3FZLB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
111
structure length
111
Chain Sequence
b'GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 48
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzlB00
1UK5A 1HX1B 4HWDA 5AQKB 3FZLB 1M7KA 5AQQB 5AQHB 5AQGB 5AQSB 3FZKB 4HWHA 5AQIB 5AQTB 5AQOB 5AQMB 4HWIB 3FZFB 5AQNB 3A8YC 1UGOA 5AQJB 2D9DA 4HWFA 3FZHB 1T7SA 3M3ZB 1I6ZA 3FZMB 4HWCA 1M62A 5AQLB 5AQUB 5AQFB 5AQPB 3LDQB 5AQVB 5AQRB
chains in the Genus database with same CATH superfamily
1JNRA 3UU8A 5HXSA 4JBWF 4HFEA 2JQKA 2PTFA 2Q9QC 5BMVE 2E9XA 4DBRA 2KT9A 4HFBA 1XZYA 2LJLA 4JI4T 4CXWA 3UFEA 2XAQB 2B1EA 2XAJB 2M6IA 2XTLA 4I0UA 1XDOA 2Q9QB 3MJXA 3PUAA 5F3JA 2EHOD 4WBOA 2WZHA 4LFCT 1MNDA 4DV7T 3LK2B 3O1IA 4YY3T 1WYCA 4JEHB 2WDRA 4PFPA 4BJNA 4X5TA 3VU7H 4IT4A 5HWYA 3C4WA 1YKEB 3ETVA 2WAUA 1ZHCA 5ETWA 3IBPA 3WI3A 2XY8B 4YJ3E 3EABA 3AE7A 4GOUA 4EIWA 2LE8A 4DR7T 3E08A 5AQOB 3Q2MA 4ZZCA 2A72A 3EDVA 3AA0B 4TNVA 4A98A 2A9UA 3K3OA 2WS3A 2NP9A 4EB6E 4LF9T 2XQ6A 3AA1B 2VB6A 2F4VT 1BR0A 5FXVA 3ONLC 4DNDA 3AA6B 3P50A 3PUSA 4UVAB 3TLVA 3N2OA 3T1HT 5LOVE 2B76A 2E9XC 2V8SV 2LM2A 3HKCE 4B3TT 3I1AA 3VKGA 2J47A 3TLWA 2CMRA 5AQMB 2WDVA 2A2FX 4KI0F 2J4GA 5L3DB 3ZYKA 3O1JA 3RQWA 2X9YA 4LF7T 2C5JA 2E9XB 4JEUB 1HF8A 4EZHA 5AQQB 1L0VA 3CX6B 4ZEYA 1OEDA 2XQ9A 5HYAA 3AE6A 3UQ4A 1IBKT 3H37A 2XQ4A 5C3JA 3RIUA 1MIWA 3C64A 1HS7A 5HAXA 2V7IA 4H9RC 2IC9A 4YXDA 5KXJA 4HEAA 2NTYA 1YKHB 4K0KT 2IUBA 4EOZB 5KMGP 3M3ZB 4IIJE 2VVSA 3GN5A 3HKEE 3I0QA 1US7B 4BA9A 3L8RA 3D0TA 3RYCE 2JQ9A 1WLXA 2HHHT 3FHNA 2MOZA 4YSZA 2W4XA 3ZJ1A 1QUUA 4ERRA 4HGAA 3LDQB 2XQ7A 4ZI2C 3C4XA 2JPFA 4HKAA 2XASB 2V5CA 2QRXA 3RC8A 3CK6A 1UURA 3RKGA 2QGSA 3QK6A 2X0HA 2KLQA 3CPZA 5FNVE 1QSDA 4O2AE 3L39A 1D0XA 3FZMB 3P4SA 2VL8A 2DCFA 4NUVA 1HX1B 1O3XA 3BK9A 1I94T 3JAEA 1MMNA 2CLYC 3Q5XA 1HCIA 5F5WA 4TV9E 2LSGA 4KX6A 3GMIA 3VKHA 2XQ5A 2W63A 4J2CA 3UU6A 2W00A 1OEDC 3N9PA 2Q9QD 2L3LA 2CHOA 4ASKA 1NENA 3FZLB 3RIUC 5AQHB 1R8IA 4HWHA 4AKRB 3E22E 3R84B 4YJ2E 2UXBT 3FB2A 5L3FB 4YHHT 5DABA 1OEDB 2LSKA 4CI1B 3JADA 4YTMA 4TWHA 1YQ3A 4LF4T 5JDGA 1KNPA 4TV8E 4HFDA 4B3ST 1E2AA 4DBQA 2WMNA 5HXCA 3AEFA 1I6ZA 2VKDA 2C0SA 5DQWA 1M62A 2CXLA 5HXRA 3P8CD 1WR6A 3ZMVB 1SE7A 1HR0T 1IZNB 4UVCB 2YU1A 1UCUA 3U3IA 1HNWT 4DUYT 4DO0A 1QLBA 3UUNA 4HWCA 2RP4A 4IDPA 1D0ZA 3N5LA 2BS4A 4IDNA 2UXXB 1WCRA 2WMOA 3EAMA 5AFUL 4JUYA 1H7CA 4M1PA 2W67A 4YFSA 1UGOA 4WNKA 2IIUA 5KX5E 2BKNA 1J5ET 3RHWA 3Q5DA 2W2UA 2E9XD 3G06A 2DWGA 2RA1A 5JRCA 2BKPA 4HFIA 2W62A 2LM9A 4U7YA 2MPKA 5L3CB 2XAHB 2V7LA 2VVNA 3FBZA 4GYRA 4IE4A 4CI3B 4OYJA 3RKOA 4X66T 5HCMA 1NWMX 2ODVA 3HR0A 4IE6A 3GWHA 3FZFB 1D1AA 3A8YC 5JDMA 1HG2A 2JJ9A 1YXRA 2CBJA 3PV0F 3ZCIA 3GA8A 3CIRA 3E0ZA 4FJOA 5JDHA 2K9AA 2V26A 3AAEB 1HG5A 3U78A 3ZN1B 3UTKA 4EYUA 2V7KA 4QWNB 4DVDA 3LK3B 3V5SA 5CGMA 2XSBA 3N9LA 4KP3C 4TWFA 2BS3A 5HEJA 3PE0A 4MHCA 5ABFA 4DV3T 2DWKA 4DV1T 5HEGA 2ZM6T 3QNUA 3SS1A 1ZEEA 2LOPA 3LSVA 3MACA 2IDOB 4ZI2D 4UR9A 2YN6A 5CA1E 3K3NA 1Y01A 5JREA 3VHLA 4V1Av 5HEUA 4HE8A 3OYZA 1IBLT 2XQYA 5LXTE 2ODUA 2WDQA 2WBLA 5L3BB 2MTQA 1FEWA 3C51A 3UUXB 1OWAA 2KNDA 5LBMA 2LSJA 2I0MA 4B6XA 4UXNB 1KFYA 2HPLA 3RQUA 4X64T 5FMNA 2M6BA 4FI5A 5JQGE 5JRCB 4GIWA 3RYHE 1DU2A 3SFEA 3QB5K 2Y48B 5DQVA 4TNWA 3KV4A 1E7PA 4OFZA 2WWVA 2X68A 4LMJA 2JMKA 3ZC0A 4CN4A 3CQGB 2H88A 1KEYA 3ZC1A 5HEHA 5CA0E 4AI6A 5ABEA 2LOSA 2VURA 4QH1A 4HWIB 4U2ZA 3RF1A 3AE1A 1KK7A 2K48A 1MNEA 4X1IE 2BVLA 4JLEA 2YDSA 1WRDA 2NR4A 5L3GB 2K3WA 2IMLA 1JNZA 4ISSA 3N2GE 3ZMUB 1XMQT 4X1KE 2X9HA 2JQQA 2CXFA 4X62T 5ABFB 4IE5A 3ZMTB 3PU8A 3ZSTA 4TX5A 2HN1A 5LYJE 3AB3B 1XNRT 4DV0T 2LT3A 1BR1A 3ZPOA 1NEKA 2DNXA 3KV9A 4I55E 3H3MA 1ZP0A 2K24A 3PU3A 1IJ6A 4X65T 4OHFA 1N32T 4DV2T 3J7Yq 2V6YA 2CA5A 4JYAT 2H7VC 5H6QB 3RX6A 3TLTA 3TLSA 3UU5A 4OYKA 3HL6A 3RGLA 3P7IA 5LMUT 2H7OA 3QUJA 5GONE 5LA6E 3OPCA 3LK42 1OEDE 4ANJA 2R6GF 1T98A 2HN2A 2UUAT 4H9PC 3RIAA 4KHZF 2E8IA 4NUUA 4ISTA 2Y6XA 4CXYA 1W0BA 2VL0A 2ZM2A 3QOFA 2P9BA 3CX7B 3L09A 3ABVA 1UUSA 1CHUA 4WZXA 4O4HE 1M7KA 2A3DA 2UUBT 5AQIB 2XM1A 3SOLA 2OA5A 3NRXA 5L2LA 3AE9A 5LP6E 2ACXA 4AKLA 3K8PC 2CXDA 3C4ZA 3N2KE 2VWAA 3LBXA 1E1HB 3F57A 3RRCA 5EK3A 2KSRA 4F6RC 4LFAT 4DR3T 4WYVA 5BR8T 2K5BB 5LG3A 1KNRA 2LSYA 5HCJA 3AVRA 2L9QA 2BZBA 4JI1T 1N36T 4QX8B 5AQVB 1Y64B 5JDFA 3JCFA 3V5UA 2YINA 4HFHA 1W9RA 3AAIA 4P0AA 3RRWA 3SFDA 5L3EB 5AQSB 2KWIB 2W66A 5KDMC 3JAFA 2X51A 4IE0A 4H9NC 5FL0A 3UULA 4DR2T 3OKQA 2V6YB 5A1LA 3BQLA 1VRBA 4P09A 1UX4A 2FJBA 2QA7A 2EHOA 2N9DA 5M4YA 3ZT5A 5FXZA 2LKHA 3ZLIA 4YHJA 5J0ZA 5L4EA 1MMAA 2BBHA 4LF8T 2UXDT 5LBQB 3HA4A 4LF6T 1LKXA 3RLFF 4NPPA 5E0OA 4IDQA 1SA0E 1UX5A 3RPUA 1S35A 3ZKRA 5L47A 5L4HA 3ZT7A 3P4RA 3KBTA 2VK9A 4JV5T 4PFOA 4O4LE 2LRKA 1LVKA 4HTEA 3ONJA 4GK5E 3K3QC 4G63A 4UV9B 5J2UE 3AEBA 3NVOA 3N9QA 3AA7B 2E5LT 2JMHA 2C5IT 4AKGA 4ADZA 2X67A 5FY1A 4U7IA 4JI7T 1OXZA 2CLYB 3MKDA 5IHYA 4Z90A 5CFBA 2NOXA 2VQFT 2G0UA 4YSXA 2WQYA 1VCSA 4DR4T 4H63H 4DV6T 4O4JE 2UU9T 4DR5T 3IHRA 4L9IA 4LMLA 4JI0T 4U3CA 3LBXB 2LSIA 4ILUA 4L0RA 2CM0A 2MYSA 3EHZA 3PUVF 1T8BA 2ACZA 4AIUA 3NZPA 2FJEA 3AEEA 5FYMA 2KXPB 2DL1A 1HX8A 3GN5B 4TUYE 1XWMA 4DMWA 2EHOC 4H9OC 2W61A 1D1BA 4C90A 2V7JA 5FY0A 2H89A 4IL9A 4ZS2A 3WAKA 2JQHA 3PJAJ 4K0UA 1HNXT 2RPAA 4WBNE 3NZQA 1J1JA 1UK5A 1YD8G 4JI2T 3N9NA 4H63V 5LCYA 1BR2A 3I9YA 4X1YE 5FVKA 2W0GA 2YDQA 3AE2A 5AQTB 2NW9A 2EHOB 4QXBB 1YW0A 1HFAA 4YTNA 3OVUA 3RC3A 4CN6A 3Q5EA 2BG9E 1MIVA 3KVBA 3ZJ2A 4AKHA 3AEDA 2IAKA 5LJMA 5FXWA 2LEHA 3AE3A 3PURA 1N34T 3I9WA 2CRBA 5CB4E 5CJ5A 5TAOA 4ILCA 4U2YA 4U33A 1EZ3A 4IGUA 5JR9A 1V9DA 4AQGA 3PUZF 3VRBA 2OV9A 2XAFB 5LJNA 4EV6A 4DUZT 2KZ7B 4U31A 2BG9A 4QX7B 3P4QA 1LVFA 2BKOA 4BAYB 3UU4A 3O4XE 5EK2A 2Z6EA 2FBWA 4GK0E 3VRAA 1HNZT 5FY7A 3KFWX 4IHJE 3SWHA 5LB7B 3KVAA 3NRYA 1FMWA 4IREA 2NTXA 4PK6A 2E2AA 4B3MT 1D0YA 3OJAA 4CN1A 3UU3A 2HH7A 2Y8DA 3CMLA 4UVBB 4PJNA 1T7SA 1FJGT 2X66A 3NWIA 4OK0A 2MAWA 5C8YE 2CWOA 3AE8A 1ZKEA 5EZYE 3MZKB 5J1GA 4O8SA 3PUXF 3HKDE 1IBMT 3PJAA 2WU2A 4ZXLA 3UFGA 2CBIA 2XAGB 4LMKA 1XMOT 4UV8B 5IUXA 5C2TA 4KMCA 1U5PA 4JI5T 2PBIA 3AAAB 5JR9C 3DJBA 4IDOA 2VKJA 5JDNA 4PW8A 1FIOA 1MMGA 4U72A 5LNKA 5AQUB 5AQFB 2PJQA 2BG9C 4PK5A 5IYZE 4YSYA 1YQ4A 3KDSE 2PG8A 3ZCJA 4OX9T 4BJMA 4ILAA 3FXEB 5JR9B 2UXCT 4XAXB 3A5XA 3JC6C 4KBMB 3RYFE 4EAHA 2SPCA 4Q25A 2BG9B 3KBUA 3ZYLA 4TN7B 2FJAA 2H3RA 4A97A 4GKJT 4I43B 5AQKB 3VR8A 2IC6A 4XBFB 3CQXC 4PJJA 3LJCA 4AXPA 3UQ7A 2XZEA 2CEAA 2ZMAA 4HWFA 4DMVA 2YOEA 2X0LB 5AQLB 4C91A 3ZSSA 4IE7A 5IWAT 5HXEA 1B7TA 3S4UA 1W09A 2BDEA 3I0OA 5FXXA 4QXCB 2GK9A 1XDPA 2WZIA 3FBLA 4AQFA 5LGNB 2X9XA 3FXDB 2V5DA 4IL4A 1IAPA 4GKKT 2AXDS 3OTOT 4P0BA 5AQGB 2FUPA 4CXXA 3O1HA 3P4PA 2WB5A 3DTOA 3X1DA 4AKIA 2OLTA 5HXHA 2N1GA 2LHRA 1AJ3A 1Z0PA 2D5UA 2XUEA 3A7MA 2C5KT 3IF8B 3ONXA 3L3PA 4QH4A 5AQJB 3M65A 4ZZBA 3ZEFB 4WW0A 5AQPB 1KF6A 2YU2A 3C50A 4EYYR 4JI3T 5JDLA 4UIGA 2FJDA 4YLHA 3J9X1 4ZS3A 3PUGA 3T8OA 1CUNA 4JI6T 3AEGA 4IDZA 3N9MA 4JI8T 2V7MA 2WM9A 4COFA 5LGTB 4TZ4C 5LGUB 2AE9A 2D0UA 3TLUA 3EUHA 4EGWA 3VR9A 4AQFC 3OBVE 2IHR1 4QH5A 4DIDB 1NAFA 4MFRA 2KWHA 4NIQA 1Z8UA 4PJLA 3BQIA 2WCAA 4ZI3C 2DLRA 3T1YT 2N2NA 3PUYF 2DHRA 4EXTA 3P4WA 4XZCA 5LHHB 4O4IE 3O9XA 5JVDE 2NW7A 3CX8B 3RH3A 1VOMA 1T72A 5FP3A 1G8XA 3MA9A 4HWDA 4ILBA 4CZZB 3CQCB 2VASA 4EEDA 3EI0A 3Q5WA 3SRZA 3R6NA 4PJMA 4I50E 1HTJF 1N33T 4UF0A 3KINB 1X79A 4E7SA 2YK0A 4L5GA 4PAGA 3EDUA 3ZYMA 2XQAA 4QHOA 5JH7E 4ZOLE 4N78D 4O2BE 2CE7A 3JC6D 3AXJA 2CHNA 2PFVA 3PDYA 3K1SA 2I59A 4CQIA 2XPKA 3KV5A 4CI2B 5JTGA 2IW5B 4NXNT 3EVYA 2QVAA 2CWYA 4MLKA 5ADXL 3AE5A 4P1NA 4PK4A 5ABHA 4YT0A 2YEVC 3PTRB 2XHEB 2VQET 4F8HA 3RYIE 2XSAA 3W15B 2MBGA 2LRLA 3PUWF 1D1CA 3B5MA 1IJ5A 4TWDA 4DR6T 2JIWA 3MXZA 5H6RB 2X9WA 2J62A 5FVLA 2KMFA 3KV6A 2V6XA 1WYBA 3LFMA 3CKDA 2X0YA 3FZKB 4E7ZA 4Z91A 1G73A 3MK7C 2BBJA 4KHPT 2UXNB 2XQ8A 3IA3A 1KNZA 2M67A 3B57A 2YDRA 2ZM8A 2ES0A 2CCQA 5HWXA 4ZHQE 1WR0A 4G2AA 1XNQT 3LG7A 3ANWA 2UUCT 3HKBE 4EZ4A 5FKYA 2D0TA 4YTPA 1W0AA 4ZI7E 2I6HA 2L8KA 4AISA 1MIYA 3Q9DA 3BQKA 2D2SA 4AQYT 4UF0B 3PUQA 2WY2A 3ZN0B 3NKZA 5FL1A 2XM2A 4A56A 3TKLB 4NXMT 2LLYA 2KINB 2YKSA 1SHZC 4X20E 1MMDA 2BVMA 4GYSA 5ABGA 5AQRB 3AE4A 3QC9A 3UT5E 2HPJA 3ESLA 1ZOYA 4H9SE 3AEAA 5LG4A 1SUMB 3ZT6A 3AXJB 2XQ3A 1J5WA 1X9BA 3WAJA 4MBQA 3IEEA 2NW8A 4KUMB 3AVSA 4DV5T 2JRKA 3F31A 2LKGA 2CPTA 2E5VA 4LFBT 3N9OA 2DI4A 4ZI3D 4QXHB 4H9QC 3RI5A 4Z8XA 1U4QA 3ZMZB 2WSSV 3UUBA 4DR1T 1ZV4X 2WP9A 2WWUA 2ZM0A 3DP7A 3F2EA 4HN9A 3ETUA 4B3RT 5LHIB 2QYWA 2Q9QA 3ZMSB 5F8PA 4U74A 4MALA 4HFVA 5LMNT 2ZLYA 3NBXX 3AECA 5DJQC 1WFDA 2LHNA 2BS2A 3HI2A 5JDQA 2WU5A 5AQNB 1S94A 3ANWB 4PNIA 3FZHB 4QKNA 3CWZB 4UEMA 3C98B 2VKOA 3UUMA 2NWBA 3CVRA 1BR4A 1GQEA 1FMVA 5J2TE 2D9DA 4EEBA 3OYXA 4I4TE 3H3AA 2VKHA 5HEOA 3RIFA 2V1DB 4A5XA 4DV4T 2XJ7A 3B13A 1LRZA 5EK4A 3QB5A 4HFCA 4LF5T 2J1DG 1VCTA 4UELA 5LHGB
chains in the Genus database with same CATH topology
1UK5A 1HX1B 4HWDA 5AQKB 3FZLB 1M7KA 5AQQB 5AQHB 5AQGB 5AQSB 3FZKB 4HWHA 5AQIB 5AQTB 5AQOB 5AQMB 4HWIB 3FZFB 5AQNB 3A8YC 1UGOA 5AQJB 2D9DA 4HWFA 3FZHB 1T7SA 3M3ZB 1I6ZA 3FZMB 4HWCA 1M62A 5AQLB 5AQUB 5AQFB 5AQPB 3LDQB 5AQVB 5AQRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UK5 A;  1HX1 B;  4HWD A;  5AQK B;  3FZL B;  1M7K A;  5AQQ B;  5AQH B;  5AQG B;  5AQS B;  3FZK B;  4HWH A;  5AQI B;  5AQT B;  5AQO B;  5AQM B;  4HWI B;  3FZF B;  5AQN B;  3A8Y C;  1UGO A;  5AQJ B;  2D9D A;  4HWF A;  3FZH B;  1T7S A;  3M3Z B;  1I6Z A;  3FZM B;  4HWC A;  1M62 A;  5AQL B;  5AQU B;  5AQF B;  5AQP B;  3LDQ B;  5AQV B;  5AQR B; 
#chains in the Genus database with same CATH topology
 1JNR A;  3UU8 A;  5HXS A;  4JBW F;  4HFE A;  2JQK A;  2PTF A;  2Q9Q C;  5BMV E;  2E9X A;  4DBR A;  2KT9 A;  4HFB A;  1XZY A;  2LJL A;  4JI4 T;  4CXW A;  3UFE A;  2XAQ B;  2B1E A;  2XAJ B;  2M6I A;  2XTL A;  4I0U A;  1XDO A;  2Q9Q B;  3MJX A;  3PUA A;  5F3J A;  2EHO D;  4WBO A;  2WZH A;  4LFC T;  1MND A;  4DV7 T;  3LK2 B;  3O1I A;  4YY3 T;  1WYC A;  4JEH B;  2WDR A;  4PFP A;  4BJN A;  4X5T A;  3VU7 H;  4IT4 A;  5HWY A;  3C4W A;  1YKE B;  3ETV A;  2WAU A;  1ZHC A;  5ETW A;  3IBP A;  3WI3 A;  2XY8 B;  4YJ3 E;  3EAB A;  3AE7 A;  4GOU A;  4EIW A;  2LE8 A;  4DR7 T;  3E08 A;  5AQO B;  3Q2M A;  4ZZC A;  2A72 A;  3EDV A;  3AA0 B;  4TNV A;  4A98 A;  2A9U A;  3K3O A;  2WS3 A;  2NP9 A;  4EB6 E;  4LF9 T;  2XQ6 A;  3AA1 B;  2VB6 A;  2F4V T;  1BR0 A;  5FXV A;  3ONL C;  4DND A;  3AA6 B;  3P50 A;  3PUS A;  4UVA B;  3TLV A;  3N2O A;  3T1H T;  5LOV E;  2B76 A;  2E9X C;  2V8S V;  2LM2 A;  3HKC E;  4B3T T;  3I1A A;  3VKG A;  2J47 A;  3TLW A;  2CMR A;  5AQM B;  2WDV A;  2A2F X;  4KI0 F;  2J4G A;  5L3D B;  3ZYK A;  3O1J A;  3RQW A;  2X9Y A;  4LF7 T;  2C5J A;  2E9X B;  4JEU B;  1HF8 A;  4EZH A;  5AQQ B;  1L0V A;  3CX6 B;  4ZEY A;  1OED A;  2XQ9 A;  5HYA A;  3AE6 A;  3UQ4 A;  1IBK T;  3H37 A;  2XQ4 A;  5C3J A;  3RIU A;  1MIW A;  3C64 A;  1HS7 A;  5HAX A;  2V7I A;  4H9R C;  2IC9 A;  4YXD A;  5KXJ A;  4HEA A;  2NTY A;  1YKH B;  4K0K T;  2IUB A;  4EOZ B;  5KMG P;  3M3Z B;  4IIJ E;  2VVS A;  3GN5 A;  3HKE E;  3I0Q A;  1US7 B;  4BA9 A;  3L8R A;  3D0T A;  3RYC E;  2JQ9 A;  1WLX A;  2HHH T;  3FHN A;  2MOZ A;  4YSZ A;  2W4X A;  3ZJ1 A;  1QUU A;  4ERR A;  4HGA A;  3LDQ B;  2XQ7 A;  4ZI2 C;  3C4X A;  2JPF A;  4HKA A;  2XAS B;  2V5C A;  2QRX A;  3RC8 A;  3CK6 A;  1UUR A;  3RKG A;  2QGS A;  3QK6 A;  2X0H A;  2KLQ A;  3CPZ A;  5FNV E;  1QSD A;  4O2A E;  3L39 A;  1D0X A;  3FZM B;  3P4S A;  2VL8 A;  2DCF A;  4NUV A;  1HX1 B;  1O3X A;  3BK9 A;  1I94 T;  3JAE A;  1MMN A;  2CLY C;  3Q5X A;  1HCI A;  5F5W A;  4TV9 E;  2LSG A;  4KX6 A;  3GMI A;  3VKH A;  2XQ5 A;  2W63 A;  4J2C A;  3UU6 A;  2W00 A;  1OED C;  3N9P A;  2Q9Q D;  2L3L A;  2CHO A;  4ASK A;  1NEN A;  3FZL B;  3RIU C;  5AQH B;  1R8I A;  4HWH A;  4AKR B;  3E22 E;  3R84 B;  4YJ2 E;  2UXB T;  3FB2 A;  5L3F B;  4YHH T;  5DAB A;  1OED B;  2LSK A;  4CI1 B;  3JAD A;  4YTM A;  4TWH A;  1YQ3 A;  4LF4 T;  5JDG A;  1KNP A;  4TV8 E;  4HFD A;  4B3S T;  1E2A A;  4DBQ A;  2WMN A;  5HXC A;  3AEF A;  1I6Z A;  2VKD A;  2C0S A;  5DQW A;  1M62 A;  2CXL A;  5HXR A;  3P8C D;  1WR6 A;  3ZMV B;  1SE7 A;  1HR0 T;  1IZN B;  4UVC B;  2YU1 A;  1UCU A;  3U3I A;  1HNW T;  4DUY T;  4DO0 A;  1QLB A;  3UUN A;  4HWC A;  2RP4 A;  4IDP A;  1D0Z A;  3N5L A;  2BS4 A;  4IDN A;  2UXX B;  1WCR A;  2WMO A;  3EAM A;  5AFU L;  4JUY A;  1H7C A;  4M1P A;  2W67 A;  4YFS A;  1UGO A;  4WNK A;  2IIU A;  5KX5 E;  2BKN A;  1J5E T;  3RHW A;  3Q5D A;  2W2U A;  2E9X D;  3G06 A;  2DWG A;  2RA1 A;  5JRC A;  2BKP A;  4HFI A;  2W62 A;  2LM9 A;  4U7Y A;  2MPK A;  5L3C B;  2XAH B;  2V7L A;  2VVN A;  3FBZ A;  4GYR A;  4IE4 A;  4CI3 B;  4OYJ A;  3RKO A;  4X66 T;  5HCM A;  1NWM X;  2ODV A;  3HR0 A;  4IE6 A;  3GWH A;  3FZF B;  1D1A A;  3A8Y C;  5JDM A;  1HG2 A;  2JJ9 A;  1YXR A;  2CBJ A;  3PV0 F;  3ZCI A;  3GA8 A;  3CIR A;  3E0Z A;  4FJO A;  5JDH A;  2K9A A;  2V26 A;  3AAE B;  1HG5 A;  3U78 A;  3ZN1 B;  3UTK A;  4EYU A;  2V7K A;  4QWN B;  4DVD A;  3LK3 B;  3V5S A;  5CGM A;  2XSB A;  3N9L A;  4KP3 C;  4TWF A;  2BS3 A;  5HEJ A;  3PE0 A;  4MHC A;  5ABF A;  4DV3 T;  2DWK A;  4DV1 T;  5HEG A;  2ZM6 T;  3QNU A;  3SS1 A;  1ZEE A;  2LOP A;  3LSV A;  3MAC A;  2IDO B;  4ZI2 D;  4UR9 A;  2YN6 A;  5CA1 E;  3K3N A;  1Y01 A;  5JRE A;  3VHL A;  4V1A v;  5HEU A;  4HE8 A;  3OYZ A;  1IBL T;  2XQY A;  5LXT E;  2ODU A;  2WDQ A;  2WBL A;  5L3B B;  2MTQ A;  1FEW A;  3C51 A;  3UUX B;  1OWA A;  2KND A;  5LBM A;  2LSJ A;  2I0M A;  4B6X A;  4UXN B;  1KFY A;  2HPL A;  3RQU A;  4X64 T;  5FMN A;  2M6B A;  4FI5 A;  5JQG E;  5JRC B;  4GIW A;  3RYH E;  1DU2 A;  3SFE A;  3QB5 K;  2Y48 B;  5DQV A;  4TNW A;  3KV4 A;  1E7P A;  4OFZ A;  2WWV A;  2X68 A;  4LMJ A;  2JMK A;  3ZC0 A;  4CN4 A;  3CQG B;  2H88 A;  1KEY A;  3ZC1 A;  5HEH A;  5CA0 E;  4AI6 A;  5ABE A;  2LOS A;  2VUR A;  4QH1 A;  4HWI B;  4U2Z A;  3RF1 A;  3AE1 A;  1KK7 A;  2K48 A;  1MNE A;  4X1I E;  2BVL A;  4JLE A;  2YDS A;  1WRD A;  2NR4 A;  5L3G B;  2K3W A;  2IML A;  1JNZ A;  4ISS A;  3N2G E;  3ZMU B;  1XMQ T;  4X1K E;  2X9H A;  2JQQ A;  2CXF A;  4X62 T;  5ABF B;  4IE5 A;  3ZMT B;  3PU8 A;  3ZST A;  4TX5 A;  2HN1 A;  5LYJ E;  3AB3 B;  1XNR T;  4DV0 T;  2LT3 A;  1BR1 A;  3ZPO A;  1NEK A;  2DNX A;  3KV9 A;  4I55 E;  3H3M A;  1ZP0 A;  2K24 A;  3PU3 A;  1IJ6 A;  4X65 T;  4OHF A;  1N32 T;  4DV2 T;  3J7Y q;  2V6Y A;  2CA5 A;  4JYA T;  2H7V C;  5H6Q B;  3RX6 A;  3TLT A;  3TLS A;  3UU5 A;  4OYK A;  3HL6 A;  3RGL A;  3P7I A;  5LMU T;  2H7O A;  3QUJ A;  5GON E;  5LA6 E;  3OPC A;  3LK4 2;  1OED E;  4ANJ A;  2R6G F;  1T98 A;  2HN2 A;  2UUA T;  4H9P C;  3RIA A;  4KHZ F;  2E8I A;  4NUU A;  4IST A;  2Y6X A;  4CXY A;  1W0B A;  2VL0 A;  2ZM2 A;  3QOF A;  2P9B A;  3CX7 B;  3L09 A;  3ABV A;  1UUS A;  1CHU A;  4WZX A;  4O4H E;  1M7K A;  2A3D A;  2UUB T;  5AQI B;  2XM1 A;  3SOL A;  2OA5 A;  3NRX A;  5L2L A;  3AE9 A;  5LP6 E;  2ACX A;  4AKL A;  3K8P C;  2CXD A;  3C4Z A;  3N2K E;  2VWA A;  3LBX A;  1E1H B;  3F57 A;  3RRC A;  5EK3 A;  2KSR A;  4F6R C;  4LFA T;  4DR3 T;  4WYV A;  5BR8 T;  2K5B B;  5LG3 A;  1KNR A;  2LSY A;  5HCJ A;  3AVR A;  2L9Q A;  2BZB A;  4JI1 T;  1N36 T;  4QX8 B;  5AQV B;  1Y64 B;  5JDF A;  3JCF A;  3V5U A;  2YIN A;  4HFH A;  1W9R A;  3AAI A;  4P0A A;  3RRW A;  3SFD A;  5L3E B;  5AQS B;  2KWI B;  2W66 A;  5KDM C;  3JAF A;  2X51 A;  4IE0 A;  4H9N C;  5FL0 A;  3UUL A;  4DR2 T;  3OKQ A;  2V6Y B;  5A1L A;  3BQL A;  1VRB A;  4P09 A;  1UX4 A;  2FJB A;  2QA7 A;  2EHO A;  2N9D A;  5M4Y A;  3ZT5 A;  5FXZ A;  2LKH A;  3ZLI A;  4YHJ A;  5J0Z A;  5L4E A;  1MMA A;  2BBH A;  4LF8 T;  2UXD T;  5LBQ B;  3HA4 A;  4LF6 T;  1LKX A;  3RLF F;  4NPP A;  5E0O A;  4IDQ A;  1SA0 E;  1UX5 A;  3RPU A;  1S35 A;  3ZKR A;  5L47 A;  5L4H A;  3ZT7 A;  3P4R A;  3KBT A;  2VK9 A;  4JV5 T;  4PFO A;  4O4L E;  2LRK A;  1LVK A;  4HTE A;  3ONJ A;  4GK5 E;  3K3Q C;  4G63 A;  4UV9 B;  5J2U E;  3AEB A;  3NVO A;  3N9Q A;  3AA7 B;  2E5L T;  2JMH A;  2C5I T;  4AKG A;  4ADZ A;  2X67 A;  5FY1 A;  4U7I A;  4JI7 T;  1OXZ A;  2CLY B;  3MKD A;  5IHY A;  4Z90 A;  5CFB A;  2NOX A;  2VQF T;  2G0U A;  4YSX A;  2WQY A;  1VCS A;  4DR4 T;  4H63 H;  4DV6 T;  4O4J E;  2UU9 T;  4DR5 T;  3IHR A;  4L9I A;  4LML A;  4JI0 T;  4U3C A;  3LBX B;  2LSI A;  4ILU A;  4L0R A;  2CM0 A;  2MYS A;  3EHZ A;  3PUV F;  1T8B A;  2ACZ A;  4AIU A;  3NZP A;  2FJE A;  3AEE A;  5FYM A;  2KXP B;  2DL1 A;  1HX8 A;  3GN5 B;  4TUY E;  1XWM A;  4DMW A;  2EHO C;  4H9O C;  2W61 A;  1D1B A;  4C90 A;  2V7J A;  5FY0 A;  2H89 A;  4IL9 A;  4ZS2 A;  3WAK A;  2JQH A;  3PJA J;  4K0U A;  1HNX T;  2RPA A;  4WBN E;  3NZQ A;  1J1J A;  1UK5 A;  1YD8 G;  4JI2 T;  3N9N A;  4H63 V;  5LCY A;  1BR2 A;  3I9Y A;  4X1Y E;  5FVK A;  2W0G A;  2YDQ A;  3AE2 A;  5AQT B;  2NW9 A;  2EHO B;  4QXB B;  1YW0 A;  1HFA A;  4YTN A;  3OVU A;  3RC3 A;  4CN6 A;  3Q5E A;  2BG9 E;  1MIV A;  3KVB A;  3ZJ2 A;  4AKH A;  3AED A;  2IAK A;  5LJM A;  5FXW A;  2LEH A;  3AE3 A;  3PUR A;  1N34 T;  3I9W A;  2CRB A;  5CB4 E;  5CJ5 A;  5TAO A;  4ILC A;  4U2Y A;  4U33 A;  1EZ3 A;  4IGU A;  5JR9 A;  1V9D A;  4AQG A;  3PUZ F;  3VRB A;  2OV9 A;  2XAF B;  5LJN A;  4EV6 A;  4DUZ T;  2KZ7 B;  4U31 A;  2BG9 A;  4QX7 B;  3P4Q A;  1LVF A;  2BKO A;  4BAY B;  3UU4 A;  3O4X E;  5EK2 A;  2Z6E A;  2FBW A;  4GK0 E;  3VRA A;  1HNZ T;  5FY7 A;  3KFW X;  4IHJ E;  3SWH A;  5LB7 B;  3KVA A;  3NRY A;  1FMW A;  4IRE A;  2NTX A;  4PK6 A;  2E2A A;  4B3M T;  1D0Y A;  3OJA A;  4CN1 A;  3UU3 A;  2HH7 A;  2Y8D A;  3CML A;  4UVB B;  4PJN A;  1T7S A;  1FJG T;  2X66 A;  3NWI A;  4OK0 A;  2MAW A;  5C8Y E;  2CWO A;  3AE8 A;  1ZKE A;  5EZY E;  3MZK B;  5J1G A;  4O8S A;  3PUX F;  3HKD E;  1IBM T;  3PJA A;  2WU2 A;  4ZXL A;  3UFG A;  2CBI A;  2XAG B;  4LMK A;  1XMO T;  4UV8 B;  5IUX A;  5C2T A;  4KMC A;  1U5P A;  4JI5 T;  2PBI A;  3AAA B;  5JR9 C;  3DJB A;  4IDO A;  2VKJ A;  5JDN A;  4PW8 A;  1FIO A;  1MMG A;  4U72 A;  5LNK A;  5AQU B;  5AQF B;  2PJQ A;  2BG9 C;  4PK5 A;  5IYZ E;  4YSY A;  1YQ4 A;  3KDS E;  2PG8 A;  3ZCJ A;  4OX9 T;  4BJM A;  4ILA A;  3FXE B;  5JR9 B;  2UXC T;  4XAX B;  3A5X A;  3JC6 C;  4KBM B;  3RYF E;  4EAH A;  2SPC A;  4Q25 A;  2BG9 B;  3KBU A;  3ZYL A;  4TN7 B;  2FJA A;  2H3R A;  4A97 A;  4GKJ T;  4I43 B;  5AQK B;  3VR8 A;  2IC6 A;  4XBF B;  3CQX C;  4PJJ A;  3LJC A;  4AXP A;  3UQ7 A;  2XZE A;  2CEA A;  2ZMA A;  4HWF A;  4DMV A;  2YOE A;  2X0L B;  5AQL B;  4C91 A;  3ZSS A;  4IE7 A;  5IWA T;  5HXE A;  1B7T A;  3S4U A;  1W09 A;  2BDE A;  3I0O A;  5FXX A;  4QXC B;  2GK9 A;  1XDP A;  2WZI A;  3FBL A;  4AQF A;  5LGN B;  2X9X A;  3FXD B;  2V5D A;  4IL4 A;  1IAP A;  4GKK T;  2AXD S;  3OTO T;  4P0B A;  5AQG B;  2FUP A;  4CXX A;  3O1H A;  3P4P A;  2WB5 A;  3DTO A;  3X1D A;  4AKI A;  2OLT A;  5HXH A;  2N1G A;  2LHR A;  1AJ3 A;  1Z0P A;  2D5U A;  2XUE A;  3A7M A;  2C5K T;  3IF8 B;  3ONX A;  3L3P A;  4QH4 A;  5AQJ B;  3M65 A;  4ZZB A;  3ZEF B;  4WW0 A;  5AQP B;  1KF6 A;  2YU2 A;  3C50 A;  4EYY R;  4JI3 T;  5JDL A;  4UIG A;  2FJD A;  4YLH A;  3J9X 1;  4ZS3 A;  3PUG A;  3T8O A;  1CUN A;  4JI6 T;  3AEG A;  4IDZ A;  3N9M A;  4JI8 T;  2V7M A;  2WM9 A;  4COF A;  5LGT B;  4TZ4 C;  5LGU B;  2AE9 A;  2D0U A;  3TLU A;  3EUH A;  4EGW A;  3VR9 A;  4AQF C;  3OBV E;  2IHR 1;  4QH5 A;  4DID B;  1NAF A;  4MFR A;  2KWH A;  4NIQ A;  1Z8U A;  4PJL A;  3BQI A;  2WCA A;  4ZI3 C;  2DLR A;  3T1Y T;  2N2N A;  3PUY F;  2DHR A;  4EXT A;  3P4W A;  4XZC A;  5LHH B;  4O4I E;  3O9X A;  5JVD E;  2NW7 A;  3CX8 B;  3RH3 A;  1VOM A;  1T72 A;  5FP3 A;  1G8X A;  3MA9 A;  4HWD A;  4ILB A;  4CZZ B;  3CQC B;  2VAS A;  4EED A;  3EI0 A;  3Q5W A;  3SRZ A;  3R6N A;  4PJM A;  4I50 E;  1HTJ F;  1N33 T;  4UF0 A;  3KIN B;  1X79 A;  4E7S A;  2YK0 A;  4L5G A;  4PAG A;  3EDU A;  3ZYM A;  2XQA A;  4QHO A;  5JH7 E;  4ZOL E;  4N78 D;  4O2B E;  2CE7 A;  3JC6 D;  3AXJ A;  2CHN A;  2PFV A;  3PDY A;  3K1S A;  2I59 A;  4CQI A;  2XPK A;  3KV5 A;  4CI2 B;  5JTG A;  2IW5 B;  4NXN T;  3EVY A;  2QVA A;  2CWY A;  4MLK A;  5ADX L;  3AE5 A;  4P1N A;  4PK4 A;  5ABH A;  4YT0 A;  2YEV C;  3PTR B;  2XHE B;  2VQE T;  4F8H A;  3RYI E;  2XSA A;  3W15 B;  2MBG A;  2LRL A;  3PUW F;  1D1C A;  3B5M A;  1IJ5 A;  4TWD A;  4DR6 T;  2JIW A;  3MXZ A;  5H6R B;  2X9W A;  2J62 A;  5FVL A;  2KMF A;  3KV6 A;  2V6X A;  1WYB A;  3LFM A;  3CKD A;  2X0Y A;  3FZK B;  4E7Z A;  4Z91 A;  1G73 A;  3MK7 C;  2BBJ A;  4KHP T;  2UXN B;  2XQ8 A;  3IA3 A;  1KNZ A;  2M67 A;  3B57 A;  2YDR A;  2ZM8 A;  2ES0 A;  2CCQ A;  5HWX A;  4ZHQ E;  1WR0 A;  4G2A A;  1XNQ T;  3LG7 A;  3ANW A;  2UUC T;  3HKB E;  4EZ4 A;  5FKY A;  2D0T A;  4YTP A;  1W0A A;  4ZI7 E;  2I6H A;  2L8K A;  4AIS A;  1MIY A;  3Q9D A;  3BQK A;  2D2S A;  4AQY T;  4UF0 B;  3PUQ A;  2WY2 A;  3ZN0 B;  3NKZ A;  5FL1 A;  2XM2 A;  4A56 A;  3TKL B;  4NXM T;  2LLY A;  2KIN B;  2YKS A;  1SHZ C;  4X20 E;  1MMD A;  2BVM A;  4GYS A;  5ABG A;  5AQR B;  3AE4 A;  3QC9 A;  3UT5 E;  2HPJ A;  3ESL A;  1ZOY A;  4H9S E;  3AEA A;  5LG4 A;  1SUM B;  3ZT6 A;  3AXJ B;  2XQ3 A;  1J5W A;  1X9B A;  3WAJ A;  4MBQ A;  3IEE A;  2NW8 A;  4KUM B;  3AVS A;  4DV5 T;  2JRK A;  3F31 A;  2LKG A;  2CPT A;  2E5V A;  4LFB T;  3N9O A;  2DI4 A;  4ZI3 D;  4QXH B;  4H9Q C;  3RI5 A;  4Z8X A;  1U4Q A;  3ZMZ B;  2WSS V;  3UUB A;  4DR1 T;  1ZV4 X;  2WP9 A;  2WWU A;  2ZM0 A;  3DP7 A;  3F2E A;  4HN9 A;  3ETU A;  4B3R T;  5LHI B;  2QYW A;  2Q9Q A;  3ZMS B;  5F8P A;  4U74 A;  4MAL A;  4HFV A;  5LMN T;  2ZLY A;  3NBX X;  3AEC A;  5DJQ C;  1WFD A;  2LHN A;  2BS2 A;  3HI2 A;  5JDQ A;  2WU5 A;  5AQN B;  1S94 A;  3ANW B;  4PNI A;  3FZH B;  4QKN A;  3CWZ B;  4UEM A;  3C98 B;  2VKO A;  3UUM A;  2NWB A;  3CVR A;  1BR4 A;  1GQE A;  1FMV A;  5J2T E;  2D9D A;  4EEB A;  3OYX A;  4I4T E;  3H3A A;  2VKH A;  5HEO A;  3RIF A;  2V1D B;  4A5X A;  4DV4 T;  2XJ7 A;  3B13 A;  1LRZ A;  5EK4 A;  3QB5 A;  4HFC A;  4LF5 T;  2J1D G;  1VCT A;  4UEL A;  5LHG B; 
#chains in the Genus database with same CATH homology
 1UK5 A;  1HX1 B;  4HWD A;  5AQK B;  3FZL B;  1M7K A;  5AQQ B;  5AQH B;  5AQG B;  5AQS B;  3FZK B;  4HWH A;  5AQI B;  5AQT B;  5AQO B;  5AQM B;  4HWI B;  3FZF B;  5AQN B;  3A8Y C;  1UGO A;  5AQJ B;  2D9D A;  4HWF A;  3FZH B;  1T7S A;  3M3Z B;  1I6Z A;  3FZM B;  4HWC A;  1M62 A;  5AQL B;  5AQU B;  5AQF B;  5AQP B;  3LDQ B;  5AQV B;  5AQR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...