3FZLB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 48
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzlB00
1I6ZA 5AQRB 1M62A 4HWHA 5AQGB 5AQFB 5AQJB 4HWCA 5AQIB 5AQNB 3FZFB 3A8YC 3M3ZB 4HWIB 4HWFA 1M7KA 5AQOB 3FZMB 1T7SA 5AQMB 3FZLB 1UK5A 5AQUB 5AQSB 5AQPB 3LDQB 5AQHB 3FZKB 5AQTB 1HX1B 4HWDA 5AQQB 2D9DA 1UGOA 3FZHB 5AQVB 5AQKB 5AQLB
chains in the Genus database with same CATH superfamily
3UTKA 5KDMC 3SFEA 3CX6B 5FP3A 2KMFA 4X62T 5C2TA 4OYKA 3FZLB 5IUXA 4EV6A 2NW8A 2CWYA 2OV9A 2LSKA 4ZXLA 3PUZF 1NWMX 3WI3A 2WZHA 4HFDA 2X0YA 4JI6T 1D0XA 4HWFA 1OEDE 4EEBA 4XAXB 5HAXA 4YLHA 2XASB 3FBLA 1XDOA 2H88A 4X66T 1QSDA 4JI4T 1HNWT 2JQHA 3ZMVB 2MPKA 2ZM2A 4H63V 2XHEB 2BZBA 3TKLB 4MALA 4CI3B 3LK42 3RYFE 5L47A 4B3MT 4HFIA 3L8RA 2WWVA 3I0QA 4LFAT 2IHR1 2GK9A 2CXDA 2XAHB 2W2UA 2BVLA 1H7CA 2NWBA 2CRBA 4V1Av 2MYSA 2LM2A 1YQ4A 2KWHA 4K0KT 1T72A 3AAAB 3A5XA 5DQVA 2NP9A 3ZYMA 3HKBE 5LMNT 2LKGA 4IL4A 4ERRA 3IBPA 4MLKA 4ANJA 2ODVA 2H3RA 2D0UA 4CN4A 3T8OA 4UF0A 2CEAA 4X64T 5LA6E 5HXSA 2LRLA 4TWFA 1E7PA 3ETVA 4PW8A 1KK7A 2UXXB 2CXLA 4YXDA 4QX7B 5JR9C 4ZZCA 5FY1A 3P50A 4UIGA 2I0MA 3AE2A 4QXHB 4DV6T 5HCMA 3UU5A 2X0HA 3TLVA 2VQET 4U72A 1Z0PA 2BBJA 3RX6A 3HL6A 2E8IA 2PFVA 4JEHB 2W66A 4GIWA 2WAUA 5KMGP 3KVBA 2FJBA 3UUBA 2HHHT 5L3FB 2DWKA 2I59A 4YSXA 3FXDB 4YHJA 2Y8DA 3KFWX 3M65A 4DR4T 3VKGA 1KNZA 4B3TT 4ZI2D 3AB3B 3RKOA 5L3GB 4FJOA 3IA3A 1S94A 5HEJA 4ZI2C 3QB5K 1VOMA 4CN1A 5LHIB 1ZKEA 1IBKT 4PJLA 2WCAA 5LOVE 3QNUA 3C64A 4J2CA 4JI1T 4JI0T 2QRXA 3RHWA 3AVSA 3Q5EA 4UF0B 3UU3A 4DUZT 5LGTB 5L3DB 3AAIA 1NAFA 4JI8T 4AKGA 2XSBA 1I94T 2X9YA 2XQ4A 3RLFF 1T8BA 3JC6D 2V5CA 3OYZA 4ILBA 1XNRT 5L2LA 3QOFA 2LSIA 4O4LE 1YXRA 2V7KA 3JC6C 2L9QA 4DV4T 1M7KA 4LF6T 4HTEA 3AEEA 2J4GA 1OXZA 3RC3A 3UFEA 3ZT7A 2UUCT 1ZHCA 3DTOA 3KV9A 4YHHT 3ZSSA 3C98B 1IBMT 2QYWA 3LBXA 3VRAA 3K3QC 5AQNB 3A8YC 3N9QA 4KX6A 3ONXA 2ES0A 2Z6EA 3PJAJ 3X1DA 3RC8A 1W09A 3PUXF 4CQIA 2J1DG 2D2SA 5AQQB 2NW9A 5FXXA 4NXNT 1YQ3A 4TZ4C 5GONE 4BJNA 3Q5WA 2Q9QA 4QH1A 2IC6A 5HYAA 3LDQB 2RP4A 3ZN1B 2XQYA 3E0ZA 4H9OC 5IYZE 2M67A 4JI5T 3ZYLA 4F6RC 5ADXL 1W9RA 4OK0A 4WNKA 1KF6A 4OX9T 4YY3T 4KI0F 2AXDS 1G8XA 5JQGE 2EHOA 2ZLYA 1HG5A 3N9LA 5AQLB 5LNKA 2KNDA 1MMDA 2A9UA 3N9MA 3CX8B 1SE7A 3KBTA 3LBXB 4NPPA 3ONJA 2W67A 4AQFC 3ZCIA 2UUAT 2IC9A 3UUMA 2VB6A 2XAJB 3Q9DA 5CA1E 4DV3T 4KUMB 1YW0A 2XPKA 2W62A 4E7SA 3ZT6A 2CCQA 4IHJE 5AQUB 2Q9QB 2NTXA 3EUHA 2W00A 1U5PA 2UUBT 3B13A 2CE7A 3P4SA 3FHNA 1BR1A 4UEMA 1XMQT 3RI5A 2CBIA 2C5JA 5BR8T 1UGOA 2BS3A 5FVLA 5HEHA 3PJAA 4IE6A 2EHOB 3L3PA 4AISA 3M3ZB 4ILUA 2E9XA 4ZS3A 2XAQB 2AE9A 2A2FX 5DABA 1WYCA 2LRKA 5KXJA 2MBGA 2OA5A 3LK2B 5LJNA 4DIDB 4DVDA 3OVUA 4E7ZA 3VRBA 4F8HA 4U33A 2VKHA 1MMGA 3HR0A 2XQAA 3J9X1 5EK2A 1LRZA 2LOSA 5HCJA 3NVOA 4IE4A 4GKKT 3V5UA 4GK5E 4U74A 2KT9A 4JBWF 2RA1A 1HNXT 5HEOA 1MIYA 2H89A 1BR2A 2VWAA 2JQQA 3I9YA 4WBNE 2A72A 2Q9QD 3JAEA 4XBFB 3U3IA 2ZM6T 4YTMA 2Q9QC 2FJDA 3UT5E 3ZN0B 3RQUA 2E9XB 3U78A 5FNVE 2M6BA 4COFA 1SUMB 2QGSA 2E5VA 2JQ9A 4L5GA 2MOZA 1FEWA 1FMVA 4ZZBA 3P7IA 3OYXA 3VU7H 5M4YA 5LYJE 4IIJE 2HN1A 3CVRA 1U4QA 5F5WA 3N9PA 2SPCA 4HFVA 3QC9A 1BR0A 2X67A 3SWHA 4UR9A 1UCUA 1BR4A 3ABVA 4DV2T 1J1JA 4B3RT 4IREA 4EXTA 4UVCB 5LB7B 4LFCT 2VK9A 2V7JA 1OEDA 3PUSA 2WSSV 4PK5A 2MTQA 4TNVA 4O8SA 3IEEA 4CXYA 2DWGA 5HXCA 5HXRA 4CXWA 3ANWA 3GN5A 5ABFA 3TLTA 2WDRA 2YU1A 4O4JE 5L3CB 4NXMT 4JV5T 2N2NA 3MK7C 2DNXA 2ACZA 2PJQA 1N33T 3L39A 3ONLC 1CHUA 1FJGT 3PUWF 2V5DA 5L4EA 3AA6B 3C4WA 3SRZA 4JI3T 1MNEA 2LOPA 4YTPA 4IDNA 1Y64B 2YOEA 4OHFA 2XAFB 3E22E 2WMNA 4YJ2E 2X51A 3PTRB 4YTNA 3PU3A 3JADA 4HFHA 3VKHA 2JQKA 1XWMA 3C4XA 4TV8E 4NIQA 5CB4E 5ABEA 3ZC0A 1OEDB 2VKOA 5LBQB 5FKYA 3LSVA 3MXZA 1CUNA 3AECA 3AE4A 3N9NA 4YSZA 3ANWB 5CJ5A 3GN5B 5ABFB 1DU2A 3ZLIA 1EZ3A 2C0SA 2JMHA 3Q5XA 2J62A 4IDPA 1N36T 4I4TE 3HA4A 1X9BA 4C91A 1E1HB 3PUYF 2F4VT 2BS2A 4IDZA 4TWDA 3O4XE 4OYJA 4HE8A 1GQEA 4LMLA 4X65T 2XUEA 3PUAA 3L09A 1SA0E 4O4HE 4ISSA 5J2TE 4QH5A 4TV9E 4LF5T 2H7VC 1D1AA 3CQGB 5HXEA 1WLXA 5C8YE 2XSAA 2K48A 4LMKA 2CLYB 2G0UA 3R6NA 3J7Yq 3T1HT 4HWCA 1AJ3A 2XY8B 5EK3A 2NW7A 3RYCE 2KINB 1LVKA 2UXDT 1N32T 1QUUA 5JVDE 5HWXA 4EEDA 4DR2T 3ZMUB 4WZXA 5HXHA 1UX5A 4UELA 5FMNA 3PUVF 3E08A 1YKHB 4I0UA 2C5IT 2BBHA 2XQ8A 4AI6A 4LMJA 3P4PA 3ZC1A 3FBZA 3QK6A 2KLQA 3VR9A 3PURA 2BG9A 5H6QB 3AE6A 5AQVB 3UU6A 4CI1B 4QH4A 3TLUA 4KHZF 3KVAA 2CA5A 4ZEYA 2BG9E 3ZJ2A 3AAEB 2Y48B 5AQHB 3FZKB 4X1KE 3RH3A 4IE0A 2CM0A 1T98A 4WW0A 4U31A 1W0AA 3KINB 4EAHA 3ZT5A 5IWAT 4QKNA 3UQ4A 4P0BA 4H9QC 1WCRA 3DJBA 4DNDA 4L0RA 2JMKA 2XQ9A 1D1BA 4U2YA 2PBIA 4PK6A 5ETWA 4U2ZA 2YEVC 2CBJA 2XQ6A 5LG4A 2C5KT 3P8CD 4Z90A 4QX8B 1HR0T 5C3JA 2X0LB 4HWIB 2LSGA 3GA8A 3I0OA 1IJ5A 5AQPB 4DR6T 3UFGA 3RGLA 3O1HA 4PAGA 2N9DA 5F8PA 4IDOA 4ZHQE 1WRDA 2PTFA 2HPJA 3RRCA 2X9XA 2BG9B 5HWYA 1IJ6A 4JLEA 1IZNB 5HEUA 3QB5A 2V6YA 3OTOT 5ABGA 3TLWA 4LF9T 1JNZA 5JDHA 1HCIA 4GYRA 2IUBA 3AEAA 4CN6A 2L8KA 1ZV4X 4HWHA 3ZMSB 3EDVA 3R84B 4EZHA 3K8PC 4UXNB 4KHPT 4AQYT 4U3CA 4LF4T 2E2AA 3EABA 4TUYE 2VL0A 4AKIA 3KDSE 3CWZB 1Z8UA 2W4XA 5J1GA 3KV4A 3QUJA 4KBMB 3IF8B 1HNZT 2LM9A 3F2EA 2CWOA 2K5BB 4Q25A 3MA9A 2MAWA 5L4HA 3KV5A 1X79A 4A56A 3UUNA 3HKDE 4B3ST 3NRYA 4AKHA 2DLRA 3LFMA 2JPFA 4B6XA 4DR7T 3MJXA 2E5LT 1UK5A 1IBLT 5BMVE 3Q5DA 2V6YB 3D0TA 1B7TA 3C4ZA 1R8IA 4X1YE 3K1SA 2YKSA 2LEHA 1ZEEA 5FY0A 4MFRA 2ZM0A 4PFOA 4XZCA 2QVAA 2WP9A 4CI2B 4A98A 3F31A 4U7YA 3AE8A 4H9PC 3RQWA 2KXPB 2JJ9A 3N2KE 5JDMA 3CQCB 5J2UE 4ZI3D 3HI2A 3FZHB 4TX5A 1HX8A 3CX7B 3PUQA 5JDQA 4EB6E 4ZI3C 2UU9T 3G06A 2FJAA 4CXXA 3RYHE 3WAKA 1YKEB 2YU2A 1OWAA 5AQKB 1XNQT 1MIVA 3EHZA 3NWIA 1HFAA 4KP3C 2BVMA 2LSJA 4EYYR 4UVBB 1T7SA 3PUGA 4OFZA 3FB2A 2WS3A 5LHGB 4O2BE 2XQ7A 2WQYA 4I50E 4AKRB 2K9AA 2CHOA 2XQ3A 3SFDA 3RRWA 4CZZB 2YDQA 2XJ7A 3EI0A 2XTLA 1XMOT 1VCTA 2EHOD 5JRCA 2XQ5A 2VASA 4ILCA 4EZ4A 1KFYA 4YSYA 3GWHA 3EAMA 4AXPA 3H37A 2EHOC 1LKXA 3MACA 2FJEA 4ZS2A 3ZPOA 1HG2A 2WZIA 1N34T 2WY2A 4HKAA 4NUUA 2BKPA 2LHNA 3ZMTB 3NRXA 2CPTA 4TWHA 4TN7B 4QWNB 2M6IA 2V1DB 3AEFA 2HH7A 5IHYA 2V8SV 2J47A 5AQGB 3RF1A 5H6RB 1NENA 5DJQC 4QXBB 4GYSA 2NOXA 2WBLA 2D0TA 2QA7A 2CHNA 4ZI7E 4P09A 2UXNB 4BAYB 3N2OA 3OBVE 4DR1T 1S35A 1LVFA 1YD8G 4EYUA 3V5SA 3KBUA 5LG3A 3F57A 1VCSA 4WYVA 5EZYE 4ASKA 5AQMB 3NZQA 3VR8A 3TLSA 2YDSA 2JRKA 3CMLA 1IAPA 3AEGA 3PDYA 4DBQA 3H3AA 5JRCB 2DL1A 2WB5A 4AIUA 2E9XD 3I9WA 1WR0A 4Z91A 2NTYA 4H9NC 4GOUA 4M1PA 4UV8B 3JCFA 3A7MA 2E9XC 1ZOYA 2LKHA 2HPLA 3AA1B 4HWDA 1KNPA 4P1NA 4DV5T 3AA0B 3FZFB 3IHRA 1V9DA 5L3EB 2RPAA 5LJMA 5TAOA 4AKLA 2V7LA 4PJNA 3W15B 4FI5A 5J0ZA 5FL0A 2XAGB 3ZJ1A 3AE5A 3ETUA 4JUYA 3P4RA 5AQSB 5FY7A 2VVSA 3O9XA 4YT0A 2B76A 3EDUA 1WYBA 1I6ZA 3S4UA 4L9IA 3ZYKA 3O1IA 4AQFA 1UUSA 3MKDA 3K3OA 2WMOA 5LXTE 1MIWA 3RYIE 4QXCB 2BDEA 2CXFA 4N78D 4MHCA 2LHRA 3MZKB 2WWUA 3FXEB 2XZEA 2V6XA 1J5ET 2X9HA 3AA7B 3RKGA 2YK0A 2PG8A 3ZSTA 4A97A 4IDQA 4GKJT 3RIUA 3RIFA 4AQGA 2A3DA 5JREA 5FXZA 3B57A 4H63H 3CIRA 2YDRA 3H3MA 4UVAB 1JNRA 4PJJA 1O3XA 1UX4A 3GMIA 3LK3B 5L3BB 3AXJA 4IT4A 2CMRA 4HN9A 1OEDC 3ZKRA 4YJ3E 2X66A 3UU4A 2H7OA 3BK9A 3AE7A 4I55E 4O2AE 4G63A 2D5UA 5CFBA 2HN2A 4PFPA 1HX1B 4ZOLE 3UQ7A 2WU2A 5LCYA 5E0OA 2IIUA 2K24A 2LT3A 3HKCE 4DR5T 2P9BA 3HKEE 3CK6A 3KV6A 4YFSA 4IE7A 5AQOB 3RPUA 5FXVA 3P4QA 2IDOB 2IMLA 3JAFA 1D1CA 2VL8A 2ODUA 4LF8T 3AE3A 1XZYA 4BA9A 3C50A 4IGUA 1HTJF 4UV9B 2I6HA 2YINA 2VKJA 4PNIA 2CLYC 3OKQA 2YN6A 2DI4A 3OPCA 4HFCA 3AXJB 4ILAA 3I1AA 3O1JA 3CKDA 4A5XA 1VRBA 3PU8A 3RIAA 2WU5A 4IE5A 2V7MA 5FYMA 4KMCA 2IAKA 2ZMAA 2JIWA 2W0GA 3PE0A 5AQRB 2BKNA 5FVKA 3LG7A 4X5TA 2KWIB 3UULA 2UXCT 3LJCA 1WFDA 3AEBA 1KNRA 4WBOA 2N1GA 3UU8A 3NKZA 5LHHB 1ZP0A 4DR3T 3K3NA 4U7IA 4NUVA 3CQXC 2V26A 5DQWA 2L3LA 3OJAA 4LF7T 3WAJA 4H9SE 1L0VA 5KX5E 2DCFA 2LJLA 5JDLA 2NR4A 4HGAA 2R6GF 3NBXX 2VVNA 1NEKA 1QLBA 3ESLA 5AQJB 4DV7T 5ABHA 5JDGA 4C90A 4HEAA 1W0BA 1MNDA 5A1LA 4P0AA 1MMAA 2X68A 2LSYA 4X20E 5LMUT 4I43B 5AFUL 2LLYA 2UXBT 2ZM8A 2LE8A 2BS4A 5EK4A 2VQFT 3P4WA 5HEGA 3T1YT 3RIUC 5CA0E 5LP6E 4LFBT 2FUPA 2W61A 3AE1A 1J5WA 4EOZB 2X9WA 2BKOA 4DMWA 1MMNA 1E2AA 3UUXB 4ISTA 5JDNA 4Z8XA 4ADZA 1G73A 1M62A 2BG9C 5AQFB 3ZCJA 3PV0F 5AQIB 4HFEA 3BQIA 5LGNB 2XM1A 3B5MA 5F3JA 3DP7A 1D0YA 3AVRA 3N5LA 3ZMZB 4EIWA 2DHRA 2W63A 3NZPA 3ZEFB 2ACXA 1Y01A 4JYAT 4QHOA 3CPZA 4HFBA 4PJMA 5LGUB 3FZMB 4K0UA 1FMWA 4JI7T 1D0ZA 5JR9A 4H9RC 3BQLA 4X1IE 1XDPA 2B1EA 2WDVA 5JH7E 4JEUB 4MBQA 2XM2A 5FXWA 4IL9A 3N2GE 4GK0E 1SHZC 3Q2MA 3C51A 3BQKA 5LBMA 1WR6A 2V7IA 3SS1A 2OLTA 4G2AA 2WM9A 4DBRA 4EGWA 3AEDA 2KZ7B 1HS7A 1US7B 2VURA 1FIOA 1KEYA 4DV0T 3N9OA 2WDQA 4TNWA 3VHLA 5JDFA 1UURA 4DO0A 4DMVA 2Y6XA 3EVYA 2IW5B 4DUYT 4O4IE 3SOLA 2FBWA 5CGMA 3AE9A 5JTGA 2K3WA 2KSRA 4PK4A 4BJMA 4DV1T 1HF8A 2D9DA 2VKDA 5FL1A 5AQTB 5JR9B 4JI2T
chains in the Genus database with same CATH topology
1I6ZA 5AQRB 1M62A 4HWHA 5AQGB 5AQFB 5AQJB 4HWCA 5AQIB 5AQNB 3FZFB 3A8YC 3M3ZB 4HWIB 4HWFA 1M7KA 5AQOB 3FZMB 1T7SA 5AQMB 3FZLB 1UK5A 5AQUB 5AQSB 5AQPB 3LDQB 5AQHB 3FZKB 5AQTB 1HX1B 4HWDA 5AQQB 2D9DA 1UGOA 3FZHB 5AQVB 5AQKB 5AQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  5AQR B;  1M62 A;  4HWH A;  5AQG B;  5AQF B;  5AQJ B;  4HWC A;  5AQI B;  5AQN B;  3FZF B;  3A8Y C;  3M3Z B;  4HWI B;  4HWF A;  1M7K A;  5AQO B;  3FZM B;  1T7S A;  5AQM B;  3FZL B;  1UK5 A;  5AQU B;  5AQS B;  5AQP B;  3LDQ B;  5AQH B;  3FZK B;  5AQT B;  1HX1 B;  4HWD A;  5AQQ B;  2D9D A;  1UGO A;  3FZH B;  5AQV B;  5AQK B;  5AQL B; 
#chains in the Genus database with same CATH topology
 3UTK A;  5KDM C;  3SFE A;  3CX6 B;  5FP3 A;  2KMF A;  4X62 T;  5C2T A;  4OYK A;  3FZL B;  5IUX A;  4EV6 A;  2NW8 A;  2CWY A;  2OV9 A;  2LSK A;  4ZXL A;  3PUZ F;  1NWM X;  3WI3 A;  2WZH A;  4HFD A;  2X0Y A;  4JI6 T;  1D0X A;  4HWF A;  1OED E;  4EEB A;  4XAX B;  5HAX A;  4YLH A;  2XAS B;  3FBL A;  1XDO A;  2H88 A;  4X66 T;  1QSD A;  4JI4 T;  1HNW T;  2JQH A;  3ZMV B;  2MPK A;  2ZM2 A;  4H63 V;  2XHE B;  2BZB A;  3TKL B;  4MAL A;  4CI3 B;  3LK4 2;  3RYF E;  5L47 A;  4B3M T;  4HFI A;  3L8R A;  2WWV A;  3I0Q A;  4LFA T;  2IHR 1;  2GK9 A;  2CXD A;  2XAH B;  2W2U A;  2BVL A;  1H7C A;  2NWB A;  2CRB A;  4V1A v;  2MYS A;  2LM2 A;  1YQ4 A;  2KWH A;  4K0K T;  1T72 A;  3AAA B;  3A5X A;  5DQV A;  2NP9 A;  3ZYM A;  3HKB E;  5LMN T;  2LKG A;  4IL4 A;  4ERR A;  3IBP A;  4MLK A;  4ANJ A;  2ODV A;  2H3R A;  2D0U A;  4CN4 A;  3T8O A;  4UF0 A;  2CEA A;  4X64 T;  5LA6 E;  5HXS A;  2LRL A;  4TWF A;  1E7P A;  3ETV A;  4PW8 A;  1KK7 A;  2UXX B;  2CXL A;  4YXD A;  4QX7 B;  5JR9 C;  4ZZC A;  5FY1 A;  3P50 A;  4UIG A;  2I0M A;  3AE2 A;  4QXH B;  4DV6 T;  5HCM A;  3UU5 A;  2X0H A;  3TLV A;  2VQE T;  4U72 A;  1Z0P A;  2BBJ A;  3RX6 A;  3HL6 A;  2E8I A;  2PFV A;  4JEH B;  2W66 A;  4GIW A;  2WAU A;  5KMG P;  3KVB A;  2FJB A;  3UUB A;  2HHH T;  5L3F B;  2DWK A;  2I59 A;  4YSX A;  3FXD B;  4YHJ A;  2Y8D A;  3KFW X;  3M65 A;  4DR4 T;  3VKG A;  1KNZ A;  4B3T T;  4ZI2 D;  3AB3 B;  3RKO A;  5L3G B;  4FJO A;  3IA3 A;  1S94 A;  5HEJ A;  4ZI2 C;  3QB5 K;  1VOM A;  4CN1 A;  5LHI B;  1ZKE A;  1IBK T;  4PJL A;  2WCA A;  5LOV E;  3QNU A;  3C64 A;  4J2C A;  4JI1 T;  4JI0 T;  2QRX A;  3RHW A;  3AVS A;  3Q5E A;  4UF0 B;  3UU3 A;  4DUZ T;  5LGT B;  5L3D B;  3AAI A;  1NAF A;  4JI8 T;  4AKG A;  2XSB A;  1I94 T;  2X9Y A;  2XQ4 A;  3RLF F;  1T8B A;  3JC6 D;  2V5C A;  3OYZ A;  4ILB A;  1XNR T;  5L2L A;  3QOF A;  2LSI A;  4O4L E;  1YXR A;  2V7K A;  3JC6 C;  2L9Q A;  4DV4 T;  1M7K A;  4LF6 T;  4HTE A;  3AEE A;  2J4G A;  1OXZ A;  3RC3 A;  3UFE A;  3ZT7 A;  2UUC T;  1ZHC A;  3DTO A;  3KV9 A;  4YHH T;  3ZSS A;  3C98 B;  1IBM T;  2QYW A;  3LBX A;  3VRA A;  3K3Q C;  5AQN B;  3A8Y C;  3N9Q A;  4KX6 A;  3ONX A;  2ES0 A;  2Z6E A;  3PJA J;  3X1D A;  3RC8 A;  1W09 A;  3PUX F;  4CQI A;  2J1D G;  2D2S A;  5AQQ B;  2NW9 A;  5FXX A;  4NXN T;  1YQ3 A;  4TZ4 C;  5GON E;  4BJN A;  3Q5W A;  2Q9Q A;  4QH1 A;  2IC6 A;  5HYA A;  3LDQ B;  2RP4 A;  3ZN1 B;  2XQY A;  3E0Z A;  4H9O C;  5IYZ E;  2M67 A;  4JI5 T;  3ZYL A;  4F6R C;  5ADX L;  1W9R A;  4OK0 A;  4WNK A;  1KF6 A;  4OX9 T;  4YY3 T;  4KI0 F;  2AXD S;  1G8X A;  5JQG E;  2EHO A;  2ZLY A;  1HG5 A;  3N9L A;  5AQL B;  5LNK A;  2KND A;  1MMD A;  2A9U A;  3N9M A;  3CX8 B;  1SE7 A;  3KBT A;  3LBX B;  4NPP A;  3ONJ A;  2W67 A;  4AQF C;  3ZCI A;  2UUA T;  2IC9 A;  3UUM A;  2VB6 A;  2XAJ B;  3Q9D A;  5CA1 E;  4DV3 T;  4KUM B;  1YW0 A;  2XPK A;  2W62 A;  4E7S A;  3ZT6 A;  2CCQ A;  4IHJ E;  5AQU B;  2Q9Q B;  2NTX A;  3EUH A;  2W00 A;  1U5P A;  2UUB T;  3B13 A;  2CE7 A;  3P4S A;  3FHN A;  1BR1 A;  4UEM A;  1XMQ T;  3RI5 A;  2CBI A;  2C5J A;  5BR8 T;  1UGO A;  2BS3 A;  5FVL A;  5HEH A;  3PJA A;  4IE6 A;  2EHO B;  3L3P A;  4AIS A;  3M3Z B;  4ILU A;  2E9X A;  4ZS3 A;  2XAQ B;  2AE9 A;  2A2F X;  5DAB A;  1WYC A;  2LRK A;  5KXJ A;  2MBG A;  2OA5 A;  3LK2 B;  5LJN A;  4DID B;  4DVD A;  3OVU A;  4E7Z A;  3VRB A;  4F8H A;  4U33 A;  2VKH A;  1MMG A;  3HR0 A;  2XQA A;  3J9X 1;  5EK2 A;  1LRZ A;  2LOS A;  5HCJ A;  3NVO A;  4IE4 A;  4GKK T;  3V5U A;  4GK5 E;  4U74 A;  2KT9 A;  4JBW F;  2RA1 A;  1HNX T;  5HEO A;  1MIY A;  2H89 A;  1BR2 A;  2VWA A;  2JQQ A;  3I9Y A;  4WBN E;  2A72 A;  2Q9Q D;  3JAE A;  4XBF B;  3U3I A;  2ZM6 T;  4YTM A;  2Q9Q C;  2FJD A;  3UT5 E;  3ZN0 B;  3RQU A;  2E9X B;  3U78 A;  5FNV E;  2M6B A;  4COF A;  1SUM B;  2QGS A;  2E5V A;  2JQ9 A;  4L5G A;  2MOZ A;  1FEW A;  1FMV A;  4ZZB A;  3P7I A;  3OYX A;  3VU7 H;  5M4Y A;  5LYJ E;  4IIJ E;  2HN1 A;  3CVR A;  1U4Q A;  5F5W A;  3N9P A;  2SPC A;  4HFV A;  3QC9 A;  1BR0 A;  2X67 A;  3SWH A;  4UR9 A;  1UCU A;  1BR4 A;  3ABV A;  4DV2 T;  1J1J A;  4B3R T;  4IRE A;  4EXT A;  4UVC B;  5LB7 B;  4LFC T;  2VK9 A;  2V7J A;  1OED A;  3PUS A;  2WSS V;  4PK5 A;  2MTQ A;  4TNV A;  4O8S A;  3IEE A;  4CXY A;  2DWG A;  5HXC A;  5HXR A;  4CXW A;  3ANW A;  3GN5 A;  5ABF A;  3TLT A;  2WDR A;  2YU1 A;  4O4J E;  5L3C B;  4NXM T;  4JV5 T;  2N2N A;  3MK7 C;  2DNX A;  2ACZ A;  2PJQ A;  1N33 T;  3L39 A;  3ONL C;  1CHU A;  1FJG T;  3PUW F;  2V5D A;  5L4E A;  3AA6 B;  3C4W A;  3SRZ A;  4JI3 T;  1MNE A;  2LOP A;  4YTP A;  4IDN A;  1Y64 B;  2YOE A;  4OHF A;  2XAF B;  3E22 E;  2WMN A;  4YJ2 E;  2X51 A;  3PTR B;  4YTN A;  3PU3 A;  3JAD A;  4HFH A;  3VKH A;  2JQK A;  1XWM A;  3C4X A;  4TV8 E;  4NIQ A;  5CB4 E;  5ABE A;  3ZC0 A;  1OED B;  2VKO A;  5LBQ B;  5FKY A;  3LSV A;  3MXZ A;  1CUN A;  3AEC A;  3AE4 A;  3N9N A;  4YSZ A;  3ANW B;  5CJ5 A;  3GN5 B;  5ABF B;  1DU2 A;  3ZLI A;  1EZ3 A;  2C0S A;  2JMH A;  3Q5X A;  2J62 A;  4IDP A;  1N36 T;  4I4T E;  3HA4 A;  1X9B A;  4C91 A;  1E1H B;  3PUY F;  2F4V T;  2BS2 A;  4IDZ A;  4TWD A;  3O4X E;  4OYJ A;  4HE8 A;  1GQE A;  4LML A;  4X65 T;  2XUE A;  3PUA A;  3L09 A;  1SA0 E;  4O4H E;  4ISS A;  5J2T E;  4QH5 A;  4TV9 E;  4LF5 T;  2H7V C;  1D1A A;  3CQG B;  5HXE A;  1WLX A;  5C8Y E;  2XSA A;  2K48 A;  4LMK A;  2CLY B;  2G0U A;  3R6N A;  3J7Y q;  3T1H T;  4HWC A;  1AJ3 A;  2XY8 B;  5EK3 A;  2NW7 A;  3RYC E;  2KIN B;  1LVK A;  2UXD T;  1N32 T;  1QUU A;  5JVD E;  5HWX A;  4EED A;  4DR2 T;  3ZMU B;  4WZX A;  5HXH A;  1UX5 A;  4UEL A;  5FMN A;  3PUV F;  3E08 A;  1YKH B;  4I0U A;  2C5I T;  2BBH A;  2XQ8 A;  4AI6 A;  4LMJ A;  3P4P A;  3ZC1 A;  3FBZ A;  3QK6 A;  2KLQ A;  3VR9 A;  3PUR A;  2BG9 A;  5H6Q B;  3AE6 A;  5AQV B;  3UU6 A;  4CI1 B;  4QH4 A;  3TLU A;  4KHZ F;  3KVA A;  2CA5 A;  4ZEY A;  2BG9 E;  3ZJ2 A;  3AAE B;  2Y48 B;  5AQH B;  3FZK B;  4X1K E;  3RH3 A;  4IE0 A;  2CM0 A;  1T98 A;  4WW0 A;  4U31 A;  1W0A A;  3KIN B;  4EAH A;  3ZT5 A;  5IWA T;  4QKN A;  3UQ4 A;  4P0B A;  4H9Q C;  1WCR A;  3DJB A;  4DND A;  4L0R A;  2JMK A;  2XQ9 A;  1D1B A;  4U2Y A;  2PBI A;  4PK6 A;  5ETW A;  4U2Z A;  2YEV C;  2CBJ A;  2XQ6 A;  5LG4 A;  2C5K T;  3P8C D;  4Z90 A;  4QX8 B;  1HR0 T;  5C3J A;  2X0L B;  4HWI B;  2LSG A;  3GA8 A;  3I0O A;  1IJ5 A;  5AQP B;  4DR6 T;  3UFG A;  3RGL A;  3O1H A;  4PAG A;  2N9D A;  5F8P A;  4IDO A;  4ZHQ E;  1WRD A;  2PTF A;  2HPJ A;  3RRC A;  2X9X A;  2BG9 B;  5HWY A;  1IJ6 A;  4JLE A;  1IZN B;  5HEU A;  3QB5 A;  2V6Y A;  3OTO T;  5ABG A;  3TLW A;  4LF9 T;  1JNZ A;  5JDH A;  1HCI A;  4GYR A;  2IUB A;  3AEA A;  4CN6 A;  2L8K A;  1ZV4 X;  4HWH A;  3ZMS B;  3EDV A;  3R84 B;  4EZH A;  3K8P C;  4UXN B;  4KHP T;  4AQY T;  4U3C A;  4LF4 T;  2E2A A;  3EAB A;  4TUY E;  2VL0 A;  4AKI A;  3KDS E;  3CWZ B;  1Z8U A;  2W4X A;  5J1G A;  3KV4 A;  3QUJ A;  4KBM B;  3IF8 B;  1HNZ T;  2LM9 A;  3F2E A;  2CWO A;  2K5B B;  4Q25 A;  3MA9 A;  2MAW A;  5L4H A;  3KV5 A;  1X79 A;  4A56 A;  3UUN A;  3HKD E;  4B3S T;  3NRY A;  4AKH A;  2DLR A;  3LFM A;  2JPF A;  4B6X A;  4DR7 T;  3MJX A;  2E5L T;  1UK5 A;  1IBL T;  5BMV E;  3Q5D A;  2V6Y B;  3D0T A;  1B7T A;  3C4Z A;  1R8I A;  4X1Y E;  3K1S A;  2YKS A;  2LEH A;  1ZEE A;  5FY0 A;  4MFR A;  2ZM0 A;  4PFO A;  4XZC A;  2QVA A;  2WP9 A;  4CI2 B;  4A98 A;  3F31 A;  4U7Y A;  3AE8 A;  4H9P C;  3RQW A;  2KXP B;  2JJ9 A;  3N2K E;  5JDM A;  3CQC B;  5J2U E;  4ZI3 D;  3HI2 A;  3FZH B;  4TX5 A;  1HX8 A;  3CX7 B;  3PUQ A;  5JDQ A;  4EB6 E;  4ZI3 C;  2UU9 T;  3G06 A;  2FJA A;  4CXX A;  3RYH E;  3WAK A;  1YKE B;  2YU2 A;  1OWA A;  5AQK B;  1XNQ T;  1MIV A;  3EHZ A;  3NWI A;  1HFA A;  4KP3 C;  2BVM A;  2LSJ A;  4EYY R;  4UVB B;  1T7S A;  3PUG A;  4OFZ A;  3FB2 A;  2WS3 A;  5LHG B;  4O2B E;  2XQ7 A;  2WQY A;  4I50 E;  4AKR B;  2K9A A;  2CHO A;  2XQ3 A;  3SFD A;  3RRW A;  4CZZ B;  2YDQ A;  2XJ7 A;  3EI0 A;  2XTL A;  1XMO T;  1VCT A;  2EHO D;  5JRC A;  2XQ5 A;  2VAS A;  4ILC A;  4EZ4 A;  1KFY A;  4YSY A;  3GWH A;  3EAM A;  4AXP A;  3H37 A;  2EHO C;  1LKX A;  3MAC A;  2FJE A;  4ZS2 A;  3ZPO A;  1HG2 A;  2WZI A;  1N34 T;  2WY2 A;  4HKA A;  4NUU A;  2BKP A;  2LHN A;  3ZMT B;  3NRX A;  2CPT A;  4TWH A;  4TN7 B;  4QWN B;  2M6I A;  2V1D B;  3AEF A;  2HH7 A;  5IHY A;  2V8S V;  2J47 A;  5AQG B;  3RF1 A;  5H6R B;  1NEN A;  5DJQ C;  4QXB B;  4GYS A;  2NOX A;  2WBL A;  2D0T A;  2QA7 A;  2CHN A;  4ZI7 E;  4P09 A;  2UXN B;  4BAY B;  3N2O A;  3OBV E;  4DR1 T;  1S35 A;  1LVF A;  1YD8 G;  4EYU A;  3V5S A;  3KBU A;  5LG3 A;  3F57 A;  1VCS A;  4WYV A;  5EZY E;  4ASK A;  5AQM B;  3NZQ A;  3VR8 A;  3TLS A;  2YDS A;  2JRK A;  3CML A;  1IAP A;  3AEG A;  3PDY A;  4DBQ A;  3H3A A;  5JRC B;  2DL1 A;  2WB5 A;  4AIU A;  2E9X D;  3I9W A;  1WR0 A;  4Z91 A;  2NTY A;  4H9N C;  4GOU A;  4M1P A;  4UV8 B;  3JCF A;  3A7M A;  2E9X C;  1ZOY A;  2LKH A;  2HPL A;  3AA1 B;  4HWD A;  1KNP A;  4P1N A;  4DV5 T;  3AA0 B;  3FZF B;  3IHR A;  1V9D A;  5L3E B;  2RPA A;  5LJM A;  5TAO A;  4AKL A;  2V7L A;  4PJN A;  3W15 B;  4FI5 A;  5J0Z A;  5FL0 A;  2XAG B;  3ZJ1 A;  3AE5 A;  3ETU A;  4JUY A;  3P4R A;  5AQS B;  5FY7 A;  2VVS A;  3O9X A;  4YT0 A;  2B76 A;  3EDU A;  1WYB A;  1I6Z A;  3S4U A;  4L9I A;  3ZYK A;  3O1I A;  4AQF A;  1UUS A;  3MKD A;  3K3O A;  2WMO A;  5LXT E;  1MIW A;  3RYI E;  4QXC B;  2BDE A;  2CXF A;  4N78 D;  4MHC A;  2LHR A;  3MZK B;  2WWU A;  3FXE B;  2XZE A;  2V6X A;  1J5E T;  2X9H A;  3AA7 B;  3RKG A;  2YK0 A;  2PG8 A;  3ZST A;  4A97 A;  4IDQ A;  4GKJ T;  3RIU A;  3RIF A;  4AQG A;  2A3D A;  5JRE A;  5FXZ A;  3B57 A;  4H63 H;  3CIR A;  2YDR A;  3H3M A;  4UVA B;  1JNR A;  4PJJ A;  1O3X A;  1UX4 A;  3GMI A;  3LK3 B;  5L3B B;  3AXJ A;  4IT4 A;  2CMR A;  4HN9 A;  1OED C;  3ZKR A;  4YJ3 E;  2X66 A;  3UU4 A;  2H7O A;  3BK9 A;  3AE7 A;  4I55 E;  4O2A E;  4G63 A;  2D5U A;  5CFB A;  2HN2 A;  4PFP A;  1HX1 B;  4ZOL E;  3UQ7 A;  2WU2 A;  5LCY A;  5E0O A;  2IIU A;  2K24 A;  2LT3 A;  3HKC E;  4DR5 T;  2P9B A;  3HKE E;  3CK6 A;  3KV6 A;  4YFS A;  4IE7 A;  5AQO B;  3RPU A;  5FXV A;  3P4Q A;  2IDO B;  2IML A;  3JAF A;  1D1C A;  2VL8 A;  2ODU A;  4LF8 T;  3AE3 A;  1XZY A;  4BA9 A;  3C50 A;  4IGU A;  1HTJ F;  4UV9 B;  2I6H A;  2YIN A;  2VKJ A;  4PNI A;  2CLY C;  3OKQ A;  2YN6 A;  2DI4 A;  3OPC A;  4HFC A;  3AXJ B;  4ILA A;  3I1A A;  3O1J A;  3CKD A;  4A5X A;  1VRB A;  3PU8 A;  3RIA A;  2WU5 A;  4IE5 A;  2V7M A;  5FYM A;  4KMC A;  2IAK A;  2ZMA A;  2JIW A;  2W0G A;  3PE0 A;  5AQR B;  2BKN A;  5FVK A;  3LG7 A;  4X5T A;  2KWI B;  3UUL A;  2UXC T;  3LJC A;  1WFD A;  3AEB A;  1KNR A;  4WBO A;  2N1G A;  3UU8 A;  3NKZ A;  5LHH B;  1ZP0 A;  4DR3 T;  3K3N A;  4U7I A;  4NUV A;  3CQX C;  2V26 A;  5DQW A;  2L3L A;  3OJA A;  4LF7 T;  3WAJ A;  4H9S E;  1L0V A;  5KX5 E;  2DCF A;  2LJL A;  5JDL A;  2NR4 A;  4HGA A;  2R6G F;  3NBX X;  2VVN A;  1NEK A;  1QLB A;  3ESL A;  5AQJ B;  4DV7 T;  5ABH A;  5JDG A;  4C90 A;  4HEA A;  1W0B A;  1MND A;  5A1L A;  4P0A A;  1MMA A;  2X68 A;  2LSY A;  4X20 E;  5LMU T;  4I43 B;  5AFU L;  2LLY A;  2UXB T;  2ZM8 A;  2LE8 A;  2BS4 A;  5EK4 A;  2VQF T;  3P4W A;  5HEG A;  3T1Y T;  3RIU C;  5CA0 E;  5LP6 E;  4LFB T;  2FUP A;  2W61 A;  3AE1 A;  1J5W A;  4EOZ B;  2X9W A;  2BKO A;  4DMW A;  1MMN A;  1E2A A;  3UUX B;  4IST A;  5JDN A;  4Z8X A;  4ADZ A;  1G73 A;  1M62 A;  2BG9 C;  5AQF B;  3ZCJ A;  3PV0 F;  5AQI B;  4HFE A;  3BQI A;  5LGN B;  2XM1 A;  3B5M A;  5F3J A;  3DP7 A;  1D0Y A;  3AVR A;  3N5L A;  3ZMZ B;  4EIW A;  2DHR A;  2W63 A;  3NZP A;  3ZEF B;  2ACX A;  1Y01 A;  4JYA T;  4QHO A;  3CPZ A;  4HFB A;  4PJM A;  5LGU B;  3FZM B;  4K0U A;  1FMW A;  4JI7 T;  1D0Z A;  5JR9 A;  4H9R C;  3BQL A;  4X1I E;  1XDP A;  2B1E A;  2WDV A;  5JH7 E;  4JEU B;  4MBQ A;  2XM2 A;  5FXW A;  4IL9 A;  3N2G E;  4GK0 E;  1SHZ C;  3Q2M A;  3C51 A;  3BQK A;  5LBM A;  1WR6 A;  2V7I A;  3SS1 A;  2OLT A;  4G2A A;  2WM9 A;  4DBR A;  4EGW A;  3AED A;  2KZ7 B;  1HS7 A;  1US7 B;  2VUR A;  1FIO A;  1KEY A;  4DV0 T;  3N9O A;  2WDQ A;  4TNW A;  3VHL A;  5JDF A;  1UUR A;  4DO0 A;  4DMV A;  2Y6X A;  3EVY A;  2IW5 B;  4DUY T;  4O4I E;  3SOL A;  2FBW A;  5CGM A;  3AE9 A;  5JTG A;  2K3W A;  2KSR A;  4PK4 A;  4BJM A;  4DV1 T;  1HF8 A;  2D9D A;  2VKD A;  5FL1 A;  5AQT B;  5JR9 B;  4JI2 T; 
#chains in the Genus database with same CATH homology
 1I6Z A;  5AQR B;  1M62 A;  4HWH A;  5AQG B;  5AQF B;  5AQJ B;  4HWC A;  5AQI B;  5AQN B;  3FZF B;  3A8Y C;  3M3Z B;  4HWI B;  4HWF A;  1M7K A;  5AQO B;  3FZM B;  1T7S A;  5AQM B;  3FZL B;  1UK5 A;  5AQU B;  5AQS B;  5AQP B;  3LDQ B;  5AQH B;  3FZK B;  5AQT B;  1HX1 B;  4HWD A;  5AQQ B;  2D9D A;  1UGO A;  3FZH B;  5AQV B;  5AQK B;  5AQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...