QUU A;  3AB3 B;  1FEW A;  5KMG P;  4C91 A;  3TLU A;  2V7L A;  2V7J A;  3DP7 A;  4AIU A;  4WYV A;  2BBH A;  2E9X B;  4IRE A;  5L2L A;  4DV5 T;  2D0U A;  4DO0 A;  3LBX B;  1MMG A;  4HWI B;  3X1D A;  1O3X A;  4A97 A;  1U4Q A;  3ANW A;  3RX6 A;  1BR2 A;  4JI2 T;  4EB6 E;  2X9W A;  3ZMZ B;  3UUM A;  4I43 B;  3M65 A;  3AA6 B;  5AQH B;  1FJG T;  4UVA B;  4PW8 A;  3OPC A;  2VAS A;  3NRX A;  5FXW A;  4ANJ A;  2YKS A;  3BK9 A;  2X0L B;  2XPK A;  5EK3 A;  3MKD A;  1HNW T;  3AE8 A;  2XZE A;  3NKZ A;  2CLY C;  4TWH A;  2WWU A;  5EZY E;  2KLQ A;  5ABE A;  4CN4 A;  5AQF B;  4P0B A;  4X62 T;  1XNQ T;  4ZZC A;  5L3B B;  1S94 A;  1HS7 A;  4LF9 T;  3SWH A;  2V6Y B;  2XJ7 A;  4UVC B;  5LGT B;  4HWF A;  3MA9 A;  3FXD B;  5AQM B;  4A5X A;  3K8P C;  3WAJ A;  3O1J A;  2Q9Q A;  2LSG A;  2WBL A;  2E2A A;  2XTL A;  4O4I E;  5DJQ C;  2CA5 A;  4TUY E;  4UIG A;  2LOS A;  1KK7 A;  1LRZ A;  4HKA A;  4DR3 T;  4DBR A;  2OLT A;  5C2T A;  5J2U E;  1OWA A;  1KEY A;  3JC6 C;  4BJM A;  3LDQ B;  2NP9 A;  1WLX A;  2HHH T;  4E7S A;  5LNK A;  3VRA A;  2VL8 A;  3NWI A;  4EAH A;  3IHR A;  4ZI2 C;  1GQE A;  2YU2 A;  3KVA A;  1VCS A;  4IE4 A;  3AED A;  2KWH A;  3ZT5 A;  2VVS A;  3GA8 A;  3PE0 A;  3B57 A;  1X79 A;  2K9A A;  4OFZ A;  1WR6 A;  2KZ7 B;  2LKH A;  4DUY T;  4U3C A;  4UVB B;  4QWN B;  4HTE A;  5CJ5 A;  2YDS A;  3KBT A;  3ZYK A;  3LJC A;  3UFG A;  3C4X A;  2E9X A;  1IJ5 A;  4KX6 A;  3LBX A;  3RRW A;  2CWY A;  4U2Z A;  2R6G F;  3P7I A;  2I6H A;  4WW0 A;  2NTX A;  3CX7 B;  3AAA B;  2DWG A;  4BA9 A;  5HXS A;  1OXZ A;  2NR4 A;  2LSJ A;  3L09 A;  2N1G A;  2X67 A;  5HEU A;  4COF A;  3HA4 A;  3FZF B;  1XDP A;  3RKG A;  2V8S V;  1W0A A;  5L3F B;  3JAF A;  3SOL A;  5IYZ E;  2WP9 A;  4DR4 T;  3N9L A;  3F57 A;  5ADX L;  2MYS A;  4IL9 A;  1S35 A;  2VQF T;  2CBJ A;  2A2F X;  2J62 A;  4Z8X A;  2DNX A;  1US7 B;  2V6Y A;  5TAO A;  3ZMT B;  2ZMA A;  4AI6 A;  3OTO T;  3CWZ B;  4B6X A;  2ZM6 T;  2CBI A;  5JDG A;  3C51 A;  2H89 A;  2W0G A;  3MZK B;  1SA0 E;  4DID B;  3EI0 A;  1W09 A;  4JV5 T;  4PK6 A;  4IL4 A;  3J9X 1;  2IML A;  3T1Y T;  5L3E B;  4LMK A;  2E9X D;  2PJQ A;  5DQW A;  4ZI7 E;  5A1L A;  3UU3 A;  4YTN A;  3FBL A;  1YKH B;  4NIQ A;  3UQ7 A;  1XMO T;  3FB2 A;  4B3M T;  4GIW A;  1E2A A;  3ZYL A;  3H37 A;  3I0O A;  4C90 A;  3ZMU B;  3L39 A;  2YDQ A;  4KP3 C;  3KV5 A;  4F8H A;  4X66 T;  2CE7 A;  5JDF A;  3HKE E;  2LT3 A;  4IDQ A;  3NZQ A;  1J1J A;  2AXD S;  4TWD A;  4MFR A;  4WBN E;  2XHE B;  4DV4 T;  4IHJ E;  1NEN A;  4H9S E;  4IDO A;  1WR0 A;  1J5E T;  1V9D A;  3V5U A;  2VKH A;  1N36 T;  2EHO C;  3F31 A;  2RPA A;  4H9N C;  3M3Z B;  4HFI A;  5LGU B;  5FVL A;  2VKO A;  4QKN A;  3FBZ A;  3KV4 A;  1ZHC A;  1UX5 A;  1CHU A;  3UFE A;  3Q5D A;  3O4X E;  4Z91 A;  2FJD A;  4CXY A;  2IDO B;  3JAD A;  4CXW A;  4BAY B;  2W67 A;  4GOU A;  3AEE A;  4HE8 A;  4KI0 F;  2F4V T;  3V5S A;  4V1A v;  3SRZ A;  4TV9 E;  5LHH B;  2G0U A;  5LHI B;  3UU5 A;  3TLW A;  2C5J A;  3IA3 A;  3KFW X;  2NTY A;  4O4J E;  1UK5 A;  2V7M A;  4PAG A;  5JH7 E;  1MIY A;  1JNZ A;  3RPU A;  3UUB A;  2CLY B;  4P1N A;  1IBM T;  5KXJ A;  2UUC T;  2KT9 A;  3PUG A;  1N32 T;  1I94 T;  3NZP A;  3T1H T;  5J0Z A;  2LSK A;  1CUN A;  3RYC E;  2DI4 A;  3ONJ A;  1N34 T;  1M7K A;  4CZZ B;  3LFM A;  1HF8 A;  3HKD E;  5LG4 A;  3LSV A;  3C4Z A;  1XMQ T;  1X9B A;  2K5B B;  3AE7 A;  5F5W A;  2OA5 A;  1E1H B;  3A8Y C;  4JEH B;  2WDV A;  3C64 A;  4EIW A;  4ASK A;  2LLY A;  3CQC B;  3AE6 A;  2FJA A;  5AQS B;  4NXM T;  4TV8 E;  5J2T E;  1U5P A;  3VR9 A;  2W66 A;  1M62 A;  3B5M A;  4AKI A;  2CMR A;  1Z8U A;  4IE6 A;  2UXD T;  3PUY F;  4XAX B;  2X9Y A;  4H9Q C;  2WSS V;  4CN1 A;  3TKL B;  3RKO A;  3N2K E;  3RRC A;  2V1D B;  1XDO A;  4MBQ A;  3RYH E;  3ETU A;  1MMN A;  4IE5 A;  4U33 A;  2WU2 A;  4FJO A;  4DV3 T;  4XZC A;  4PJJ A;  3NBX X;  3AEG A;  4H9P C;  5LBQ B;  4PNI A;  2WS3 A;  5ABG A;  2A3D A;  4MAL A;  2M6B A;  3MXZ A;  2V7K A;  2JQH A;  2XAQ B;  5HCM A;  4EYU A;  4GK5 E;  2H7V C;  4EZH A;  3P4W A;  2BS4 A;  2ZM8 A;  3P50 A;  4LF6 T;  2DWK A;  4ZI3 C;  4ERR A;  3TLV A;  1KNP A;  4B3S T;  2IC6 A;  1IZN B;  3CQX C;  5JDM A;  4HFC A;  2YK0 A;  4UEM A;  2ODU A;  1HX1 B;  2PBI A;  1BR0 A;  1DU2 A;  5L3D B;  4PK5 A;  3H3M A;  4TN7 B;  4YSY A;  2YU1 A;  2IUB A;  3L8R A;  3HKC E;  3NVO A;  4YT0 A;  3TLS A;  4U2Y A;  1D0Z A;  2AE9 A;  3SFE A;  3AE3 A;  3CIR A;  1D1B A;  3KIN B;  2JJ9 A;  4JLE A;  3PU8 A;  3JAE A;  3P4P A;  5CA1 E;  1T72 A;  1HNZ T;  5FY0 A;  4I0U A;  3O1I A;  2KWI B;  5JTG A;  3VKG A;  3K1S A;  4IGU A;  5FYM A;  4OHF A;  4LFA T;  2IAK A;  2LRL A;  1HX8 A;  1ZKE A;  5JDL A;  4HWD A;  5EK4 A;  3MK7 C;  4ZS3 A;  2D5U A;  4O4L E;  4H9O C;  1ZEE A;  4LF8 T;  2LRK A;  4IDN A;  3N2G E;  2YEV C;  3RH3 A;  3AE1 A;  1H7C A;  4YSX A;  2JMK A;  4JI3 T;  3QNU A;  3WAK A;  3PUS A;  1XZY A;  4AXP A;  4YJ2 E;  2W4X A;  3UU4 A;  2CPT A;  4ZI3 D;  4DV7 T;  3UTK A;  4XBF B;  4ZEY A;  3BQI A;  3EHZ A;  3OYX A;  1Y64 B;  2RP4 A;  3R6N A;  2BKN A;  5HAX A;  3QB5 A;  4GYS A;  2JQQ A;  2UU9 T;  3RQW A;  2A72 A;  1I6Z A;  2VWA A;  2ZLY A;  1G73 A;  2B76 A;  2WAU A;  1HG5 A;  4X1Y E;  2WMO A;  4X64 T;  4DND A;  2FBW A;  2H3R A;  3UUL A;  4CXX A;  1UGO A;  3GN5 B;  3C4W A;  3RYI E;  5JDQ A;  2HPL A;  3AEC A;  3RF1 A;  3P4S A;  2EHO B;  4IT4 A;  1ZV4 X;  2GK9 A;  3UQ4 A;  5JDH A;  2BBJ A;  3AAE B;  2IC9 A;  3PJA J;  3AEF A;  5C8Y E;  4H63 V;  2PG8 A;  1XWM A;  3EAB A;  3ETV A;  2Y48 B;  3FZH B;  5DAB A;  4QX8 B;  2CRB A;  2KMF A;  5IUX A;  4IDZ A;  3D0T A;  4CI1 B;  4GKK T;  3ZCI A;  5L3C B;  3KVB A;  2W2U A;  2C0S A;  1D1C A;  3JC6 D;  4O2A E;  3EDU A;  3J7Y q;  3ZC1 A;  4IIJ E;  3EAM A;  3FZL B;  2XQ7 A;  2XQ6 A;  4ADZ A;  4NUU A;  4ZI2 D;  2WB5 A;  1QSD A;  4X5T A;  2D0T A;  3K3Q C;  3K3O A;  2XQ5 A;  4JUY A;  5AQT B;  4NXN T;  3PUX F;  1HNX T;  5FXX A;  5EK2 A;  3AAI A;  3VU7 H;  5AQI B;  3OVU A;  3U3I A;  1NWM X;  3F2E A;  2Z6E A;  4KHP T;  1SHZ C;  4CQI A;  2W63 A;  2MBG A;  3PDY A;  4BJN A;  4JI8 T;  4U31 A;  2L3L A;  4H63 H;  4QH4 A;  3QB5 K;  1FMW A;  1FIO A;  3N9P A;  1YD8 G;  2MPK A;  2Y6X A;  3VKH A;  3FXE B;  4K0K T;  5BMV E;  3PV0 F;  1YKE B;  5HWY A;  3RC3 A;  2XAH B;  4P09 A;  3PUQ A;  4EOZ B;  2D9D A;  2PFV A;  1KF6 A;  2HN1 A;  3C98 B;  4QH1 A;  3N9O A;  3HR0 A;  4ILC A;  1EZ3 A;  5ABF B;  1WYB A;  4I50 E;  2LHN A;  5L3G B;  2LKG A;  1WRD A;  1LKX A;  4X1I E;  4ILB A;  5IWA T;  1LVK A;  3Q5X A;  3GN5 A;  2K3W A;  4HN9 A;  4LFC T;  2YIN A;  2BVL A;  4QXH B;  3ZC0 A;  4HFB A;  2X66 A;  2NW9 A;  5FMN A;  2EHO A;  3RGL A;  3KV9 A;  5LMU T;  2WU5 A;  2YN6 A;  2WZI A;  3UT5 E;  3HL6 A;  5H6Q B;  4ILA A;  5JR9 C;  2RA1 A;  4U74 A;  3MJX A;  4O4H E;  4LF5 T;  3PU3 A;  5E0O A;  1UX4 A;  2M6I A;  2W61 A;  4L0R A;  2DCF A;  2FJE A;  4EED A;  2WCA A;  2J47 A;  2BVM A;  3Q2M A;  5DQV A;  4DR6 T;  2VUR A;  1IBL T;  3LK4 2;  4JEU B;  3CQG B;  2I59 A;  4P0A A;  4IE7 A;  2QGS A;  3UUX B;  4DMV A;  2LM2 A;  5CA0 E;  3ZLI A;  1VRB A;  2KXP B;  4JI7 T;  2CXF A;  3VRB A;  2N2N A;  1HFA A;  1OED C;  3LG7 A;  3P8C D;  2I0M A;  2CXL A;  3UUN A;  2J4G A;  4YJ3 E;  4B3R T;  5AQJ B;  3EUH A;  2QVA A;  2NW7 A;  3LK2 B;  2E5L T;  4IDP A;  4CN6 A;  4DV6 T;  3RIU A;  4JI6 T;  4YSZ A;  3ZCJ A;  5AQG B;  3KV6 A;  2DHR A;  4AIS A;  4QHO A;  3FZK B;  3RIU C;  3AEB A;  2NWB A;  2DL1 A;  2IHR 1;  2EHO D;  4CI2 B;  5JRE A;  2V5D A;  3N9Q A;  3PUW F;  3AE4 A;  4B3T T;  3ZMV B;  3FHN A;  2PTF A;  4IST A;  1ZOY A;  3RI5 A;  3DJB A;  2CWO A;  2JMH A;  3T8O A;  4UXN B;  2UXB T;  5CB4 E;  3ZN1 B;  1MMA A;  3GWH A;  2JIW A;  3MAC A;  2HN2 A;  5ABF A;  2KSR A;  3ZKR A;  3PJA A;  3R84 B;  1VOM A;  3ZYM A;  3QUJ A;  2BDE A;  3LK3 B;  3AE2 A;  2X0H A;  2X9X A;  5HEG A;  2K24 A;  1MIW A;  2V5C A;  3I9Y A;  2BZB A;  3KDS E;  3CKD A;  3ABV A;  5AQV B;  5LBM A;  4HFH A;  2FUP A;  4WBO A;  1Y01 A;  5KDM C;  2HPJ A;  4J2C A;  5M4Y A;  2BG9 C;  1UCU A;  2XAG B;  2XM2 A;  4LFB T;  3RYF E;  4DBQ A;  2BKO A;  2QRX A;  3BQL A;  4OYK A;  2IIU A;  4Z90 A;  4GK0 E;  4OK0 A;  4KBM B;  4G63 A;  4U7Y A;  3UU6 A;  5JDN A;  5LXT E;  2L9Q A;  2W00 A;  4FI5 A;  4PJN A;  4JI0 T;  3PUA A;  4JI1 T;  5HYA A;  2W62 A;  3H3A A;  3ZJ1 A;  2C5K T;  5F3J A;  2YOE A;  1LVF A;  5AQN B;  4DUZ T;  4PK4 A;  5JQG E;  4X1K E;  1HR0 T;  1T7S A;  3OYZ A;  4PJM A;  4JBW F;  4A98 A;  1OED E;  1NEK A;  1UUS A;  2CXD A;  1L0V A;  5AQO B;  3HI2 A;  2X68 A;  3AE9 A;  1YQ4 A;  1QLB A;  4NPP A;  4YLH A;  2VQE T;  4EGW A;  2D2S A;  2JQ9 A;  2H88 A;  4TX5 A;  3AVS A;  3ZST A;  2VKD A;  3AEA A;  2UUB T;  3ONX A;  3ZT7 A;  2XY8 B;  4KUM B;  4ISS A;  2FJB A;  3EVY A;  2BS3 A;  3A7M A;  3QK6 A;  5AQQ B;  4ZZB A;  4ZXL A;  4GYR A;  1IJ6 A;  4IE0 A;  5HXE A;  3N9M A;  5HXH A;  2K48 A;  1VCT A;  1XNR T;  2ZM0 A;  3AA7 B;  5LJN A;  4AKL A;  3P4Q A;  5FVK A;  1W9R A;  4I4T E;  4DVD A;  5LGN B;  2UXN B;  4ZS2 A;  5BR8 T;  3L3P A;  5L4H A;  2WWV A;  2CM0 A;  3UU8 A;  3K3N A;  4QXC B;  1MND A;  3TLT A;  3S4U A;  5J1G A;  2Q9Q C;  3Q9D A;  3JCF A;  2P9B A;  3OBV E;  3RIA A;  4E7Z A;  3I9W A;  4GKJ T;  5LOV E;  1D0X A;  4TNV A;  4I55 E;  4LMJ A;  4UV8 B;  1D1A A;  2NOX A;  2B1E A;  2V26 A;  4KHZ F;  2BG9 E;  1D0Y A;  1N33 T;  2M67 A;  5AQP B;  4YXD A;  2WDQ A;  5LA6 E;  4DR1 T;  4AQF A;  4G2A A;  4UEL A;  3IF8 B;  5JR9 B;  2LE8 A;  3EDV A;  4EZ4 A;  2E5V A;  3E22 E;  1MIV A;  4O2B E;  4AQF C;  5F8P A;  1MMD A;  4MHC A;  2ZM2 A;  5HXC A;  3B13 A;  3RC8 A;  4UV9 B;  3QOF A;  5GON E;  3QC9 A;  4YTP A;  2X0Y A;  1ZP0 A;  5LYJ E;  3G06 A;  5IHY A;  1SUM B;  2CHN A;  2WQY A;  1R8I A;  2H7O A;  4K0U A;  3N2O A;  2LM9 A;  1HTJ F;  2CEA A;  2MAW A;  3CVR A;  5JVD E;  1SE7 A;  1E7P A;  3CPZ A;  2E9X C;  2LHR A;  2CCQ A;  5L4E A;  2NW8 A;  3I0Q A;  3U78 A;  2X51 A;  1OED B;  4X65 T;  2Q9Q D;  5ETW A;  4CI3 B;  5FNV E;  5FY1 A;  4AQG A;  4JI4 T;  1KFY A;  5ABH A;  3I1A A;  3BQK A;  2MOZ A;  2BS2 A;  4YFS A;  4HFD A;  3SS1 A;  3A5X A;  2JPF A;  5AQK B;  4PFO A;  3AA0 B;  5H6R B;  4ZOL E;  4DV1 T;  3PTR B;  3Q5W A;  3C50 A;  3CK6 A;  2IW5 B;  2XSA A;  1IBK T;  5HEJ A; 
#chains in the Genus database with same CATH homology
 5AQM B;  3LDQ B;  4HWC A;  3FZH B;  5AQG B;  2D9D A;  3FZM B;  5AQV B;  5AQH B;  5AQK B;  5AQF B;  3A8Y C;  5AQI B;  3FZL B;  3FZK B;  3M3Z B;  5AQO B;  4HWH A;  1UK5 A;  1I6Z A;  1UGO A;  5AQJ B;  5AQR B;  4HWI B;  5AQS B;  5AQU B;  1M7K A;  5AQN B;  5AQT B;  5AQQ B;  4HWD A;  1HX1 B;  5AQP B;  4HWF A;  3FZF B;  1T7S A;  1M62 A;  5AQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...