3FZLB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 48
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzlB00
5AQFB 4HWHA 1HX1B 5AQSB 3FZHB 5AQMB 3FZKB 1T7SA 4HWFA 5AQQB 4HWIB 5AQIB 1M62A 5AQTB 5AQLB 2D9DA 5AQOB 5AQNB 4HWCA 1UGOA 5AQGB 1M7KA 5AQHB 5AQUB 3FZLB 5AQPB 3FZFB 3M3ZB 1I6ZA 4HWDA 5AQJB 5AQKB 5AQRB 5AQVB 3LDQB 3FZMB 3A8YC 1UK5A
chains in the Genus database with same CATH superfamily
2RPAA 1HX1B 2LT3A 4IDNA 3RQUA 2W00A 3QNUA 4DUYT 3ZT7A 2CHNA 2LM2A 4AISA 1SA0E 5F5WA 1HTJF 4CN4A 2HN1A 1WR6A 2AXDS 5DABA 5JR9C 1VRBA 5LJMA 3O1IA 2G0UA 2J62A 4L9IA 2BS2A 2CPTA 4QXCB 2XUEA 4TV9E 4JI4T 3VKHA 4LMJA 2LSYA 1NAFA 1CHUA 3D0TA 2H7OA 5LMUT 3VRAA 3AA7B 5JR9B 4IREA 2LLYA 4XZCA 3VR8A 2LE8A 1WR0A 1Y64B 3AE9A 4DVDA 4PFOA 2BKNA 4A98A 2BS4A 3SRZA 3GN5A 1UX5A 4YSYA 4UVCB 4EAHA 2NP9A 2RA1A 2NW7A 3UFGA 3M65A 3R84B 5FMNA 3ZKRA 4P09A 3EI0A 3AA6B 2FJEA 2VQFT 2I59A 2PTFA 4LMLA 2IAKA 4TX5A 1MMAA 2ACZA 2Q9QD 2XAQB 4AXPA 4DBQA 2KNDA 1E7PA 2OLTA 3JAFA 1FJGT 5AQKB 4EYYR 2LEHA 4QHOA 4LMKA 2X0YA 1MNDA 4C90A 3RPUA 4PW8A 4DR2T 1WYCA 5JTGA 1MIWA 5HYAA 3UUMA 3BQLA 3MACA 4MLKA 1E2AA 2IMLA 1QLBA 4HFBA 3KDSE 2RP4A 4PFPA 3K1SA 4DV0T 5A1LA 4NUUA 1N34T 5JDHA 2ACXA 3ONXA 1YKHB 3Q5DA 4NPPA 3ETUA 4LFBT 5JQGE 2UXNB 3OJAA 2CWOA 4KX6A 3C4WA 2XAFB 5ADXL 2BS3A 4TN7B 4ZOLE 3CIRA 4O2AE 3RYCE 2PJQA 4ADZA 2WU2A 4DMVA 4BJNA 1E1HB 1O3XA 5LP6E 4C91A 2EHOD 5GONE 1HG2A 3Q9DA 2KXPB 2MOZA 3U78A 3PDYA 2JQ9A 2XAGB 3FXEB 4LF5T 3UUNA 2LSIA 3UQ7A 4PNIA 1OEDC 2UUBT 2VWAA 3PUXF 3VKGA 3ZSSA 3O1JA 5L3DB 4ISSA 3O4XE 4XBFB 3QOFA 3AA0B 4B6XA 2XY8B 4DR4T 1WYBA 4CI2B 3AAAB 1MIVA 3N9LA 3VU7H 4A5XA 4PK5A 4ILUA 4AKHA 2LSJA 1OEDB 5FVLA 3ZJ1A 2JQQA 2QRXA 2M6IA 1KNRA 4AIUA 4JI3T 2J47A 4U2YA 3KV4A 3HA4A 3TLWA 4DUZT 2V1DB 4CI3B 2WMNA 1HFAA 4I55E 3RX6A 3PUAA 4QH1A 2V7IA 2XQ9A 2XQ4A 2VASA 1IZNB 1IAPA 2XQ5A 3ANWA 2VURA 5EK3A 1I94T 2X0HA 4UR9A 4NIQA 1VCTA 4U72A 2P9BA 2UXXB 5CA1E 4DR1T 4JI2T 2CBIA 2DWGA 2MAWA 4I0UA 4UV9B 5LYJE 3C51A 2ZM0A 3T1HT 2UUAT 2D9DA 1IBMT 2XHEB 3KVBA 3U3IA 5LBQB 2LOSA 3UULA 3JC6C 4UXNB 2L8KA 3X1DA 2CXDA 2YKSA 4H9PC 1ZHCA 2IDOB 4YTPA 4GKKT 1LKXA 3LBXA 5AQHB 3KINB 3M3ZB 2DHRA 4YHJA 4TWHA 1HG5A 2YU1A 5IWAT 2Y48B 4IE7A 3TKLB 2CE7A 4B3TT 4ZEYA 3I9YA 1KEYA 3L39A 3QB5K 2NTYA 3UU5A 2E5LT 2VK9A 1G8XA 2ZM2A 1SUMB 4AQYT 3N2OA 4HFHA 1YKEB 4P1NA 5HXRA 1UX4A 2V7JA 3ETVA 4HKAA 1Z0PA 3CVRA 5L4EA 2IIUA 3ZCJA 1W9RA 4PK4A 2E5VA 3ZN1B 2CHOA 3MKDA 1N33T 3FZKB 2DLRA 2XJ7A 5AQOB 4LF4T 2VB6A 1D1AA 1UCUA 2JQHA 3FZLB 2X9XA 3F2EA 4JLEA 2FBWA 2WAUA 3CQXC 1XMOT 3ZC0A 4UF0A 2UXBT 2XPKA 1KNPA 5L3CB 1BR1A 4DV1T 4UIGA 4H9NC 4EIWA 3ONJA 3NRXA 4U31A 2B1EA 2BG9A 3RF1A 2JMKA 3SFEA 3PUSA 3QB5A 4V1Av 4HWDA 4JV5T 1V9DA 3JC6D 3CQGB 2GK9A 3RKOA 1W09A 4AKIA 4ZI2D 1X9BA 5LXTE 5J2TE 2I6HA 4AKRB 4CXXA 4AI6A 2V5DA 3RI5A 3EDUA 3FZFB 2A9UA 5AQJB 2E9XD 2XAHB 3K8PC 2DNXA 3VHLA 1T98A 2KWHA 4YJ3E 4EEBA 1JNZA 3GMIA 4DV5T 4HFCA 2LRKA 4AKLA 3ABVA 3GN5B 2HN2A 1D0XA 2X51A 4FI5A 1NENA 3AEEA 3P4WA 3SOLA 3AEFA 4GYRA 2IC6A 3FXDB 4A97A 1SHZC 4GOUA 3RHWA 2V7LA 2XQ8A 2BVMA 3OBVE 2V6XA 3FB2A 2J4GA 5HEJA 3MXZA 4P0AA 3G06A 3B13A 3NZPA 4QKNA 4K0UA 1HCIA 5LHGB 4KHZF 4DMWA 2YINA 5H6QB 3RC8A 4DR6T 3NZQA 1XZYA 5FL1A 2QA7A 4UVAB 5HEHA 3ZYMA 2V6YA 3OVUA 5ABFA 1D0YA 4HWCA 5BR8T 2B76A 4IL4A 4JI5T 2CBJA 1YQ4A 5HAXA 3AVRA 5FP3A 4X1KE 2WSSV 4JI6T 4O8SA 4UVBB 3CMLA 1MMDA 3ZC1A 5FXXA 2CCQA 2YK0A 2ODUA 5JRCB 4NXMT 2Y8DA 1IJ6A 4UV8B 4DV7T 3WAJA 5CJ5A 2CXLA 4FJOA 2UXDT 3KBTA 4DV4T 3N5LA 3UT5E 2VKDA 4O4HE 4WBOA 4IE0A 3AXJA 5JDLA 3A8YC 1UK5A 5JDNA 3K3QC 4JI7T 3JCFA 2R6GF 4X65T 3OYXA 3UU6A 4GYSA 2N9DA 4EZ4A 3J9X1 4ILBA 3EVYA 4WW0A 3PU8A 3R6NA 1XWMA 2F4VT 1FMVA 2KSRA 4X5TA 3JAEA 3LJCA 2JQKA 1HNWT 2XQ7A 3PTRB 2IUBA 4ZI3C 2D0UA 4DV2T 1SE7A 4Z90A 3I0OA 4CQIA 4H63H 2KINB 2WS3A 2YDQA 2Q9QA 3RH3A 3KV6A 5HXCA 3RIAA 5AQQB 3ANWB 4YSZA 5LA6E 2VQET 2JPFA 5L3EB 3UU8A 1YXRA 2Z6EA 4EEDA 2FUPA 4K0KT 3ZMZB 4ZS2A 5LCYA 4DR5T 3AEDA 3PUQA 4YSXA 2M6BA 4ZHQE 5AQIB 5F3JA 4YJ2E 2XQYA 3L8RA 4ZXLA 2BKPA 3PURA 1XNQT 4OX9T 5L2LA 3AE1A 3Q5WA 2XM1A 3AECA 3CQCB 3LBXB 4Z8XA 2L9QA 5L3FB 5LHIB 3TLSA 4E7ZA 4NUVA 2DCFA 4DR3T 5FXZA 3NBXX 3F57A 1ZEEA 3ZMUB 2K9AA 4IGUA 5KX5E 2EHOA 3K3OA 3V5SA 4IIJE 4QWNB 2CM0A 2D0TA 4U2ZA 2WP9A 4OK0A 4TNWA 5AQMB 2YOEA 4ZI3D 2WBLA 3UQ4A 1XDOA 5HWXA 5HEUA 3L09A 2NW8A 3TLVA 2N1GA 2XZEA 3AVSA 1YD8G 3N2KE 5L3BB 2ZM6T 5AQSB 3HI2A 1T7SA 1OEDE 4IDOA 3RRWA 2LSKA 2H88A 4UF0B 4YY3T 3CWZB 3WAKA 2BG9C 4F6RC 4O4LE 4JYAT 5JDMA 1XMQT 3EHZA 2YDRA 5JVDE 2BDEA 3AE4A 5KXJA 4O4IE 3IA3A 4DR7T 3Q5EA 1QSDA 4DV6T 1M62A 2K48A 3ZYLA 4HE8A 3RIUA 2BG9B 2PBIA 4EV6A 1KFYA 2ZMAA 2AE9A 5JDGA 5LBMA 4OYKA 3C4ZA 1VOMA 3FZHB 4YLHA 2BVLA 2BBJA 4F8HA 2JIWA 5LOVE 2YEVC 4ILAA 2W62A 3ZMSB 5FY7A 3ZEFB 5ABEA 2VL8A 5AQFB 2XASB 3H37A 4EGWA 1S94A 1J5WA 4X1YE 2X9YA 2CLYB 2X67A 4B3ST 1UURA 4QH5A 3B57A 2LSGA 1FEWA 4H9OC 3O9XA 2PG8A 3AE7A 1ZP0A 2WU5A 3OTOT 2W2UA 2E2AA 5LHHB 3E08A 1DU2A 2A3DA 2CXFA 2ES0A 2FJBA 3N2GE 2VKJA 3RRCA 4U3CA 3LSVA 1D1CA 4JUYA 5HCMA 4AQFA 1OEDA 2K5BB 4HWHA 2MTQA 3RQWA 5HXHA 4WZXA 2WM9A 4M1PA 2KT9A 4AKGA 3AEBA 4XAXB 3BQIA 2V5CA 1MIYA 3FBZA 1W0BA 5TAOA 4I4TE 3ESLA 3PU3A 2V6YB 3AE8A 1W0AA 2CA5A 2XSBA 3PUGA 2L3LA 3LG7A 3T1YT 4U7YA 5ABFB 2XM2A 4PJLA 3NWIA 5JH7E 2ZM8A 4CXYA 5AQUB 1MMGA 4J2CA 4MFRA 4CXWA 5ABHA 2YDSA 3WI3A 4O4JE 2VKOA 1WRDA 4DIDB 1G73A 4COFA 2X9HA 3KV9A 2IW5B 3BQKA 4IDQA 3LK3B 2KWIB 3C50A 3HKEE 4LF6T 2CRBA 3RYFE 4EOZB 4QX7B 2I0MA 5JREA 2IC9A 4IHJE 1J5ET 2VKHA 5JDFA 4GK0E 1LVFA 3HKBE 2BBHA 1I6ZA 5ABGA 4H63V 5CGMA 1OWAA 4ANJA 5KMGP 3CX7B 2FJDA 3QC9A 3CK6A 4YTMA 3CX8B 3HR0A 2X9WA 2LOPA 2E9XA 1X79A 4MALA 2VVNA 1ZV4X 3TLUA 3PUVF 3E0ZA 2WWUA 2WQYA 2W63A 2V7MA 3N9OA 5CFBA 2Q9QC 5IYZE 4E7SA 4HWFA 2C0SA 4PK6A 2WDVA 4LF9T 3CPZA 1T8BA 2D2SA 2HHHT 4I50E 4TWDA 4YFSA 4I43B 1IBKT 4HFEA 4IDPA 2Q9QB 2KZ7B 3MJXA 3T8OA 3AB3B 3P4RA 4BAYB 1D0ZA 3UU3A 3MK7C 5CA0E 1M7KA 4HGAA 1S35A 3ZCIA 2JMHA 3A7MA 3K3NA 2X0LB 5LB7B 4HWIB 4U74A 5E0OA 2WMOA 4MHCA 3ZT5A 2UUCT 5FYMA 4EXTA 3RKGA 2FJAA 4IE5A 2XQ3A 3CX6B 1HF8A 3DP7A 4ERRA 2UXCT 3EUHA 2LHNA 3SWHA 2YU2A 3A5XA 3CKDA 3OKQA 2Y6XA 4U7IA 3KBUA 1H7CA 2EHOC 2NTXA 5J2UE 1FIOA 1EZ3A 2NWBA 3C64A 4H9QC 2KLQA 2X66A 5EK2A 3QK6A 4JI1T 2QYWA 3S4UA 2NR4A 3UFEA 2A72A 4PJNA 5HWYA 2EHOB 3P7IA 2OV9A 4IT4A 1UUSA 4TV8E 3TLTA 1WLXA 4HN9A 5FY0A 3IHRA 4PJMA 2J1DG 3NVOA 3P4SA 2C5JA 3N9MA 4WBNE 4WNKA 3P8CD 5AQRB 4X66T 2N2NA 3ZYKA 3HKCE 4X1IE 3RC3A 3AE5A 1VCSA 2CMRA 2XQ6A 4CN1A 4OHFA 2K3WA 2MPKA 2H7VC 3C98B 1WFDA 2C5IT 5KDMC 2D5UA 5HEGA 5EZYE 5FVKA 4IE6A 4HFVA 3RIUC 4LFCT 5IUXA 3ZPOA 2H3RA 5AQVB 2NW9A 3Q5XA 4KBMB 2LM9A 2CWYA 3AAIA 2WY2A 1Y01A 4Z91A 2ZLYA 4PAGA 5AQLB 4HEAA 4TNVA 3H3MA 1L0VA 4ZI7E 4GK5E 5M4YA 4IDZA 5HCJA 4UELA 2LKHA 1J1JA 4OFZA 1T72A 3AE6A 1HX8A 5JR9A 3RYIE 1U4QA 4ZZBA 3FHNA 2XSAA 1JNRA 3ZMVB 1MNEA 5L3GB 5AQGB 3OPCA 4JI0T 5FKYA 1KK7A 4GKJT 2HPJA 1HR0T 1YW0A 5JRCA 1U5PA 4EZHA 3FBLA 2W0GA 1HNXT 2X68A 3MZKB 4BJMA 3C4XA 4HFDA 2SPCA 1XDPA 4CI1B 2A2FX 3HL6A 2E8IA 3AE3A 4QXHB 3AEAA 1OXZA 3ZLIA 4ZS3A 4CN6A 3P4PA 2LJLA 4AQFC 3AE2A 1HS7A 5LMNT 1QUUA 4A56A 3I9WA 4L5GA 1MMNA 3LFMA 3OYZA 4CZZB 2MBGA 5IHYA 3EAMA 5AQTB 4LF7T 4IL9A 2IHR1 2WWVA 1IJ5A 2WCAA 3N9QA 5J0ZA 2JRKA 2LKGA 3BK9A 5FNVE 2WDQA 3IEEA 4UEMA 4X62T 1BR2A 4B3RT 1YQ3A 3GA8A 3IF8B 5BMVE 3UUXB 4H9SE 3PUYF 2C5KT 1NEKA 1R8IA 3KVAA 3UU4A 3PE0A 1FMWA 4YT0A 1US7B 4YXDA 5LJNA 5HXEA 5LGTB 3VR9A 4B3MT 2W61A 4DNDA 2MYSA 2W4XA 2QVAA 2LRLA 3VRBA 4ISTA 1XNRT 4WYVA 4GIWA 3PUWF 5LGUB 3J7Yq 5J1GA 4HTEA 4X64T 2V7KA 4MBQA 2BZBA 2CLYC 2VL0A 4HFIA 4TZ4C 2V8SV 4EB6E 3AAEB 1NWMX 3PJAJ 2BG9E 5DJQC 5C3JA 4H9RC 4ZI2C 4G63A 4KI0F 1D1BA 5F8PA 5L47A 5CB4E 3KFWX 1N32T 3L3PA 1BR4A 3SS1A 1ZOYA 3AEGA 1UGOA 2E9XC 2WB5A 4G2AA 2W67A 3SFDA 3HKDE 5LG4A 4TUYE 3O1HA 5FXWA 3RIFA 1GQEA 3PUZF 4KMCA 3RYHE 5L4HA 4ZZCA 3V5UA 4TWFA 5LG3A 2KMFA 4OYJA 2E9XB 1B7TA 4QXBB 3ZSTA 4AQGA 4YHHT 4JI8T 2NOXA 3MA9A 3LK2B 3PJAA 3NKZA 1BR0A 3LDQB 4QH4A 2W66A 3ONLC 4JEHB 5H6RB 3P4QA 4ASKA 3AA1B 2QGSA 1HNZT 5LGNB 4DV3T 2YN6A 4U33A 5AQPB 2DL1A 1ZKEA 3KV5A 1LVKA 5LNKA 2ODVA 2M67A 1IBLT 3ZN0B 1WCRA 2HH7A 2XAJB 2XTLA 5HXSA 2LHRA 5FL0A 3N9PA 2VVSA 3JADA 2H89A 4L0RA 4ILCA 3F31A 4DBRA 4NXNT 3PV0F 3P50A 5C2TA 2UU9T 2K24A 2OA5A 3EDVA 4IE4A 3IBPA 2WZHA 4PJJA 5FY1A 5C8YE 4EYUA 4LF8T 3ZMTB 4X20E 3RGLA 4JBWF 3W15B 2WZIA 4N78D 3NRYA 2CEAA 3LK42 3UUBA 2V26A 3I0QA 4QX8B 5DQVA 5DQWA 3ZT6A 4P0BA 2PFVA 3UTKA 1Z8UA 4O2BE 3AXJB 3QUJA 1KNZA 5EK4A 3DJBA 5ETWA 2DI4A 2WDRA 2DWKA 3RLFF 4KHPT 2JJ9A 3DTOA 3H3AA 3ZJ2A 5FXVA 4YTNA 5JDQA 3N9NA 3I1AA 1CUNA 2HPLA 1LRZA 2XQAA 5AFUL 3GWHA 1KF6A 5AQNB 3Q2MA 4LFAT 4Q25A 1AJ3A 2BKOA 3E22E 3B5MA 1N36T 3EABA 4DO0A 4JEUB 4KP3C 3FZMB 4KUMB 4BA9A 5HEOA
chains in the Genus database with same CATH topology
5AQFB 4HWHA 1HX1B 5AQSB 3FZHB 5AQMB 3FZKB 1T7SA 4HWFA 5AQQB 4HWIB 5AQIB 1M62A 5AQTB 5AQLB 2D9DA 5AQOB 5AQNB 4HWCA 1UGOA 5AQGB 1M7KA 5AQHB 5AQUB 3FZLB 5AQPB 3FZFB 3M3ZB 1I6ZA 4HWDA 5AQJB 5AQKB 5AQRB 5AQVB 3LDQB 3FZMB 3A8YC 1UK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQF B;  4HWH A;  1HX1 B;  5AQS B;  3FZH B;  5AQM B;  3FZK B;  1T7S A;  4HWF A;  5AQQ B;  4HWI B;  5AQI B;  1M62 A;  5AQT B;  5AQL B;  2D9D A;  5AQO B;  5AQN B;  4HWC A;  1UGO A;  5AQG B;  1M7K A;  5AQH B;  5AQU B;  3FZL B;  5AQP B;  3FZF B;  3M3Z B;  1I6Z A;  4HWD A;  5AQJ B;  5AQK B;  5AQR B;  5AQV B;  3LDQ B;  3FZM B;  3A8Y C;  1UK5 A; 
#chains in the Genus database with same CATH topology
 2RPA A;  1HX1 B;  2LT3 A;  4IDN A;  3RQU A;  2W00 A;  3QNU A;  4DUY T;  3ZT7 A;  2CHN A;  2LM2 A;  4AIS A;  1SA0 E;  5F5W A;  1HTJ F;  4CN4 A;  2HN1 A;  1WR6 A;  2AXD S;  5DAB A;  5JR9 C;  1VRB A;  5LJM A;  3O1I A;  2G0U A;  2J62 A;  4L9I A;  2BS2 A;  2CPT A;  4QXC B;  2XUE A;  4TV9 E;  4JI4 T;  3VKH A;  4LMJ A;  2LSY A;  1NAF A;  1CHU A;  3D0T A;  2H7O A;  5LMU T;  3VRA A;  3AA7 B;  5JR9 B;  4IRE A;  2LLY A;  4XZC A;  3VR8 A;  2LE8 A;  1WR0 A;  1Y64 B;  3AE9 A;  4DVD A;  4PFO A;  2BKN A;  4A98 A;  2BS4 A;  3SRZ A;  3GN5 A;  1UX5 A;  4YSY A;  4UVC B;  4EAH A;  2NP9 A;  2RA1 A;  2NW7 A;  3UFG A;  3M65 A;  3R84 B;  5FMN A;  3ZKR A;  4P09 A;  3EI0 A;  3AA6 B;  2FJE A;  2VQF T;  2I59 A;  2PTF A;  4LML A;  2IAK A;  4TX5 A;  1MMA A;  2ACZ A;  2Q9Q D;  2XAQ B;  4AXP A;  4DBQ A;  2KND A;  1E7P A;  2OLT A;  3JAF A;  1FJG T;  5AQK B;  4EYY R;  2LEH A;  4QHO A;  4LMK A;  2X0Y A;  1MND A;  4C90 A;  3RPU A;  4PW8 A;  4DR2 T;  1WYC A;  5JTG A;  1MIW A;  5HYA A;  3UUM A;  3BQL A;  3MAC A;  4MLK A;  1E2A A;  2IML A;  1QLB A;  4HFB A;  3KDS E;  2RP4 A;  4PFP A;  3K1S A;  4DV0 T;  5A1L A;  4NUU A;  1N34 T;  5JDH A;  2ACX A;  3ONX A;  1YKH B;  3Q5D A;  4NPP A;  3ETU A;  4LFB T;  5JQG E;  2UXN B;  3OJA A;  2CWO A;  4KX6 A;  3C4W A;  2XAF B;  5ADX L;  2BS3 A;  4TN7 B;  4ZOL E;  3CIR A;  4O2A E;  3RYC E;  2PJQ A;  4ADZ A;  2WU2 A;  4DMV A;  4BJN A;  1E1H B;  1O3X A;  5LP6 E;  4C91 A;  2EHO D;  5GON E;  1HG2 A;  3Q9D A;  2KXP B;  2MOZ A;  3U78 A;  3PDY A;  2JQ9 A;  2XAG B;  3FXE B;  4LF5 T;  3UUN A;  2LSI A;  3UQ7 A;  4PNI A;  1OED C;  2UUB T;  2VWA A;  3PUX F;  3VKG A;  3ZSS A;  3O1J A;  5L3D B;  4ISS A;  3O4X E;  4XBF B;  3QOF A;  3AA0 B;  4B6X A;  2XY8 B;  4DR4 T;  1WYB A;  4CI2 B;  3AAA B;  1MIV A;  3N9L A;  3VU7 H;  4A5X A;  4PK5 A;  4ILU A;  4AKH A;  2LSJ A;  1OED B;  5FVL A;  3ZJ1 A;  2JQQ A;  2QRX A;  2M6I A;  1KNR A;  4AIU A;  4JI3 T;  2J47 A;  4U2Y A;  3KV4 A;  3HA4 A;  3TLW A;  4DUZ T;  2V1D B;  4CI3 B;  2WMN A;  1HFA A;  4I55 E;  3RX6 A;  3PUA A;  4QH1 A;  2V7I A;  2XQ9 A;  2XQ4 A;  2VAS A;  1IZN B;  1IAP A;  2XQ5 A;  3ANW A;  2VUR A;  5EK3 A;  1I94 T;  2X0H A;  4UR9 A;  4NIQ A;  1VCT A;  4U72 A;  2P9B A;  2UXX B;  5CA1 E;  4DR1 T;  4JI2 T;  2CBI A;  2DWG A;  2MAW A;  4I0U A;  4UV9 B;  5LYJ E;  3C51 A;  2ZM0 A;  3T1H T;  2UUA T;  2D9D A;  1IBM T;  2XHE B;  3KVB A;  3U3I A;  5LBQ B;  2LOS A;  3UUL A;  3JC6 C;  4UXN B;  2L8K A;  3X1D A;  2CXD A;  2YKS A;  4H9P C;  1ZHC A;  2IDO B;  4YTP A;  4GKK T;  1LKX A;  3LBX A;  5AQH B;  3KIN B;  3M3Z B;  2DHR A;  4YHJ A;  4TWH A;  1HG5 A;  2YU1 A;  5IWA T;  2Y48 B;  4IE7 A;  3TKL B;  2CE7 A;  4B3T T;  4ZEY A;  3I9Y A;  1KEY A;  3L39 A;  3QB5 K;  2NTY A;  3UU5 A;  2E5L T;  2VK9 A;  1G8X A;  2ZM2 A;  1SUM B;  4AQY T;  3N2O A;  4HFH A;  1YKE B;  4P1N A;  5HXR A;  1UX4 A;  2V7J A;  3ETV A;  4HKA A;  1Z0P A;  3CVR A;  5L4E A;  2IIU A;  3ZCJ A;  1W9R A;  4PK4 A;  2E5V A;  3ZN1 B;  2CHO A;  3MKD A;  1N33 T;  3FZK B;  2DLR A;  2XJ7 A;  5AQO B;  4LF4 T;  2VB6 A;  1D1A A;  1UCU A;  2JQH A;  3FZL B;  2X9X A;  3F2E A;  4JLE A;  2FBW A;  2WAU A;  3CQX C;  1XMO T;  3ZC0 A;  4UF0 A;  2UXB T;  2XPK A;  1KNP A;  5L3C B;  1BR1 A;  4DV1 T;  4UIG A;  4H9N C;  4EIW A;  3ONJ A;  3NRX A;  4U31 A;  2B1E A;  2BG9 A;  3RF1 A;  2JMK A;  3SFE A;  3PUS A;  3QB5 A;  4V1A v;  4HWD A;  4JV5 T;  1V9D A;  3JC6 D;  3CQG B;  2GK9 A;  3RKO A;  1W09 A;  4AKI A;  4ZI2 D;  1X9B A;  5LXT E;  5J2T E;  2I6H A;  4AKR B;  4CXX A;  4AI6 A;  2V5D A;  3RI5 A;  3EDU A;  3FZF B;  2A9U A;  5AQJ B;  2E9X D;  2XAH B;  3K8P C;  2DNX A;  3VHL A;  1T98 A;  2KWH A;  4YJ3 E;  4EEB A;  1JNZ A;  3GMI A;  4DV5 T;  4HFC A;  2LRK A;  4AKL A;  3ABV A;  3GN5 B;  2HN2 A;  1D0X A;  2X51 A;  4FI5 A;  1NEN A;  3AEE A;  3P4W A;  3SOL A;  3AEF A;  4GYR A;  2IC6 A;  3FXD B;  4A97 A;  1SHZ C;  4GOU A;  3RHW A;  2V7L A;  2XQ8 A;  2BVM A;  3OBV E;  2V6X A;  3FB2 A;  2J4G A;  5HEJ A;  3MXZ A;  4P0A A;  3G06 A;  3B13 A;  3NZP A;  4QKN A;  4K0U A;  1HCI A;  5LHG B;  4KHZ F;  4DMW A;  2YIN A;  5H6Q B;  3RC8 A;  4DR6 T;  3NZQ A;  1XZY A;  5FL1 A;  2QA7 A;  4UVA B;  5HEH A;  3ZYM A;  2V6Y A;  3OVU A;  5ABF A;  1D0Y A;  4HWC A;  5BR8 T;  2B76 A;  4IL4 A;  4JI5 T;  2CBJ A;  1YQ4 A;  5HAX A;  3AVR A;  5FP3 A;  4X1K E;  2WSS V;  4JI6 T;  4O8S A;  4UVB B;  3CML A;  1MMD A;  3ZC1 A;  5FXX A;  2CCQ A;  2YK0 A;  2ODU A;  5JRC B;  4NXM T;  2Y8D A;  1IJ6 A;  4UV8 B;  4DV7 T;  3WAJ A;  5CJ5 A;  2CXL A;  4FJO A;  2UXD T;  3KBT A;  4DV4 T;  3N5L A;  3UT5 E;  2VKD A;  4O4H E;  4WBO A;  4IE0 A;  3AXJ A;  5JDL A;  3A8Y C;  1UK5 A;  5JDN A;  3K3Q C;  4JI7 T;  3JCF A;  2R6G F;  4X65 T;  3OYX A;  3UU6 A;  4GYS A;  2N9D A;  4EZ4 A;  3J9X 1;  4ILB A;  3EVY A;  4WW0 A;  3PU8 A;  3R6N A;  1XWM A;  2F4V T;  1FMV A;  2KSR A;  4X5T A;  3JAE A;  3LJC A;  2JQK A;  1HNW T;  2XQ7 A;  3PTR B;  2IUB A;  4ZI3 C;  2D0U A;  4DV2 T;  1SE7 A;  4Z90 A;  3I0O A;  4CQI A;  4H63 H;  2KIN B;  2WS3 A;  2YDQ A;  2Q9Q A;  3RH3 A;  3KV6 A;  5HXC A;  3RIA A;  5AQQ B;  3ANW B;  4YSZ A;  5LA6 E;  2VQE T;  2JPF A;  5L3E B;  3UU8 A;  1YXR A;  2Z6E A;  4EED A;  2FUP A;  4K0K T;  3ZMZ B;  4ZS2 A;  5LCY A;  4DR5 T;  3AED A;  3PUQ A;  4YSX A;  2M6B A;  4ZHQ E;  5AQI B;  5F3J A;  4YJ2 E;  2XQY A;  3L8R A;  4ZXL A;  2BKP A;  3PUR A;  1XNQ T;  4OX9 T;  5L2L A;  3AE1 A;  3Q5W A;  2XM1 A;  3AEC A;  3CQC B;  3LBX B;  4Z8X A;  2L9Q A;  5L3F B;  5LHI B;  3TLS A;  4E7Z A;  4NUV A;  2DCF A;  4DR3 T;  5FXZ A;  3NBX X;  3F57 A;  1ZEE A;  3ZMU B;  2K9A A;  4IGU A;  5KX5 E;  2EHO A;  3K3O A;  3V5S A;  4IIJ E;  4QWN B;  2CM0 A;  2D0T A;  4U2Z A;  2WP9 A;  4OK0 A;  4TNW A;  5AQM B;  2YOE A;  4ZI3 D;  2WBL A;  3UQ4 A;  1XDO A;  5HWX A;  5HEU A;  3L09 A;  2NW8 A;  3TLV A;  2N1G A;  2XZE A;  3AVS A;  1YD8 G;  3N2K E;  5L3B B;  2ZM6 T;  5AQS B;  3HI2 A;  1T7S A;  1OED E;  4IDO A;  3RRW A;  2LSK A;  2H88 A;  4UF0 B;  4YY3 T;  3CWZ B;  3WAK A;  2BG9 C;  4F6R C;  4O4L E;  4JYA T;  5JDM A;  1XMQ T;  3EHZ A;  2YDR A;  5JVD E;  2BDE A;  3AE4 A;  5KXJ A;  4O4I E;  3IA3 A;  4DR7 T;  3Q5E A;  1QSD A;  4DV6 T;  1M62 A;  2K48 A;  3ZYL A;  4HE8 A;  3RIU A;  2BG9 B;  2PBI A;  4EV6 A;  1KFY A;  2ZMA A;  2AE9 A;  5JDG A;  5LBM A;  4OYK A;  3C4Z A;  1VOM A;  3FZH B;  4YLH A;  2BVL A;  2BBJ A;  4F8H A;  2JIW A;  5LOV E;  2YEV C;  4ILA A;  2W62 A;  3ZMS B;  5FY7 A;  3ZEF B;  5ABE A;  2VL8 A;  5AQF B;  2XAS B;  3H37 A;  4EGW A;  1S94 A;  1J5W A;  4X1Y E;  2X9Y A;  2CLY B;  2X67 A;  4B3S T;  1UUR A;  4QH5 A;  3B57 A;  2LSG A;  1FEW A;  4H9O C;  3O9X A;  2PG8 A;  3AE7 A;  1ZP0 A;  2WU5 A;  3OTO T;  2W2U A;  2E2A A;  5LHH B;  3E08 A;  1DU2 A;  2A3D A;  2CXF A;  2ES0 A;  2FJB A;  3N2G E;  2VKJ A;  3RRC A;  4U3C A;  3LSV A;  1D1C A;  4JUY A;  5HCM A;  4AQF A;  1OED A;  2K5B B;  4HWH A;  2MTQ A;  3RQW A;  5HXH A;  4WZX A;  2WM9 A;  4M1P A;  2KT9 A;  4AKG A;  3AEB A;  4XAX B;  3BQI A;  2V5C A;  1MIY A;  3FBZ A;  1W0B A;  5TAO A;  4I4T E;  3ESL A;  3PU3 A;  2V6Y B;  3AE8 A;  1W0A A;  2CA5 A;  2XSB A;  3PUG A;  2L3L A;  3LG7 A;  3T1Y T;  4U7Y A;  5ABF B;  2XM2 A;  4PJL A;  3NWI A;  5JH7 E;  2ZM8 A;  4CXY A;  5AQU B;  1MMG A;  4J2C A;  4MFR A;  4CXW A;  5ABH A;  2YDS A;  3WI3 A;  4O4J E;  2VKO A;  1WRD A;  4DID B;  1G73 A;  4COF A;  2X9H A;  3KV9 A;  2IW5 B;  3BQK A;  4IDQ A;  3LK3 B;  2KWI B;  3C50 A;  3HKE E;  4LF6 T;  2CRB A;  3RYF E;  4EOZ B;  4QX7 B;  2I0M A;  5JRE A;  2IC9 A;  4IHJ E;  1J5E T;  2VKH A;  5JDF A;  4GK0 E;  1LVF A;  3HKB E;  2BBH A;  1I6Z A;  5ABG A;  4H63 V;  5CGM A;  1OWA A;  4ANJ A;  5KMG P;  3CX7 B;  2FJD A;  3QC9 A;  3CK6 A;  4YTM A;  3CX8 B;  3HR0 A;  2X9W A;  2LOP A;  2E9X A;  1X79 A;  4MAL A;  2VVN A;  1ZV4 X;  3TLU A;  3PUV F;  3E0Z A;  2WWU A;  2WQY A;  2W63 A;  2V7M A;  3N9O A;  5CFB A;  2Q9Q C;  5IYZ E;  4E7S A;  4HWF A;  2C0S A;  4PK6 A;  2WDV A;  4LF9 T;  3CPZ A;  1T8B A;  2D2S A;  2HHH T;  4I50 E;  4TWD A;  4YFS A;  4I43 B;  1IBK T;  4HFE A;  4IDP A;  2Q9Q B;  2KZ7 B;  3MJX A;  3T8O A;  3AB3 B;  3P4R A;  4BAY B;  1D0Z A;  3UU3 A;  3MK7 C;  5CA0 E;  1M7K A;  4HGA A;  1S35 A;  3ZCI A;  2JMH A;  3A7M A;  3K3N A;  2X0L B;  5LB7 B;  4HWI B;  4U74 A;  5E0O A;  2WMO A;  4MHC A;  3ZT5 A;  2UUC T;  5FYM A;  4EXT A;  3RKG A;  2FJA A;  4IE5 A;  2XQ3 A;  3CX6 B;  1HF8 A;  3DP7 A;  4ERR A;  2UXC T;  3EUH A;  2LHN A;  3SWH A;  2YU2 A;  3A5X A;  3CKD A;  3OKQ A;  2Y6X A;  4U7I A;  3KBU A;  1H7C A;  2EHO C;  2NTX A;  5J2U E;  1FIO A;  1EZ3 A;  2NWB A;  3C64 A;  4H9Q C;  2KLQ A;  2X66 A;  5EK2 A;  3QK6 A;  4JI1 T;  2QYW A;  3S4U A;  2NR4 A;  3UFE A;  2A72 A;  4PJN A;  5HWY A;  2EHO B;  3P7I A;  2OV9 A;  4IT4 A;  1UUS A;  4TV8 E;  3TLT A;  1WLX A;  4HN9 A;  5FY0 A;  3IHR A;  4PJM A;  2J1D G;  3NVO A;  3P4S A;  2C5J A;  3N9M A;  4WBN E;  4WNK A;  3P8C D;  5AQR B;  4X66 T;  2N2N A;  3ZYK A;  3HKC E;  4X1I E;  3RC3 A;  3AE5 A;  1VCS A;  2CMR A;  2XQ6 A;  4CN1 A;  4OHF A;  2K3W A;  2MPK A;  2H7V C;  3C98 B;  1WFD A;  2C5I T;  5KDM C;  2D5U A;  5HEG A;  5EZY E;  5FVK A;  4IE6 A;  4HFV A;  3RIU C;  4LFC T;  5IUX A;  3ZPO A;  2H3R A;  5AQV B;  2NW9 A;  3Q5X A;  4KBM B;  2LM9 A;  2CWY A;  3AAI A;  2WY2 A;  1Y01 A;  4Z91 A;  2ZLY A;  4PAG A;  5AQL B;  4HEA A;  4TNV A;  3H3M A;  1L0V A;  4ZI7 E;  4GK5 E;  5M4Y A;  4IDZ A;  5HCJ A;  4UEL A;  2LKH A;  1J1J A;  4OFZ A;  1T72 A;  3AE6 A;  1HX8 A;  5JR9 A;  3RYI E;  1U4Q A;  4ZZB A;  3FHN A;  2XSA A;  1JNR A;  3ZMV B;  1MNE A;  5L3G B;  5AQG B;  3OPC A;  4JI0 T;  5FKY A;  1KK7 A;  4GKJ T;  2HPJ A;  1HR0 T;  1YW0 A;  5JRC A;  1U5P A;  4EZH A;  3FBL A;  2W0G A;  1HNX T;  2X68 A;  3MZK B;  4BJM A;  3C4X A;  4HFD A;  2SPC A;  1XDP A;  4CI1 B;  2A2F X;  3HL6 A;  2E8I A;  3AE3 A;  4QXH B;  3AEA A;  1OXZ A;  3ZLI A;  4ZS3 A;  4CN6 A;  3P4P A;  2LJL A;  4AQF C;  3AE2 A;  1HS7 A;  5LMN T;  1QUU A;  4A56 A;  3I9W A;  4L5G A;  1MMN A;  3LFM A;  3OYZ A;  4CZZ B;  2MBG A;  5IHY A;  3EAM A;  5AQT B;  4LF7 T;  4IL9 A;  2IHR 1;  2WWV A;  1IJ5 A;  2WCA A;  3N9Q A;  5J0Z A;  2JRK A;  2LKG A;  3BK9 A;  5FNV E;  2WDQ A;  3IEE A;  4UEM A;  4X62 T;  1BR2 A;  4B3R T;  1YQ3 A;  3GA8 A;  3IF8 B;  5BMV E;  3UUX B;  4H9S E;  3PUY F;  2C5K T;  1NEK A;  1R8I A;  3KVA A;  3UU4 A;  3PE0 A;  1FMW A;  4YT0 A;  1US7 B;  4YXD A;  5LJN A;  5HXE A;  5LGT B;  3VR9 A;  4B3M T;  2W61 A;  4DND A;  2MYS A;  2W4X A;  2QVA A;  2LRL A;  3VRB A;  4IST A;  1XNR T;  4WYV A;  4GIW A;  3PUW F;  5LGU B;  3J7Y q;  5J1G A;  4HTE A;  4X64 T;  2V7K A;  4MBQ A;  2BZB A;  2CLY C;  2VL0 A;  4HFI A;  4TZ4 C;  2V8S V;  4EB6 E;  3AAE B;  1NWM X;  3PJA J;  2BG9 E;  5DJQ C;  5C3J A;  4H9R C;  4ZI2 C;  4G63 A;  4KI0 F;  1D1B A;  5F8P A;  5L47 A;  5CB4 E;  3KFW X;  1N32 T;  3L3P A;  1BR4 A;  3SS1 A;  1ZOY A;  3AEG A;  1UGO A;  2E9X C;  2WB5 A;  4G2A A;  2W67 A;  3SFD A;  3HKD E;  5LG4 A;  4TUY E;  3O1H A;  5FXW A;  3RIF A;  1GQE A;  3PUZ F;  4KMC A;  3RYH E;  5L4H A;  4ZZC A;  3V5U A;  4TWF A;  5LG3 A;  2KMF A;  4OYJ A;  2E9X B;  1B7T A;  4QXB B;  3ZST A;  4AQG A;  4YHH T;  4JI8 T;  2NOX A;  3MA9 A;  3LK2 B;  3PJA A;  3NKZ A;  1BR0 A;  3LDQ B;  4QH4 A;  2W66 A;  3ONL C;  4JEH B;  5H6R B;  3P4Q A;  4ASK A;  3AA1 B;  2QGS A;  1HNZ T;  5LGN B;  4DV3 T;  2YN6 A;  4U33 A;  5AQP B;  2DL1 A;  1ZKE A;  3KV5 A;  1LVK A;  5LNK A;  2ODV A;  2M67 A;  1IBL T;  3ZN0 B;  1WCR A;  2HH7 A;  2XAJ B;  2XTL A;  5HXS A;  2LHR A;  5FL0 A;  3N9P A;  2VVS A;  3JAD A;  2H89 A;  4L0R A;  4ILC A;  3F31 A;  4DBR A;  4NXN T;  3PV0 F;  3P50 A;  5C2T A;  2UU9 T;  2K24 A;  2OA5 A;  3EDV A;  4IE4 A;  3IBP A;  2WZH A;  4PJJ A;  5FY1 A;  5C8Y E;  4EYU A;  4LF8 T;  3ZMT B;  4X20 E;  3RGL A;  4JBW F;  3W15 B;  2WZI A;  4N78 D;  3NRY A;  2CEA A;  3LK4 2;  3UUB A;  2V26 A;  3I0Q A;  4QX8 B;  5DQV A;  5DQW A;  3ZT6 A;  4P0B A;  2PFV A;  3UTK A;  1Z8U A;  4O2B E;  3AXJ B;  3QUJ A;  1KNZ A;  5EK4 A;  3DJB A;  5ETW A;  2DI4 A;  2WDR A;  2DWK A;  3RLF F;  4KHP T;  2JJ9 A;  3DTO A;  3H3A A;  3ZJ2 A;  5FXV A;  4YTN A;  5JDQ A;  3N9N A;  3I1A A;  1CUN A;  2HPL A;  1LRZ A;  2XQA A;  5AFU L;  3GWH A;  1KF6 A;  5AQN B;  3Q2M A;  4LFA T;  4Q25 A;  1AJ3 A;  2BKO A;  3E22 E;  3B5M A;  1N36 T;  3EAB A;  4DO0 A;  4JEU B;  4KP3 C;  3FZM B;  4KUM B;  4BA9 A;  5HEO A; 
#chains in the Genus database with same CATH homology
 5AQF B;  4HWH A;  1HX1 B;  5AQS B;  3FZH B;  5AQM B;  3FZK B;  1T7S A;  4HWF A;  5AQQ B;  4HWI B;  5AQI B;  1M62 A;  5AQT B;  5AQL B;  2D9D A;  5AQO B;  5AQN B;  4HWC A;  1UGO A;  5AQG B;  1M7K A;  5AQH B;  5AQU B;  3FZL B;  5AQP B;  3FZF B;  3M3Z B;  1I6Z A;  4HWD A;  5AQJ B;  5AQK B;  5AQR B;  5AQV B;  3LDQ B;  3FZM B;  3A8Y C;  1UK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...