3FZKB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 49
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzkB00
5AQLB 5AQHB 5AQMB 1UK5A 3FZLB 1M62A 1T7SA 5AQGB 5AQTB 5AQJB 2D9DA 1HX1B 5AQRB 4HWDA 5AQUB 3FZMB 4HWCA 5AQQB 4HWFA 3FZFB 4HWIB 3FZKB 3A8YC 5AQPB 5AQSB 5AQVB 3M3ZB 5AQKB 5AQNB 4HWHA 3LDQB 5AQOB 1I6ZA 3FZHB 1UGOA 5AQIB 5AQFB 1M7KA
chains in the Genus database with same CATH superfamily
2XY8B 4P0AA 2FJAA 4DIDB 4JI2T 1HG5A 4AXPA 4CXXA 4H9PC 4BJNA 3ZC1A 5ETWA 1B7TA 3A8YC 3AE3A 4QKNA 3CWZB 1FIOA 4X5TA 2MOZA 5JRCB 4K0KT 1R8IA 2V7IA 2W61A 3AE9A 2H88A 1NWMX 3TLTA 2N2NA 2AXDS 2MPKA 1YKHB 3H37A 3X1DA 5FY7A 4LMLA 1HNXT 2HH7A 4HFBA 1ZOYA 2XM2A 5LG4A 2UXXB 2KNDA 2HN2A 2BVLA 1E7PA 2IW5B 1OEDA 2ACZA 4WZXA 2C5JA 5H6RB 2BDEA 2XPKA 4CXYA 1WR6A 2NP9A 1IJ5A 1OEDE 5FP3A 3QC9A 4LFAT 2E8IA 1BR0A 3AEBA 4YY3T 2KSRA 4XAXB 1OXZA 3JADA 2FJEA 4ZS2A 1YXRA 2MTQA 1WLXA 1GQEA 3ZKRA 1WRDA 3Q5EA 3P8CD 5HXCA 4TNVA 1YW0A 1Z8UA 3MK7C 1MIYA 2VKJA 4IGUA 4QXHB 2K9AA 2D2SA 5J1GA 4IDQA 4GYSA 4ZI2C 5IYZE 2Y6XA 4B3TT 4V1Av 2BG9B 2CBJA 4H63V 4DR7T 2CE7A 2V5DA 2WDVA 2LSGA 3S4UA 4XZCA 3J9X1 3LJCA 1UGOA 1MNEA 4JI6T 3WAKA 3RF1A 5EK4A 2LKHA 4I4TE 3LBXB 2JJ9A 3H3AA 3UU5A 4BAYB 4HWHA 3RYFE 4F8HA 2RPAA 4NUUA 4DR4T 4UV9B 4AISA 3CX7B 4JV5T 3O1JA 4EIWA 1IBKT 2UUCT 3ZMTB 2XJ7A 5FMNA 3LSVA 3MXZA 3L8RA 3UUBA 4AQFA 1DU2A 3FZHB 5LG3A 4AKIA 1UCUA 1S35A 5ABFA 4JI3T 1US7B 4CN6A 3AEDA 4UV8B 2I0MA 4ILCA 2A72A 4ZI2D 3UQ7A 3OKQA 2EHOD 3PUYF 5AQSB 2V7JA 4KHPT 3PUQA 2WQYA 2E9XB 5AQFB 2WB5A 5FY1A 2PFVA 5J2UE 2KT9A 3PU3A 2XM1A 3ZMUB 5AQGB 1M62A 1N36T 4AKHA 4OYKA 2VASA 4PFOA 1QUUA 3PE0A 4EEDA 4U3CA 5LGNB 5KMGP 3CMLA 4ILBA 1Z0PA 1ZP0A 2M6IA 1D0XA 4AQYT 3LDQB 2CWOA 5JRCA 3LK3B 1M7KA 2VVSA 2W4XA 5JTGA 1YKEB 3HKBE 1UX4A 5DQVA 2H7OA 3ZN0B 3KV6A 2WDRA 2KWHA 3O4XE 2PG8A 4A5XA 4JI1T 4DR1T 4UIGA 3G06A 5FYMA 4WNKA 5LMUT 4WBNE 3C50A 4WW0A 5LA6E 4YLHA 1G8XA 5LJNA 2C0SA 3P4RA 3NBXX 2UUBT 4HTEA 3PDYA 4KP3C 4UR9A 4CZZB 2DNXA 2BBJA 2XTLA 4L9IA 2XUEA 4NXNT 2YDSA 1T72A 2B1EA 2BZBA 4O4IE 2H89A 2I6HA 3OPCA 2WAUA 3KVBA 2YINA 5LHIB 5FVKA 2GK9A 4IE6A 1LRZA 4YSYA 2CXLA 3AECA 4CI2B 2Q9QA 2VKOA 2X66A 3PUAA 4KBMB 5HWXA 2BG9A 2KINB 1J5WA 2XQ4A 4G2AA 2IC9A 1FMWA 4GK5E 2LEHA 3N2KE 1EZ3A 4F6RC 3C4ZA 3ESLA 2YN6A 1MMDA 2LT3A 4G63A 4DUYT 2VVNA 4ILAA 5HEGA 2Z6EA 4GIWA 3UTKA 1XDOA 1H7CA 3LBXA 3GN5A 3P50A 4NUVA 3U78A 1ZEEA 3L39A 2YEVC 4HFIA 4DR6T 3OBVE 2XAQB 3MJXA 4AQGA 4IE5A 4I43B 3AE7A 4I55E 5FKYA 2LSJA 3O1IA 4OHFA 4AKLA 5BMVE 2W66A 3ONLC 4DV1T 1MIVA 4DMWA 2WM9A 3FXEB 2E5VA 3GMIA 2J62A 3I9YA 4HFEA 5HWYA 3CVRA 4CI3B 2N9DA 2E9XA 1HNWT 2BVMA 3I0OA 3PUGA 4DV3T 1O3XA 3FZLB 5FXXA 3T8OA 1E2AA 4ZI7E 2PBIA 3QOFA 5L3EB 4HWFA 1MMNA 5FL1A 2ZMAA 4Z8XA 5L4EA 4UXNB 4EZHA 3RYHE 2Y8DA 3RQWA 2HPJA 3RIUC 5H6QB 5LGTB 4ISTA 4TWDA 5AQQB 3QUJA 4PAGA 4NIQA 3N9PA 5AFUL 4U72A 5HEUA 1N34T 5HXSA 3UQ4A 4ZZBA 3PU8A 2CPTA 4ZS3A 4L5GA 4I0UA 1D1AA 4M1PA 2JMKA 2CBIA 2XQ8A 3JAEA 2E9XD 1W9RA 5CB4E 2YK0A 5HAXA 3I0QA 4XBFB 5LB7B 4X65T 2JMHA 2CHNA 2RA1A 2M67A 2PJQA 3RH3A 3KBTA 2HN1A 1UX5A 3QB5K 3DTOA 2VB6A 3ANWB 1NENA 2LJLA 2IMLA 5JDQA 1OWAA 3AXJB 2ZM8A 3HL6A 3C4WA 4EB6E 4IDNA 3AE5A 3Q9DA 4BJMA 3EHZA 1W0AA 3M3ZB 3RKGA 2XQ3A 3VRAA 4EGWA 1Y01A 2UU9T 4ZEYA 3AA1B 5JR9C 3B57A 3VKGA 2G0UA 4YXDA 4QXCB 2LSYA 4TUYE 3JAFA 5L3FB 2JIWA 3ZMZB 2X51A 4JLEA 3ZT7A 4KX6A 5EK2A 3SS1A 4HFVA 3CPZA 1YQ3A 1KF6A 4AIUA 2LE8A 2XSBA 4DV0T 2WU2A 2MYSA 3GWHA 5JVDE 3EVYA 2ODVA 3BQKA 5FY0A 5FXWA 3ZCJA 1OEDC 2YKSA 1FMVA 5LNKA 2J4GA 2IC6A 2WS3A 4EXTA 1UK5A 2KLQA 5JDHA 4JI5T 3AE6A 1YQ4A 3AEEA 3SFDA 5AQKB 2UXDT 2WCAA 2WMNA 3N2OA 1VOMA 3HKCE 5AQMB 2X9XA 3KDSE 3VHLA 2VL0A 3KV4A 4HN9A 2BS3A 4DV4T 2XQ7A 2DLRA 4IT4A 1MIWA 4ZXLA 1ZKEA 3UULA 4YHJA 3QNUA 3RX6A 5L3BB 1D1CA 4IIJE 2EHOA 2X9HA 4PNIA 2LOPA 2DHRA 3RGLA 3BQIA 1CHUA 3VRBA 2FJBA 3AAAB 2C5IT 3HA4A 5LCYA 3TLUA 2YOEA 4DBRA 2IUBA 4B3MT 2CM0A 1CUNA 2QA7A 1T7SA 5FXVA 4ANJA 4KMCA 2XQAA 2IHR1 2K3WA 4DBQA 2UXBT 2BS4A 5HXHA 4LF7T 4CXWA 4LMKA 3KFWX 3AEGA 4AQFC 4JI0T 3Q5XA 5C8YE 3O9XA 5JREA 3QK6A 3ETUA 3AXJA 4X66T 1X79A 4TV8E 4P0BA 4BA9A 4PJLA 4ASKA 1FEWA 1I94T 1VCSA 4U33A 3P4SA 1WYBA 3RHWA 3KBUA 3PTRB 1IJ6A 2QGSA 4MLKA 3AAEB 4X1YE 3ZMSB 4DV2T 3HR0A 3SRZA 2WWVA 4AI6A 4ILUA 2LSKA 3UU3A 4LF6T 2VK9A 2NTXA 4UEMA 2XSAA 2XQ9A 4IE0A 4YJ3E 4C90A 1IZNB 2MBGA 2ACXA 5LHHB 3E22E 2D0TA 3K3OA 3K8PC 4DVDA 4FJOA 4OK0A 3DJBA 1BR1A 4O4JE 2WDQA 3OVUA 4B3RT 5AQLB 3ZT6A 3MA9A 2XZEA 4E7ZA 4UELA 4L0RA 4X1IE 2QYWA 3FB2A 4DR2T 3SWHA 2VQET 1WYCA 1IAPA 4HGAA 4QWNB 4PK4A 4UF0B 3B5MA 2F4VT 1E1HB 2JPFA 3FZFB 3U3IA 2RP4A 3AVRA 4IE4A 3CX8B 5JDLA 3RC8A 2MAWA 3RLFF 3C64A 3IF8B 2IIUA 1WCRA 3N9QA 3NWIA 2PTFA 3F31A 2LM9A 2KWIB 3RYIE 4GKJT 4HKAA 2A2FX 2X9YA 1XNQT 3CX6B 3EUHA 4IREA 4A56A 1QSDA 4ISSA 2H7VC 2Q9QC 5IHYA 4GOUA 2VKHA 3LFMA 1D0YA 1S94A 4JI7T 2BG9E 1XMQT 2KXPB 4YTMA 2YU1A 4X64T 5HCMA 4H9NC 3AA7B 2WP9A 5JR9B 5EK3A 1SA0E 2XQYA 2NW9A 3KVAA 2OLTA 3MACA 1KK7A 2ZM2A 5HEJA 3LG7A 3NVOA 3RIAA 5JH7E 2K48A 4QX8B 4PFPA 4QH5A 3TKLB 3NRYA 1MMGA 1VCTA 3OYXA 5J0ZA 2CMRA 3CQCB 2FJDA 4ZI3C 4QXBB 5EZYE 5DQWA 3MZKB 3AAIA 4U2YA 4U2ZA 1JNRA 3AE4A 4CN1A 1OEDB 3P4QA 2A9UA 3E0ZA 1HR0T 3B13A 1J5ET 3SOLA 4DUZT 1BR4A 2CLYC 4U7IA 2LRLA 3ZJ1A 5ABEA 3NKZA 4CI1B 5FNVE 2BKNA 2XAFB 1KFYA 3ZSTA 3VKHA 4YT0A 4HWCA 2FUPA 4JUYA 2Y48B 3EDUA 4JEUB 1NEKA 2YDQA 1NAFA 3ABVA 5CA1E 1VRBA 4U7YA 3UUNA 4IE7A 4EZ4A 2CRBA 4C91A 3F2EA 1U4QA 5L2LA 3AVSA 5E0OA 4IHJE 1ZV4X 1XDPA 4TV9E 3IA3A 4EAHA 3A7MA 2E2AA 3DP7A 5L3DB 4ZI3D 4LFBT 2JRKA 2D5UA 2DWGA 1HX8A 3PJAJ 3ZC0A 3UFEA 5J2TE 4COFA 5HCJA 4MALA 4UVBB 4YSXA 2NWBA 2FBWA 4TWHA 2DL1A 5JDNA 4IDPA 4B6XA 2BBHA 3Q5WA 4YSZA 5ABGA 2CXDA 1IBLT 1N33T 2NOXA 4IL9A 3ZYLA 2XAHB 2V6YB 2JQQA 2UXNB 4U74A 2V7LA 4ZHQE 5HXRA 3CKDA 5F3JA 1D0ZA 1LVKA 5F8PA 4KI0F 4CQIA 2K5BB 4QX7B 4OFZA 2R6GF 5ABFB 3HKEE 4K0UA 2ZM6T 4N78D 5AQHB 1JNZA 4H9SE 4MBQA 5ADXL 3JC6C 3R6NA 3UT5E 3OTOT 2LLYA 2WU5A 5LBMA 5HYAA 2XASB 2CEAA 2I59A 5JR9A 2ES0A 2UUAT 3N9NA 1HG2A 2IDOB 3K3NA 1T98A 3EDVA 4LMJA 4NXMT 4UVAB 2H3RA 2WMOA 5AQPB 3KV5A 2L8KA 3PJAA 4TWFA 3P4WA 3AE2A 3FXDB 4U31A 4DMVA 4O4LE 4YJ2E 1IBMT 1G73A 3C4XA 4PK6A 3ZPOA 2NW8A 4OYJA 1LKXA 4WBOA 5GONE 4PJJA 2AE9A 3EI0A 2W67A 5TAOA 5LMNT 5AQTB 2WY2A 2X9WA 3HI2A 2VKDA 4KHZF 4IDOA 4O2BE 3ZT5A 2V1DB 3JC6D 5C3JA 2C5KT 4DO0A 3LK42 1N32T 1HCIA 2CXFA 4LF8T 4EEBA 3ONXA 3W15B 5CA0E 4HE8A 3ZMVB 3OYZA 2NW7A 2OA5A 4GK0E 4HFDA 4HWDA 3VU7H 2A3DA 5L3CB 3N9MA 5FVLA 2D0UA 4H9OC 2IAKA 2V7MA 5KXJA 5HEOA 4YTNA 3TLSA 2W00A 3CK6A 4ADZA 3RPUA 2DI4A 2W63A 2Q9QB 2EHOC 2CHOA 2K24A 3PUXF 2X68A 3IHRA 5BR8T 3ZYMA 5JDGA 4ZZCA 2HPLA 3Q5DA 2W0GA 2V6XA 2BKPA 3PUVF 4X20E 3EABA 1XZYA 5LP6E 4GYRA 3N9LA 5L4HA 2CWYA 4IDZA 2WSSV 2HHHT 4AKGA 3IBPA 3GN5B 3C51A 3TLVA 4LF9T 3ANWA 3RI5A 3K3QC 3FHNA 1LVFA 4Z90A 3RRWA 1HTJF 2WZHA 3RRCA 2X0YA 2ZM0A 1XNRT 2W62A 5FL0A 2J1DG 4JYAT 2V7KA 2V6YA 2JQHA 3UU6A 3ZYKA 2E5LT 4HFCA 3RQUA 2KZ7B 2VWAA 2X0HA 2OV9A 4TNWA 1HNZT 4KUMB 2D9DA 5A1LA 1MNDA 3RKOA 5M4YA 5L47A 4IL4A 1ZHCA 3UU8A 5LGUB 4TN7B 4ERRA 4OX9T 5AQOB 4O2AE 4EV6A 5IUXA 4DR5T 4H63H 4X1KE 5C2TA 3AA6B 2CLYB 3D0TA 2LM2A 4P09A 3UU4A 3NRXA 2XQ6A 1UURA 4DNDA 2LHRA 1UUSA 1Y64B 5DJQC 2L3LA 3AE8A 4DV7T 4LF5T 2DCFA 3FBLA 2V8SV 4QH4A 2BKOA 4LF4T 1D1BA 4B3ST 5CFBA 4MFRA 2M6BA 3BQLA 5LOVE 3N9OA 5LHGB 3ZN1B 5KX5E 4JI8T 2KMFA 2CCQA 4NPPA 1X9BA 5JDFA 2LSIA 3PV0F 3PUSA 2XAJB 5LYJE 3AA0B 3CQGB 2XAGB 4PJNA 1SUMB 1W0BA 5F5WA 1T8BA 2VL8A 5JQGE 2YU2A 3T1YT 2LOSA 5LJMA 4Z91A 3WAJA 3AE1A 2J47A 4FI5A 4J2CA 4H9RC 3NZPA 2N1GA 3CQXC 3QB5A 2LRKA 3AB3B 4TZ4C 2XQ5A 2BG9C 3J7Yq 4HFHA 3P7IA 2WBLA 5LXTE 2VQFT 1WFDA 3KV9A 3Q2MA 4I50E 3LK2B 2ZLYA 3ZCIA 4DR3T 4JEHB 1KNRA 2VURA 3RC3A 1MMAA 5AQIB 2NR4A 1SHZC 1WR0A 2UXCT 4GKKT 4EOZB 2YDRA 1HF8A 5HXEA 5LBQB 3WI3A 4DV5T 2CA5A 2JQ9A 4O8SA 4A97A 1L0VA 1XWMA 4LFCT 1BR2A 4H9QC 3L3PA 5HEHA 4JBWF 4X62T 4WYVA 2W2UA 1KEYA 3K1SA 4YTPA 4P1NA 3AEFA 3GA8A 1SE7A 3P4PA 4TX5A 2B76A 2Q9QD 4DV6T 3I9WA 1KNPA 5DABA 5AQJB 2E9XC 3OJAA 4JI4T 5AQUB 4PK5A 1YD8G 4HWIB 3BK9A 2BS2A 1J1JA 5CJ5A 1V9DA 2LKGA 2ODUA 3ONJA 1XMOT 4E7SA 4HEAA 3UUXB 2JQKA 3C98B 4EYYR 3IEEA 3RYCE 3ZSSA 4YHHT 3ZJ2A 5AQVB 3RIUA 4PJMA 4YFSA 3KINB 3N2GE 2L9QA 3SFEA 5AQRB 3CIRA 3PUWF 2LHNA 3FZKB 3V5SA 2XHEB 3H3MA 4PW8A 3L09A 5AQNB 3I1AA 4AKRB 3UFGA 5L3GB 2X67A 5KDMC 2EHOB 4UVCB 3EAMA 3VR8A 4UF0A 4MHCA 2SPCA 1HS7A 1HX1B 1AJ3A 2QVAA 3HKDE 3JCFA 3NZQA 4CN4A 3FBZA 3MKDA 5CGMA 4EYUA 3AEAA 5JDMA 3M65A 2DWKA 2QRXA 4O4HE 1FJGT 1KNZA 2WWUA 3ZLIA 3O1HA 4QHOA 1QLBA 3N5LA 4QH1A 3E08A 3R84B 5IWAT 1W09A 3F57A 3ZEFB 3PUZF 3V5UA 4A98A 1I6ZA 3RIFA 2V26A 1U5PA 3VR9A 3UUMA 5FXZA 2P9BA 4ZOLE 3PURA 1HFAA 3FZMB 2V5CA 5ABHA 4Q25A 3T1HT 3ETVA 2NTYA 3TLWA 2WZIA 2X0LB 3A5XA
chains in the Genus database with same CATH topology
5AQLB 5AQHB 5AQMB 1UK5A 3FZLB 1M62A 1T7SA 5AQGB 5AQTB 5AQJB 2D9DA 1HX1B 5AQRB 4HWDA 5AQUB 3FZMB 4HWCA 5AQQB 4HWFA 3FZFB 4HWIB 3FZKB 3A8YC 5AQPB 5AQSB 5AQVB 3M3ZB 5AQKB 5AQNB 4HWHA 3LDQB 5AQOB 1I6ZA 3FZHB 1UGOA 5AQIB 5AQFB 1M7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQL B;  5AQH B;  5AQM B;  1UK5 A;  3FZL B;  1M62 A;  1T7S A;  5AQG B;  5AQT B;  5AQJ B;  2D9D A;  1HX1 B;  5AQR B;  4HWD A;  5AQU B;  3FZM B;  4HWC A;  5AQQ B;  4HWF A;  3FZF B;  4HWI B;  3FZK B;  3A8Y C;  5AQP B;  5AQS B;  5AQV B;  3M3Z B;  5AQK B;  5AQN B;  4HWH A;  3LDQ B;  5AQO B;  1I6Z A;  3FZH B;  1UGO A;  5AQI B;  5AQF B;  1M7K A; 
#chains in the Genus database with same CATH topology
 2XY8 B;  4P0A A;  2FJA A;  4DID B;  4JI2 T;  1HG5 A;  4AXP A;  4CXX A;  4H9P C;  4BJN A;  3ZC1 A;  5ETW A;  1B7T A;  3A8Y C;  3AE3 A;  4QKN A;  3CWZ B;  1FIO A;  4X5T A;  2MOZ A;  5JRC B;  4K0K T;  1R8I A;  2V7I A;  2W61 A;  3AE9 A;  2H88 A;  1NWM X;  3TLT A;  2N2N A;  2AXD S;  2MPK A;  1YKH B;  3H37 A;  3X1D A;  5FY7 A;  4LML A;  1HNX T;  2HH7 A;  4HFB A;  1ZOY A;  2XM2 A;  5LG4 A;  2UXX B;  2KND A;  2HN2 A;  2BVL A;  1E7P A;  2IW5 B;  1OED A;  2ACZ A;  4WZX A;  2C5J A;  5H6R B;  2BDE A;  2XPK A;  4CXY A;  1WR6 A;  2NP9 A;  1IJ5 A;  1OED E;  5FP3 A;  3QC9 A;  4LFA T;  2E8I A;  1BR0 A;  3AEB A;  4YY3 T;  2KSR A;  4XAX B;  1OXZ A;  3JAD A;  2FJE A;  4ZS2 A;  1YXR A;  2MTQ A;  1WLX A;  1GQE A;  3ZKR A;  1WRD A;  3Q5E A;  3P8C D;  5HXC A;  4TNV A;  1YW0 A;  1Z8U A;  3MK7 C;  1MIY A;  2VKJ A;  4IGU A;  4QXH B;  2K9A A;  2D2S A;  5J1G A;  4IDQ A;  4GYS A;  4ZI2 C;  5IYZ E;  2Y6X A;  4B3T T;  4V1A v;  2BG9 B;  2CBJ A;  4H63 V;  4DR7 T;  2CE7 A;  2V5D A;  2WDV A;  2LSG A;  3S4U A;  4XZC A;  3J9X 1;  3LJC A;  1UGO A;  1MNE A;  4JI6 T;  3WAK A;  3RF1 A;  5EK4 A;  2LKH A;  4I4T E;  3LBX B;  2JJ9 A;  3H3A A;  3UU5 A;  4BAY B;  4HWH A;  3RYF E;  4F8H A;  2RPA A;  4NUU A;  4DR4 T;  4UV9 B;  4AIS A;  3CX7 B;  4JV5 T;  3O1J A;  4EIW A;  1IBK T;  2UUC T;  3ZMT B;  2XJ7 A;  5FMN A;  3LSV A;  3MXZ A;  3L8R A;  3UUB A;  4AQF A;  1DU2 A;  3FZH B;  5LG3 A;  4AKI A;  1UCU A;  1S35 A;  5ABF A;  4JI3 T;  1US7 B;  4CN6 A;  3AED A;  4UV8 B;  2I0M A;  4ILC A;  2A72 A;  4ZI2 D;  3UQ7 A;  3OKQ A;  2EHO D;  3PUY F;  5AQS B;  2V7J A;  4KHP T;  3PUQ A;  2WQY A;  2E9X B;  5AQF B;  2WB5 A;  5FY1 A;  2PFV A;  5J2U E;  2KT9 A;  3PU3 A;  2XM1 A;  3ZMU B;  5AQG B;  1M62 A;  1N36 T;  4AKH A;  4OYK A;  2VAS A;  4PFO A;  1QUU A;  3PE0 A;  4EED A;  4U3C A;  5LGN B;  5KMG P;  3CML A;  4ILB A;  1Z0P A;  1ZP0 A;  2M6I A;  1D0X A;  4AQY T;  3LDQ B;  2CWO A;  5JRC A;  3LK3 B;  1M7K A;  2VVS A;  2W4X A;  5JTG A;  1YKE B;  3HKB E;  1UX4 A;  5DQV A;  2H7O A;  3ZN0 B;  3KV6 A;  2WDR A;  2KWH A;  3O4X E;  2PG8 A;  4A5X A;  4JI1 T;  4DR1 T;  4UIG A;  3G06 A;  5FYM A;  4WNK A;  5LMU T;  4WBN E;  3C50 A;  4WW0 A;  5LA6 E;  4YLH A;  1G8X A;  5LJN A;  2C0S A;  3P4R A;  3NBX X;  2UUB T;  4HTE A;  3PDY A;  4KP3 C;  4UR9 A;  4CZZ B;  2DNX A;  2BBJ A;  2XTL A;  4L9I A;  2XUE A;  4NXN T;  2YDS A;  1T72 A;  2B1E A;  2BZB A;  4O4I E;  2H89 A;  2I6H A;  3OPC A;  2WAU A;  3KVB A;  2YIN A;  5LHI B;  5FVK A;  2GK9 A;  4IE6 A;  1LRZ A;  4YSY A;  2CXL A;  3AEC A;  4CI2 B;  2Q9Q A;  2VKO A;  2X66 A;  3PUA A;  4KBM B;  5HWX A;  2BG9 A;  2KIN B;  1J5W A;  2XQ4 A;  4G2A A;  2IC9 A;  1FMW A;  4GK5 E;  2LEH A;  3N2K E;  1EZ3 A;  4F6R C;  3C4Z A;  3ESL A;  2YN6 A;  1MMD A;  2LT3 A;  4G63 A;  4DUY T;  2VVN A;  4ILA A;  5HEG A;  2Z6E A;  4GIW A;  3UTK A;  1XDO A;  1H7C A;  3LBX A;  3GN5 A;  3P50 A;  4NUV A;  3U78 A;  1ZEE A;  3L39 A;  2YEV C;  4HFI A;  4DR6 T;  3OBV E;  2XAQ B;  3MJX A;  4AQG A;  4IE5 A;  4I43 B;  3AE7 A;  4I55 E;  5FKY A;  2LSJ A;  3O1I A;  4OHF A;  4AKL A;  5BMV E;  2W66 A;  3ONL C;  4DV1 T;  1MIV A;  4DMW A;  2WM9 A;  3FXE B;  2E5V A;  3GMI A;  2J62 A;  3I9Y A;  4HFE A;  5HWY A;  3CVR A;  4CI3 B;  2N9D A;  2E9X A;  1HNW T;  2BVM A;  3I0O A;  3PUG A;  4DV3 T;  1O3X A;  3FZL B;  5FXX A;  3T8O A;  1E2A A;  4ZI7 E;  2PBI A;  3QOF A;  5L3E B;  4HWF A;  1MMN A;  5FL1 A;  2ZMA A;  4Z8X A;  5L4E A;  4UXN B;  4EZH A;  3RYH E;  2Y8D A;  3RQW A;  2HPJ A;  3RIU C;  5H6Q B;  5LGT B;  4IST A;  4TWD A;  5AQQ B;  3QUJ A;  4PAG A;  4NIQ A;  3N9P A;  5AFU L;  4U72 A;  5HEU A;  1N34 T;  5HXS A;  3UQ4 A;  4ZZB A;  3PU8 A;  2CPT A;  4ZS3 A;  4L5G A;  4I0U A;  1D1A A;  4M1P A;  2JMK A;  2CBI A;  2XQ8 A;  3JAE A;  2E9X D;  1W9R A;  5CB4 E;  2YK0 A;  5HAX A;  3I0Q A;  4XBF B;  5LB7 B;  4X65 T;  2JMH A;  2CHN A;  2RA1 A;  2M67 A;  2PJQ A;  3RH3 A;  3KBT A;  2HN1 A;  1UX5 A;  3QB5 K;  3DTO A;  2VB6 A;  3ANW B;  1NEN A;  2LJL A;  2IML A;  5JDQ A;  1OWA A;  3AXJ B;  2ZM8 A;  3HL6 A;  3C4W A;  4EB6 E;  4IDN A;  3AE5 A;  3Q9D A;  4BJM A;  3EHZ A;  1W0A A;  3M3Z B;  3RKG A;  2XQ3 A;  3VRA A;  4EGW A;  1Y01 A;  2UU9 T;  4ZEY A;  3AA1 B;  5JR9 C;  3B57 A;  3VKG A;  2G0U A;  4YXD A;  4QXC B;  2LSY A;  4TUY E;  3JAF A;  5L3F B;  2JIW A;  3ZMZ B;  2X51 A;  4JLE A;  3ZT7 A;  4KX6 A;  5EK2 A;  3SS1 A;  4HFV A;  3CPZ A;  1YQ3 A;  1KF6 A;  4AIU A;  2LE8 A;  2XSB A;  4DV0 T;  2WU2 A;  2MYS A;  3GWH A;  5JVD E;  3EVY A;  2ODV A;  3BQK A;  5FY0 A;  5FXW A;  3ZCJ A;  1OED C;  2YKS A;  1FMV A;  5LNK A;  2J4G A;  2IC6 A;  2WS3 A;  4EXT A;  1UK5 A;  2KLQ A;  5JDH A;  4JI5 T;  3AE6 A;  1YQ4 A;  3AEE A;  3SFD A;  5AQK B;  2UXD T;  2WCA A;  2WMN A;  3N2O A;  1VOM A;  3HKC E;  5AQM B;  2X9X A;  3KDS E;  3VHL A;  2VL0 A;  3KV4 A;  4HN9 A;  2BS3 A;  4DV4 T;  2XQ7 A;  2DLR A;  4IT4 A;  1MIW A;  4ZXL A;  1ZKE A;  3UUL A;  4YHJ A;  3QNU A;  3RX6 A;  5L3B B;  1D1C A;  4IIJ E;  2EHO A;  2X9H A;  4PNI A;  2LOP A;  2DHR A;  3RGL A;  3BQI A;  1CHU A;  3VRB A;  2FJB A;  3AAA B;  2C5I T;  3HA4 A;  5LCY A;  3TLU A;  2YOE A;  4DBR A;  2IUB A;  4B3M T;  2CM0 A;  1CUN A;  2QA7 A;  1T7S A;  5FXV A;  4ANJ A;  4KMC A;  2XQA A;  2IHR 1;  2K3W A;  4DBQ A;  2UXB T;  2BS4 A;  5HXH A;  4LF7 T;  4CXW A;  4LMK A;  3KFW X;  3AEG A;  4AQF C;  4JI0 T;  3Q5X A;  5C8Y E;  3O9X A;  5JRE A;  3QK6 A;  3ETU A;  3AXJ A;  4X66 T;  1X79 A;  4TV8 E;  4P0B A;  4BA9 A;  4PJL A;  4ASK A;  1FEW A;  1I94 T;  1VCS A;  4U33 A;  3P4S A;  1WYB A;  3RHW A;  3KBU A;  3PTR B;  1IJ6 A;  2QGS A;  4MLK A;  3AAE B;  4X1Y E;  3ZMS B;  4DV2 T;  3HR0 A;  3SRZ A;  2WWV A;  4AI6 A;  4ILU A;  2LSK A;  3UU3 A;  4LF6 T;  2VK9 A;  2NTX A;  4UEM A;  2XSA A;  2XQ9 A;  4IE0 A;  4YJ3 E;  4C90 A;  1IZN B;  2MBG A;  2ACX A;  5LHH B;  3E22 E;  2D0T A;  3K3O A;  3K8P C;  4DVD A;  4FJO A;  4OK0 A;  3DJB A;  1BR1 A;  4O4J E;  2WDQ A;  3OVU A;  4B3R T;  5AQL B;  3ZT6 A;  3MA9 A;  2XZE A;  4E7Z A;  4UEL A;  4L0R A;  4X1I E;  2QYW A;  3FB2 A;  4DR2 T;  3SWH A;  2VQE T;  1WYC A;  1IAP A;  4HGA A;  4QWN B;  4PK4 A;  4UF0 B;  3B5M A;  2F4V T;  1E1H B;  2JPF A;  3FZF B;  3U3I A;  2RP4 A;  3AVR A;  4IE4 A;  3CX8 B;  5JDL A;  3RC8 A;  2MAW A;  3RLF F;  3C64 A;  3IF8 B;  2IIU A;  1WCR A;  3N9Q A;  3NWI A;  2PTF A;  3F31 A;  2LM9 A;  2KWI B;  3RYI E;  4GKJ T;  4HKA A;  2A2F X;  2X9Y A;  1XNQ T;  3CX6 B;  3EUH A;  4IRE A;  4A56 A;  1QSD A;  4ISS A;  2H7V C;  2Q9Q C;  5IHY A;  4GOU A;  2VKH A;  3LFM A;  1D0Y A;  1S94 A;  4JI7 T;  2BG9 E;  1XMQ T;  2KXP B;  4YTM A;  2YU1 A;  4X64 T;  5HCM A;  4H9N C;  3AA7 B;  2WP9 A;  5JR9 B;  5EK3 A;  1SA0 E;  2XQY A;  2NW9 A;  3KVA A;  2OLT A;  3MAC A;  1KK7 A;  2ZM2 A;  5HEJ A;  3LG7 A;  3NVO A;  3RIA A;  5JH7 E;  2K48 A;  4QX8 B;  4PFP A;  4QH5 A;  3TKL B;  3NRY A;  1MMG A;  1VCT A;  3OYX A;  5J0Z A;  2CMR A;  3CQC B;  2FJD A;  4ZI3 C;  4QXB B;  5EZY E;  5DQW A;  3MZK B;  3AAI A;  4U2Y A;  4U2Z A;  1JNR A;  3AE4 A;  4CN1 A;  1OED B;  3P4Q A;  2A9U A;  3E0Z A;  1HR0 T;  3B13 A;  1J5E T;  3SOL A;  4DUZ T;  1BR4 A;  2CLY C;  4U7I A;  2LRL A;  3ZJ1 A;  5ABE A;  3NKZ A;  4CI1 B;  5FNV E;  2BKN A;  2XAF B;  1KFY A;  3ZST A;  3VKH A;  4YT0 A;  4HWC A;  2FUP A;  4JUY A;  2Y48 B;  3EDU A;  4JEU B;  1NEK A;  2YDQ A;  1NAF A;  3ABV A;  5CA1 E;  1VRB A;  4U7Y A;  3UUN A;  4IE7 A;  4EZ4 A;  2CRB A;  4C91 A;  3F2E A;  1U4Q A;  5L2L A;  3AVS A;  5E0O A;  4IHJ E;  1ZV4 X;  1XDP A;  4TV9 E;  3IA3 A;  4EAH A;  3A7M A;  2E2A A;  3DP7 A;  5L3D B;  4ZI3 D;  4LFB T;  2JRK A;  2D5U A;  2DWG A;  1HX8 A;  3PJA J;  3ZC0 A;  3UFE A;  5J2T E;  4COF A;  5HCJ A;  4MAL A;  4UVB B;  4YSX A;  2NWB A;  2FBW A;  4TWH A;  2DL1 A;  5JDN A;  4IDP A;  4B6X A;  2BBH A;  3Q5W A;  4YSZ A;  5ABG A;  2CXD A;  1IBL T;  1N33 T;  2NOX A;  4IL9 A;  3ZYL A;  2XAH B;  2V6Y B;  2JQQ A;  2UXN B;  4U74 A;  2V7L A;  4ZHQ E;  5HXR A;  3CKD A;  5F3J A;  1D0Z A;  1LVK A;  5F8P A;  4KI0 F;  4CQI A;  2K5B B;  4QX7 B;  4OFZ A;  2R6G F;  5ABF B;  3HKE E;  4K0U A;  2ZM6 T;  4N78 D;  5AQH B;  1JNZ A;  4H9S E;  4MBQ A;  5ADX L;  3JC6 C;  3R6N A;  3UT5 E;  3OTO T;  2LLY A;  2WU5 A;  5LBM A;  5HYA A;  2XAS B;  2CEA A;  2I59 A;  5JR9 A;  2ES0 A;  2UUA T;  3N9N A;  1HG2 A;  2IDO B;  3K3N A;  1T98 A;  3EDV A;  4LMJ A;  4NXM T;  4UVA B;  2H3R A;  2WMO A;  5AQP B;  3KV5 A;  2L8K A;  3PJA A;  4TWF A;  3P4W A;  3AE2 A;  3FXD B;  4U31 A;  4DMV A;  4O4L E;  4YJ2 E;  1IBM T;  1G73 A;  3C4X A;  4PK6 A;  3ZPO A;  2NW8 A;  4OYJ A;  1LKX A;  4WBO A;  5GON E;  4PJJ A;  2AE9 A;  3EI0 A;  2W67 A;  5TAO A;  5LMN T;  5AQT B;  2WY2 A;  2X9W A;  3HI2 A;  2VKD A;  4KHZ F;  4IDO A;  4O2B E;  3ZT5 A;  2V1D B;  3JC6 D;  5C3J A;  2C5K T;  4DO0 A;  3LK4 2;  1N32 T;  1HCI A;  2CXF A;  4LF8 T;  4EEB A;  3ONX A;  3W15 B;  5CA0 E;  4HE8 A;  3ZMV B;  3OYZ A;  2NW7 A;  2OA5 A;  4GK0 E;  4HFD A;  4HWD A;  3VU7 H;  2A3D A;  5L3C B;  3N9M A;  5FVL A;  2D0U A;  4H9O C;  2IAK A;  2V7M A;  5KXJ A;  5HEO A;  4YTN A;  3TLS A;  2W00 A;  3CK6 A;  4ADZ A;  3RPU A;  2DI4 A;  2W63 A;  2Q9Q B;  2EHO C;  2CHO A;  2K24 A;  3PUX F;  2X68 A;  3IHR A;  5BR8 T;  3ZYM A;  5JDG A;  4ZZC A;  2HPL A;  3Q5D A;  2W0G A;  2V6X A;  2BKP A;  3PUV F;  4X20 E;  3EAB A;  1XZY A;  5LP6 E;  4GYR A;  3N9L A;  5L4H A;  2CWY A;  4IDZ A;  2WSS V;  2HHH T;  4AKG A;  3IBP A;  3GN5 B;  3C51 A;  3TLV A;  4LF9 T;  3ANW A;  3RI5 A;  3K3Q C;  3FHN A;  1LVF A;  4Z90 A;  3RRW A;  1HTJ F;  2WZH A;  3RRC A;  2X0Y A;  2ZM0 A;  1XNR T;  2W62 A;  5FL0 A;  2J1D G;  4JYA T;  2V7K A;  2V6Y A;  2JQH A;  3UU6 A;  3ZYK A;  2E5L T;  4HFC A;  3RQU A;  2KZ7 B;  2VWA A;  2X0H A;  2OV9 A;  4TNW A;  1HNZ T;  4KUM B;  2D9D A;  5A1L A;  1MND A;  3RKO A;  5M4Y A;  5L47 A;  4IL4 A;  1ZHC A;  3UU8 A;  5LGU B;  4TN7 B;  4ERR A;  4OX9 T;  5AQO B;  4O2A E;  4EV6 A;  5IUX A;  4DR5 T;  4H63 H;  4X1K E;  5C2T A;  3AA6 B;  2CLY B;  3D0T A;  2LM2 A;  4P09 A;  3UU4 A;  3NRX A;  2XQ6 A;  1UUR A;  4DND A;  2LHR A;  1UUS A;  1Y64 B;  5DJQ C;  2L3L A;  3AE8 A;  4DV7 T;  4LF5 T;  2DCF A;  3FBL A;  2V8S V;  4QH4 A;  2BKO A;  4LF4 T;  1D1B A;  4B3S T;  5CFB A;  4MFR A;  2M6B A;  3BQL A;  5LOV E;  3N9O A;  5LHG B;  3ZN1 B;  5KX5 E;  4JI8 T;  2KMF A;  2CCQ A;  4NPP A;  1X9B A;  5JDF A;  2LSI A;  3PV0 F;  3PUS A;  2XAJ B;  5LYJ E;  3AA0 B;  3CQG B;  2XAG B;  4PJN A;  1SUM B;  1W0B A;  5F5W A;  1T8B A;  2VL8 A;  5JQG E;  2YU2 A;  3T1Y T;  2LOS A;  5LJM A;  4Z91 A;  3WAJ A;  3AE1 A;  2J47 A;  4FI5 A;  4J2C A;  4H9R C;  3NZP A;  2N1G A;  3CQX C;  3QB5 A;  2LRK A;  3AB3 B;  4TZ4 C;  2XQ5 A;  2BG9 C;  3J7Y q;  4HFH A;  3P7I A;  2WBL A;  5LXT E;  2VQF T;  1WFD A;  3KV9 A;  3Q2M A;  4I50 E;  3LK2 B;  2ZLY A;  3ZCI A;  4DR3 T;  4JEH B;  1KNR A;  2VUR A;  3RC3 A;  1MMA A;  5AQI B;  2NR4 A;  1SHZ C;  1WR0 A;  2UXC T;  4GKK T;  4EOZ B;  2YDR A;  1HF8 A;  5HXE A;  5LBQ B;  3WI3 A;  4DV5 T;  2CA5 A;  2JQ9 A;  4O8S A;  4A97 A;  1L0V A;  1XWM A;  4LFC T;  1BR2 A;  4H9Q C;  3L3P A;  5HEH A;  4JBW F;  4X62 T;  4WYV A;  2W2U A;  1KEY A;  3K1S A;  4YTP A;  4P1N A;  3AEF A;  3GA8 A;  1SE7 A;  3P4P A;  4TX5 A;  2B76 A;  2Q9Q D;  4DV6 T;  3I9W A;  1KNP A;  5DAB A;  5AQJ B;  2E9X C;  3OJA A;  4JI4 T;  5AQU B;  4PK5 A;  1YD8 G;  4HWI B;  3BK9 A;  2BS2 A;  1J1J A;  5CJ5 A;  1V9D A;  2LKG A;  2ODU A;  3ONJ A;  1XMO T;  4E7S A;  4HEA A;  3UUX B;  2JQK A;  3C98 B;  4EYY R;  3IEE A;  3RYC E;  3ZSS A;  4YHH T;  3ZJ2 A;  5AQV B;  3RIU A;  4PJM A;  4YFS A;  3KIN B;  3N2G E;  2L9Q A;  3SFE A;  5AQR B;  3CIR A;  3PUW F;  2LHN A;  3FZK B;  3V5S A;  2XHE B;  3H3M A;  4PW8 A;  3L09 A;  5AQN B;  3I1A A;  4AKR B;  3UFG A;  5L3G B;  2X67 A;  5KDM C;  2EHO B;  4UVC B;  3EAM A;  3VR8 A;  4UF0 A;  4MHC A;  2SPC A;  1HS7 A;  1HX1 B;  1AJ3 A;  2QVA A;  3HKD E;  3JCF A;  3NZQ A;  4CN4 A;  3FBZ A;  3MKD A;  5CGM A;  4EYU A;  3AEA A;  5JDM A;  3M65 A;  2DWK A;  2QRX A;  4O4H E;  1FJG T;  1KNZ A;  2WWU A;  3ZLI A;  3O1H A;  4QHO A;  1QLB A;  3N5L A;  4QH1 A;  3E08 A;  3R84 B;  5IWA T;  1W09 A;  3F57 A;  3ZEF B;  3PUZ F;  3V5U A;  4A98 A;  1I6Z A;  3RIF A;  2V26 A;  1U5P A;  3VR9 A;  3UUM A;  5FXZ A;  2P9B A;  4ZOL E;  3PUR A;  1HFA A;  3FZM B;  2V5C A;  5ABH A;  4Q25 A;  3T1H T;  3ETV A;  2NTY A;  3TLW A;  2WZI A;  2X0L B;  3A5X A; 
#chains in the Genus database with same CATH homology
 5AQL B;  5AQH B;  5AQM B;  1UK5 A;  3FZL B;  1M62 A;  1T7S A;  5AQG B;  5AQT B;  5AQJ B;  2D9D A;  1HX1 B;  5AQR B;  4HWD A;  5AQU B;  3FZM B;  4HWC A;  5AQQ B;  4HWF A;  3FZF B;  4HWI B;  3FZK B;  3A8Y C;  5AQP B;  5AQS B;  5AQV B;  3M3Z B;  5AQK B;  5AQN B;  4HWH A;  3LDQ B;  5AQO B;  1I6Z A;  3FZH B;  1UGO A;  5AQI B;  5AQF B;  1M7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...