3FZLB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 48
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzlB00
3FZLB 3M3ZB 3FZFB 5AQVB 1I6ZA 4HWDA 3FZHB 1HX1B 4HWHA 5AQTB 5AQUB 5AQKB 1UGOA 4HWIB 5AQGB 1M7KA 5AQJB 5AQQB 1T7SA 3FZKB 1UK5A 5AQMB 4HWFA 5AQOB 3LDQB 5AQHB 5AQSB 5AQIB 1M62A 2D9DA 3A8YC 3FZMB 4HWCA 5AQLB 5AQPB 5AQNB 5AQRB 5AQFB
chains in the Genus database with same CATH superfamily
3IBPA 2BG9C 2ODVA 3ZSSA 4DV1T 3LFMA 1GQEA 3DP7A 1KNZA 2FBWA 4JI6T 3KBUA 2JQ9A 4F6RC 2V7JA 5H6QB 4I50E 3PUXF 3ZC0A 2CWOA 3QUJA 1SE7A 2PFVA 1HNWT 2LHRA 4BJMA 4DV7T 2YINA 2DWGA 2YDRA 3N9LA 5CB4E 4B3MT 1AJ3A 1YQ3A 3RHWA 2MBGA 2A3DA 1U5PA 3A5XA 3ANWB 3IHRA 3Q9DA 4DBQA 3LK42 3OTOT 2NWBA 3PUZF 3UU4A 4O4JE 4P09A 3FB2A 1NWMX 3O1JA 5BMVE 3BK9A 3JAEA 2VVNA 5L3FB 5LYJE 2BVLA 2WP9A 1UK5A 3AAAB 2W2UA 4NUUA 5HEUA 1NENA 5A1LA 4IE4A 2B1EA 2XM2A 2OA5A 3NBXX 2VKJA 2XQAA 3E08A 3KV9A 2I6HA 4HGAA 4O8SA 5AQRB 4Z90A 4JI5T 4YXDA 4YTPA 3SWHA 1LRZA 2L3LA 3CX6B 2OV9A 2QA7A 2WZIA 2HPJA 2ZM8A 4ILUA 4JI4T 4WZXA 4BAYB 1IBKT 4AKGA 4QWNB 1OEDA 1U4QA 4X62T 4UV8B 1NEKA 4JI0T 2XQ6A 1CUNA 3TLTA 1QSDA 2V1DB 5FL0A 2WMOA 3JC6D 3UUMA 3RYIE 2W63A 4DBRA 2LSKA 3U78A 4L0RA 5HCMA 1WYBA 4IT4A 3VRAA 4CXXA 3MKDA 4LFAT 2WB5A 5HWYA 3WAKA 3LSVA 4U33A 3RGLA 3RYFE 5AQQB 2LE8A 2BS4A 1MMAA 5HXCA 2YDQA 2V6YA 3F57A 5CA0E 2XSAA 5FVKA 2XQYA 1FIOA 3ZMSB 2LHNA 3EVYA 3FXEB 4U31A 2E9XA 1XZYA 5HXRA 1IZNB 2F4VT 2KT9A 2JMHA 4HFCA 5CA1E 2H89A 2BKNA 2MOZA 3SFEA 2KWIB 2JQKA 4L5GA 2V7MA 1VCTA 3OBVE 5AQTB 5H6RB 1D0XA 5L4HA 2W4XA 5CJ5A 5ADXL 4DR1T 1SUMB 2X0LB 3UFGA 2WSSV 1IJ6A 3B57A 3P4RA 4BA9A 5JRCA 4DMVA 4QH5A 1D0ZA 4MBQA 3ZJ2A 4AISA 3AE6A 3TLWA 4DUYT 1CHUA 3T1HT 1OEDE 2QVAA 2HN2A 5JRCB 1MMGA 3TLSA 5ABEA 2WZHA 3ETVA 4TX5A 4TV9E 1VRBA 2V7IA 2E8IA 3S4UA 5EK3A 1HFAA 2UUAT 4AKIA 5GONE 5IHYA 3C64A 2Q9QB 4YY3T 3G06A 1MNDA 4MLKA 5L2LA 1M62A 1OWAA 2D9DA 3CPZA 2KZ7B 4QXBB 4DV0T 1OEDC 3CIRA 4E7SA 3ZMTB 2KLQA 1UX4A 2VKDA 3AE5A 4KX6A 4OX9T 4XZCA 1NAFA 2W67A 3O1IA 5JR9B 3UUBA 3TLVA 3ZCJA 4GKJT 2HH7A 2XAHB 1FMWA 1BR1A 4HWHA 2BVMA 3PUVF 5FXVA 5ABGA 2IW5B 4LF4T 4NXMT 4PAGA 1XNRT 4JV5T 3ZT7A 2BG9B 5CGMA 3P4WA 5LG4A 2YK0A 5IYZE 5JQGE 2CHOA 2K24A 5J0ZA 2BS2A 2RP4A 3ABVA 3H37A 3ZKRA 4UR9A 3CKDA 3JAFA 2X51A 4NUVA 3RQWA 4CXYA 3Q2MA 2DL1A 2C0SA 2LKGA 4DR5T 1D1CA 2BG9E 3PUWF 4ZOLE 4HFEA 1WYCA 3C4XA 4JI3T 5AQMB 1KNPA 5LGUB 4EIWA 3ZYMA 5HWXA 4EB6E 3MACA 3EDUA 4P0AA 1IBMT 4I55E 4IDQA 3NWIA 5AQNB 5HEGA 3UT5E 4IE5A 4DV4T 4JI2T 3H3AA 4JLEA 1ZKEA 2CXFA 2E2AA 2X67A 5JDFA 2ZM2A 4ZI2D 5LJNA 3UQ4A 5E0OA 1FJGT 3C4WA 4HWIB 2UXCT 4V1Av 4CN1A 2EHOC 2A9UA 2E9XD 3KVAA 3PURA 3QB5K 2XSBA 4PNIA 2XJ7A 2AXDS 4CN6A 2LLYA 3O4XE 3PV0F 5BR8T 2XAGB 4Z8XA 4O2AE 4ZS3A 5HXSA 2NTXA 3P50A 3DJBA 3I9YA 1J5ET 2Z6EA 1G73A 2OLTA 3MXZA 4CXWA 2RPAA 4AQGA 4I43B 4HFHA 4U7IA 4DO0A 4CI1B 3CK6A 2WWUA 4HKAA 3PUAA 5AQIB 5JDNA 1US7B 2CM0A 2BKOA 2VURA 2ZM0A 3AEDA 1LVFA 3ETUA 3MJXA 2WDVA 4G63A 4HFDA 4UVAB 3TKLB 2BS3A 3AA1B 1KNRA 1T98A 1J5WA 3FXDB 3EAMA 3HKCE 4IE0A 4LMKA 2VVSA 2ACZA 1HG5A 1UCUA 2E9XC 2XZEA 3UQ7A 4G2AA 3Q5XA 5HAXA 1HF8A 4DR4T 3AE4A 3H3MA 3P4QA 3PUYF 4CI3B 5L4EA 4DV3T 4P1NA 2X0HA 4ZZCA 4DR3T 4LFBT 3RC3A 4EYUA 2DI4A 3U3IA 4DR7T 2IMLA 3CX8B 4AQFC 2UU9T 3KBTA 4CQIA 1MIWA 2IUBA 1HS7A 1W0BA 1WRDA 3BQKA 5L3CB 4LF7T 3C98B 3PU8A 2FUPA 3I0QA 5ABFB 2V26A 4HEAA 3KV5A 3PTRB 4WYVA 2JJ9A 5FMNA 2VKOA 5FY1A 3JC6C 1ZOYA 3A8YC 4WBNE 3VKGA 3SS1A 5AQSB 3KFWX 1XDOA 2C5IT 3LG7A 3MK7C 4ZS2A 1B7TA 3GA8A 3F31A 5LGNB 4KHPT 1D1AA 3RKGA 3RIAA 3FZFB 3IA3A 3NRYA 3PE0A 3P4PA 5HXHA 4DR6T 4GKKT 4H9QC 5ABHA 2LSYA 3P7IA 2ZLYA 2JPFA 4AXPA 2XTLA 3NVOA 5HCJA 3ZYKA 1H7CA 3AE2A 2PTFA 4X5TA 2UUBT 5LHHB 3AAIA 1MIVA 1Z0PA 1JNRA 1M7KA 3HI2A 3NZQA 4HFIA 4I0UA 2ODUA 4GK0E 3M65A 2XAQB 5LHGB 2WQYA 3LJCA 1G8XA 3EABA 2CXDA 5HYAA 1IJ5A 3A7MA 3CMLA 3QC9A 2J1DG 4XAXB 3SOLA 1FMVA 2BDEA 3LDQB 2KMFA 3AEGA 3AXJA 4GIWA 5AQHB 5FXZA 2AE9A 2K5BB 4AKHA 3PJAJ 1OEDB 2NW7A 2KNDA 3CX7B 2WCAA 3OYZA 1HCIA 4KUMB 5AQFB 2JIWA 4LF9T 2CPTA 5L3GB 4DV2T 2LEHA 3HR0A 4U7YA 2E5VA 3T8OA 3OVUA 4HWDA 4ERRA 2R6GF 3I1AA 4U74A 2JQHA 5L3DB 1KK7A 4UELA 1IAPA 2XQ8A 1UGOA 5AQKB 2FJBA 4A97A 3MA9A 2K9AA 2WAUA 4YJ3E 3P4SA 5DQWA 3V5UA 5AFUL 2VL0A 1X79A 5EZYE 5LBQB 4AQYT 2YDSA 1SA0E 4LMLA 2VB6A 2IDOB 2LSGA 1D0YA 1WFDA 3UULA 3K1SA 3ZC1A 1YKEB 2J4GA 3ESLA 3N9OA 5LG3A 1Y64B 4DV6T 4GK5E 1DU2A 1T7SA 1UURA 4IHJE 3KV4A 3ZSTA 4X64T 5DJQC 2J47A 3Q5EA 1HG2A 5FVLA 2YOEA 4TV8E 4H63H 2W61A 3RX6A 2CLYC 2EHOD 1W9RA 3O9XA 3JCFA 3RQUA 4O4IE 3N2GE 5JDQA 4UIGA 4DUZT 2XASB 4HN9A 1MNEA 4TZ4C 1UX5A 4C91A 5FY0A 5F5WA 4Q25A 2H88A 3SFDA 2LOPA 3AEBA 3I9WA 3W15B 3VR9A 4J2CA 2MAWA 5LOVE 4YSYA 4H9RC 1W09A 2B76A 2LM9A 3QB5A 1XWMA 1I94T 2NR4A 2YKSA 4TWDA 2UXDT 2DCFA 3DTOA 1YXRA 4IDOA 5JDGA 2XUEA 5FYMA 5JTGA 3UUNA 4X66T 4U2ZA 1WLXA 4UF0B 1WCRA 2WU5A 4ISSA 4YTNA 2CLYB 2D2SA 3E22E 4YTMA 2WDQA 3L8RA 3ZT6A 4HWFA 4ZI2C 5KDMC 1E1HB 1FEWA 2K3WA 2VKHA 5JVDE 5LP6E 4U2YA 4UEMA 2I59A 3FZMB 5HEHA 3RPUA 4A98A 4H9SE 1KEYA 1JNZA 2YU1A 5DABA 4Z91A 1LKXA 3EUHA 3VKHA 4QXCB 2W66A 3ZMZB 4QX7B 2HPLA 3FHNA 5EK2A 4JI1T 3N9MA 4AKLA 4O2BE 1HNZT 1HX1B 5FNVE 3GN5A 2Y48B 3NRXA 4HTEA 3D0TA 4YJ2E 4ZI3C 3RC8A 1N36T 3UFEA 2XAJB 3B13A 2IAKA 4MFRA 5JDLA 4H9PC 1HTJF 4UVCB 1N32T 4YSZA 4IGUA 3RF1A 4IE6A 2SPCA 2BBHA 2N2NA 4PK5A 1UUSA 3N9QA 2DWKA 2FJEA 3KDSE 5JDMA 2A72A 2LM2A 4EXTA 3T1YT 2V5CA 3CWZB 3RLFF 5L3EB 2LSIA 5C8YE 5LNKA 2PG8A 4U72A 4WW0A 3N5LA 4EEDA 5CFBA 1J1JA 3M3ZB 2Y8DA 2H7OA 4P0BA 4DVDA 5JR9C 5LGTB 5EK4A 4C90A 4B6XA 4NXNT 4X1YE 4PJJA 4JI8T 2W00A 1YQ4A 2LOSA 2YU2A 2HN1A 2XQ4A 3ONLC 4JEUB 4PK4A 4TN7B 2WM9A 5AQGB 3OPCA 3R84B 3RIUC 4EAHA 5ABFA 2G0UA 2EHOB 3B5MA 3C50A 3NKZA 4BJNA 3ZJ1A 4OHFA 1QLBA 2V8SV 2WS3A 1R8IA 3OJAA 3PU3A 1ZHCA 4H9OC 3VR8A 3L09A 3ZLIA 2HHHT 1XDPA 4MHCA 2IC6A 4ADZA 4B3ST 1EZ3A 2LRLA 3FBZA 2X9XA 2WWVA 4E7ZA 2VQET 2X66A 4EGWA 2KWHA 3ZN0B 5DQVA 2CA5A 3AB3B 1HNXT 4UV9B 1OXZA 2QRXA 4X20E 2CXLA 3VU7H 3F2EA 4UVBB 2X9HA 3C4ZA 4PW8A 1ZV4X 4QHOA 3FZLB 4PK6A 5F3JA 2A2FX 4L9IA 2CRBA 5LJMA 2LT3A 2VK9A 4ZXLA 5KX5E 2FJAA 2IC9A 2KXPB 3FZHB 2Y6XA 1BR2A 3ZT5A 3RH3A 4PFOA 4PJLA 5ETWA 4U3CA 3EHZA 4OK0A 1KF6A 2X9YA 3AE1A 3UU8A 5L47A 3V5SA 1Y01A 2QGSA 4QKNA 4IL4A 4FJOA 2JMKA 5FXWA 2XY8B 2CBJA 2XQ3A 2C5KT 4JEHB 3UU6A 2CEAA 3PUGA 4EEBA 2LRKA 2E5LT 1ZP0A 3UU3A 4LF8T 3K3OA 4IDPA 2WMNA 2VQFT 1XNQT 2I0MA 3AAEB 4F8HA 2DLRA 2WU2A 3J7Yq 3BQIA 2ACXA 1WR6A 2X9WA 3CQXC 3LBXB 2UXNB 4FI5A 4N78D 4NPPA 4QH4A 4DR2T 1MIYA 4X1IE 3ZPOA 2M6BA 2PBIA 2P9BA 2C5JA 2W62A 2CWYA 3AE3A 3C51A 5C3JA 4LF6T 3VRBA 3LBXA 2QYWA 5AQVB 3RRWA 5J2UE 5M4YA 2DHRA 4A56A 3AA0B 1HR0T 3IF8B 3EI0A 2H7VC 1LVKA 3OYXA 2KINB 3PUQA 4ANJA 5KXJA 4JYAT 4KBMB 4GYRA 5FKYA 4CI2B 3UUXB 4GYSA 1T72A 2XPKA 3WAJA 4AKRB 4AQFA 2WBLA 2X0YA 3ANWA 3K3NA 4H63V 4WBOA 2ZMAA 3ZYLA 2XQ5A 3K8PC 3ZCIA 5F8PA 1YD8G 3PJAA 4ASKA 1S35A 4YHHT 4JI7T 2MTQA 2K48A 2N1GA 1QUUA 2D0TA 1D1BA 2BBJA 4ILCA 2CCQA 2IHR1 2Q9QC 2RA1A 5JH7E 2CMRA 2MPKA 1L0VA 5LMNT 3VHLA 5LB7B 2JRKA 3MZKB 5LMUT 5JDHA 5IUXA 3RYHE 4O4HE 2KSRA 2D5UA 2VWAA 5L3BB 1XMQT 4ZEYA 2CE7A 2LSJA 5LBMA 2BG9A 2CBIA 4PJMA 3PDYA 4ILBA 3AA7B 1Z8UA 3BQLA 3JADA 4HE8A 3RIFA 2V6XA 1BR4A 3UTKA 4COFA 3Q5WA 5JR9A 4TWHA 4H9NC 3AE9A 4IDZA 1X9BA 4IE7A 5HEJA 4ZI7E 2YN6A 4M1PA 2V7KA 2XQ9A 3KVBA 3HKBE 4HFVA 4KP3C 4TWFA 2IIUA 2V5DA 3HL6A 1V9DA 4YSXA 2WDRA 3N2OA 5JREA 2XHEB 3AEEA 2PJQA 4O4LE 2VL8A 5TAOA 4KMCA 2FJDA 1T8BA 4NIQA 2JQQA 3N9NA 2NW8A 2V7LA 3QNUA 2J62A 4YT0A 2BZBA 4B3TT 4LFCT 1BR0A 5HEOA 5LHIB 4DNDA 2MYSA 2CHNA 4LF5T 4IREA 3UU5A 4K0KT 2M6IA 4DMWA 5AQPB 2W0GA 3AE7A 3L3PA 4PJNA 4TUYE 3RI5A 3TLUA 2NP9A 3FBLA 3PUSA 3HKEE 2NOXA 5IWAT 2ZM6T 3AECA 4I4TE 1MMDA 3GWHA 4HFBA 2X68A 5FL1A 4QH1A 4TNWA 3AVSA 4ZZBA 5HXEA 2L9QA 2WY2A 2V6YB 3AE8A 4QXHB 5AQUB 5J2TE 4XBFB 3R6NA 1S94A 3AEAA 3EDVA 1WR0A 3ONJA 2Q9QD 4IL9A 1E2AA 1ZEEA 4ISTA 3K3QC 4QX8B 5AQJB 3CVRA 3ZMVB 5LXTE 3N9PA 4X65T 2Q9QA 1N33T 3AXJB 2M67A 5FP3A 3X1DA 2YEVC 3HKDE 1VOMA 4TNVA 3IEEA 3O1HA 4EOZB 2NW9A 1SHZC 4DIDB 4B3RT 4GOUA 4JBWF 2VASA 3FZKB 3KINB 3RIUA 3WI3A 1VCSA 5AQOB 4MALA 3Q5DA 2GK9A 3E0ZA 3ONXA 1HX8A 5FXXA 3J9X1 3SRZA 2BKPA 5LCYA 4HWCA 1KFYA 3OKQA 4WNKA 2EHOA 2E9XB 3GMIA 4AIUA 5KMGP 2UUCT 3QOFA 4YHJA 4A5XA 3AVRA 4AI6A 4CN4A 4OYJA 2LKHA 4EZHA 1I6ZA 3GN5B 2UXXB 4PFPA 5FY7A 1YKHB 1XMOT 3ZMUB 3CQCB 4ILAA 4OYKA 4UXNB 3CQGB 2ES0A 1YW0A 4JUYA 4UF0A 4CZZB 2L8KA 4X1KE 4KI0F 4YLHA 3L39A 3RYCE 3HA4A 2LJLA 1MMNA 3LK2B 4YFSA 3AA6B 4KHZF 1E7PA 2XAFB 3I0OA 4OFZA 3RKOA 2UXBT 3AEFA 4LMJA 1W0AA 2H3RA 4EYYR 2XQ7A 2XM1A 2DNXA 5LA6E 3KV6A 3QK6A 4EV6A 4ZI3D 2N9DA 3P8CD 5C2TA 3N2KE 1IBLT 1N34T 4IIJE 2D0UA 4K0UA 5AQLB 4IDNA 3RRCA 3ZN1B 4EZ4A 1O3XA 3NZPA 3ZEFB 4ZHQE 5J1GA 3LK3B 4DV5T 2NTYA
chains in the Genus database with same CATH topology
3FZLB 3M3ZB 3FZFB 5AQVB 1I6ZA 4HWDA 3FZHB 1HX1B 4HWHA 5AQTB 5AQUB 5AQKB 1UGOA 4HWIB 5AQGB 1M7KA 5AQJB 5AQQB 1T7SA 3FZKB 1UK5A 5AQMB 4HWFA 5AQOB 3LDQB 5AQHB 5AQSB 5AQIB 1M62A 2D9DA 3A8YC 3FZMB 4HWCA 5AQLB 5AQPB 5AQNB 5AQRB 5AQFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZL B;  3M3Z B;  3FZF B;  5AQV B;  1I6Z A;  4HWD A;  3FZH B;  1HX1 B;  4HWH A;  5AQT B;  5AQU B;  5AQK B;  1UGO A;  4HWI B;  5AQG B;  1M7K A;  5AQJ B;  5AQQ B;  1T7S A;  3FZK B;  1UK5 A;  5AQM B;  4HWF A;  5AQO B;  3LDQ B;  5AQH B;  5AQS B;  5AQI B;  1M62 A;  2D9D A;  3A8Y C;  3FZM B;  4HWC A;  5AQL B;  5AQP B;  5AQN B;  5AQR B;  5AQF B; 
#chains in the Genus database with same CATH topology
 3IBP A;  2BG9 C;  2ODV A;  3ZSS A;  4DV1 T;  3LFM A;  1GQE A;  3DP7 A;  1KNZ A;  2FBW A;  4JI6 T;  3KBU A;  2JQ9 A;  4F6R C;  2V7J A;  5H6Q B;  4I50 E;  3PUX F;  3ZC0 A;  2CWO A;  3QUJ A;  1SE7 A;  2PFV A;  1HNW T;  2LHR A;  4BJM A;  4DV7 T;  2YIN A;  2DWG A;  2YDR A;  3N9L A;  5CB4 E;  4B3M T;  1AJ3 A;  1YQ3 A;  3RHW A;  2MBG A;  2A3D A;  1U5P A;  3A5X A;  3ANW B;  3IHR A;  3Q9D A;  4DBQ A;  3LK4 2;  3OTO T;  2NWB A;  3PUZ F;  3UU4 A;  4O4J E;  4P09 A;  3FB2 A;  1NWM X;  3O1J A;  5BMV E;  3BK9 A;  3JAE A;  2VVN A;  5L3F B;  5LYJ E;  2BVL A;  2WP9 A;  1UK5 A;  3AAA B;  2W2U A;  4NUU A;  5HEU A;  1NEN A;  5A1L A;  4IE4 A;  2B1E A;  2XM2 A;  2OA5 A;  3NBX X;  2VKJ A;  2XQA A;  3E08 A;  3KV9 A;  2I6H A;  4HGA A;  4O8S A;  5AQR B;  4Z90 A;  4JI5 T;  4YXD A;  4YTP A;  3SWH A;  1LRZ A;  2L3L A;  3CX6 B;  2OV9 A;  2QA7 A;  2WZI A;  2HPJ A;  2ZM8 A;  4ILU A;  4JI4 T;  4WZX A;  4BAY B;  1IBK T;  4AKG A;  4QWN B;  1OED A;  1U4Q A;  4X62 T;  4UV8 B;  1NEK A;  4JI0 T;  2XQ6 A;  1CUN A;  3TLT A;  1QSD A;  2V1D B;  5FL0 A;  2WMO A;  3JC6 D;  3UUM A;  3RYI E;  2W63 A;  4DBR A;  2LSK A;  3U78 A;  4L0R A;  5HCM A;  1WYB A;  4IT4 A;  3VRA A;  4CXX A;  3MKD A;  4LFA T;  2WB5 A;  5HWY A;  3WAK A;  3LSV A;  4U33 A;  3RGL A;  3RYF E;  5AQQ B;  2LE8 A;  2BS4 A;  1MMA A;  5HXC A;  2YDQ A;  2V6Y A;  3F57 A;  5CA0 E;  2XSA A;  5FVK A;  2XQY A;  1FIO A;  3ZMS B;  2LHN A;  3EVY A;  3FXE B;  4U31 A;  2E9X A;  1XZY A;  5HXR A;  1IZN B;  2F4V T;  2KT9 A;  2JMH A;  4HFC A;  5CA1 E;  2H89 A;  2BKN A;  2MOZ A;  3SFE A;  2KWI B;  2JQK A;  4L5G A;  2V7M A;  1VCT A;  3OBV E;  5AQT B;  5H6R B;  1D0X A;  5L4H A;  2W4X A;  5CJ5 A;  5ADX L;  4DR1 T;  1SUM B;  2X0L B;  3UFG A;  2WSS V;  1IJ6 A;  3B57 A;  3P4R A;  4BA9 A;  5JRC A;  4DMV A;  4QH5 A;  1D0Z A;  4MBQ A;  3ZJ2 A;  4AIS A;  3AE6 A;  3TLW A;  4DUY T;  1CHU A;  3T1H T;  1OED E;  2QVA A;  2HN2 A;  5JRC B;  1MMG A;  3TLS A;  5ABE A;  2WZH A;  3ETV A;  4TX5 A;  4TV9 E;  1VRB A;  2V7I A;  2E8I A;  3S4U A;  5EK3 A;  1HFA A;  2UUA T;  4AKI A;  5GON E;  5IHY A;  3C64 A;  2Q9Q B;  4YY3 T;  3G06 A;  1MND A;  4MLK A;  5L2L A;  1M62 A;  1OWA A;  2D9D A;  3CPZ A;  2KZ7 B;  4QXB B;  4DV0 T;  1OED C;  3CIR A;  4E7S A;  3ZMT B;  2KLQ A;  1UX4 A;  2VKD A;  3AE5 A;  4KX6 A;  4OX9 T;  4XZC A;  1NAF A;  2W67 A;  3O1I A;  5JR9 B;  3UUB A;  3TLV A;  3ZCJ A;  4GKJ T;  2HH7 A;  2XAH B;  1FMW A;  1BR1 A;  4HWH A;  2BVM A;  3PUV F;  5FXV A;  5ABG A;  2IW5 B;  4LF4 T;  4NXM T;  4PAG A;  1XNR T;  4JV5 T;  3ZT7 A;  2BG9 B;  5CGM A;  3P4W A;  5LG4 A;  2YK0 A;  5IYZ E;  5JQG E;  2CHO A;  2K24 A;  5J0Z A;  2BS2 A;  2RP4 A;  3ABV A;  3H37 A;  3ZKR A;  4UR9 A;  3CKD A;  3JAF A;  2X51 A;  4NUV A;  3RQW A;  4CXY A;  3Q2M A;  2DL1 A;  2C0S A;  2LKG A;  4DR5 T;  1D1C A;  2BG9 E;  3PUW F;  4ZOL E;  4HFE A;  1WYC A;  3C4X A;  4JI3 T;  5AQM B;  1KNP A;  5LGU B;  4EIW A;  3ZYM A;  5HWX A;  4EB6 E;  3MAC A;  3EDU A;  4P0A A;  1IBM T;  4I55 E;  4IDQ A;  3NWI A;  5AQN B;  5HEG A;  3UT5 E;  4IE5 A;  4DV4 T;  4JI2 T;  3H3A A;  4JLE A;  1ZKE A;  2CXF A;  2E2A A;  2X67 A;  5JDF A;  2ZM2 A;  4ZI2 D;  5LJN A;  3UQ4 A;  5E0O A;  1FJG T;  3C4W A;  4HWI B;  2UXC T;  4V1A v;  4CN1 A;  2EHO C;  2A9U A;  2E9X D;  3KVA A;  3PUR A;  3QB5 K;  2XSB A;  4PNI A;  2XJ7 A;  2AXD S;  4CN6 A;  2LLY A;  3O4X E;  3PV0 F;  5BR8 T;  2XAG B;  4Z8X A;  4O2A E;  4ZS3 A;  5HXS A;  2NTX A;  3P50 A;  3DJB A;  3I9Y A;  1J5E T;  2Z6E A;  1G73 A;  2OLT A;  3MXZ A;  4CXW A;  2RPA A;  4AQG A;  4I43 B;  4HFH A;  4U7I A;  4DO0 A;  4CI1 B;  3CK6 A;  2WWU A;  4HKA A;  3PUA A;  5AQI B;  5JDN A;  1US7 B;  2CM0 A;  2BKO A;  2VUR A;  2ZM0 A;  3AED A;  1LVF A;  3ETU A;  3MJX A;  2WDV A;  4G63 A;  4HFD A;  4UVA B;  3TKL B;  2BS3 A;  3AA1 B;  1KNR A;  1T98 A;  1J5W A;  3FXD B;  3EAM A;  3HKC E;  4IE0 A;  4LMK A;  2VVS A;  2ACZ A;  1HG5 A;  1UCU A;  2E9X C;  2XZE A;  3UQ7 A;  4G2A A;  3Q5X A;  5HAX A;  1HF8 A;  4DR4 T;  3AE4 A;  3H3M A;  3P4Q A;  3PUY F;  4CI3 B;  5L4E A;  4DV3 T;  4P1N A;  2X0H A;  4ZZC A;  4DR3 T;  4LFB T;  3RC3 A;  4EYU A;  2DI4 A;  3U3I A;  4DR7 T;  2IML A;  3CX8 B;  4AQF C;  2UU9 T;  3KBT A;  4CQI A;  1MIW A;  2IUB A;  1HS7 A;  1W0B A;  1WRD A;  3BQK A;  5L3C B;  4LF7 T;  3C98 B;  3PU8 A;  2FUP A;  3I0Q A;  5ABF B;  2V26 A;  4HEA A;  3KV5 A;  3PTR B;  4WYV A;  2JJ9 A;  5FMN A;  2VKO A;  5FY1 A;  3JC6 C;  1ZOY A;  3A8Y C;  4WBN E;  3VKG A;  3SS1 A;  5AQS B;  3KFW X;  1XDO A;  2C5I T;  3LG7 A;  3MK7 C;  4ZS2 A;  1B7T A;  3GA8 A;  3F31 A;  5LGN B;  4KHP T;  1D1A A;  3RKG A;  3RIA A;  3FZF B;  3IA3 A;  3NRY A;  3PE0 A;  3P4P A;  5HXH A;  4DR6 T;  4GKK T;  4H9Q C;  5ABH A;  2LSY A;  3P7I A;  2ZLY A;  2JPF A;  4AXP A;  2XTL A;  3NVO A;  5HCJ A;  3ZYK A;  1H7C A;  3AE2 A;  2PTF A;  4X5T A;  2UUB T;  5LHH B;  3AAI A;  1MIV A;  1Z0P A;  1JNR A;  1M7K A;  3HI2 A;  3NZQ A;  4HFI A;  4I0U A;  2ODU A;  4GK0 E;  3M65 A;  2XAQ B;  5LHG B;  2WQY A;  3LJC A;  1G8X A;  3EAB A;  2CXD A;  5HYA A;  1IJ5 A;  3A7M A;  3CML A;  3QC9 A;  2J1D G;  4XAX B;  3SOL A;  1FMV A;  2BDE A;  3LDQ B;  2KMF A;  3AEG A;  3AXJ A;  4GIW A;  5AQH B;  5FXZ A;  2AE9 A;  2K5B B;  4AKH A;  3PJA J;  1OED B;  2NW7 A;  2KND A;  3CX7 B;  2WCA A;  3OYZ A;  1HCI A;  4KUM B;  5AQF B;  2JIW A;  4LF9 T;  2CPT A;  5L3G B;  4DV2 T;  2LEH A;  3HR0 A;  4U7Y A;  2E5V A;  3T8O A;  3OVU A;  4HWD A;  4ERR A;  2R6G F;  3I1A A;  4U74 A;  2JQH A;  5L3D B;  1KK7 A;  4UEL A;  1IAP A;  2XQ8 A;  1UGO A;  5AQK B;  2FJB A;  4A97 A;  3MA9 A;  2K9A A;  2WAU A;  4YJ3 E;  3P4S A;  5DQW A;  3V5U A;  5AFU L;  2VL0 A;  1X79 A;  5EZY E;  5LBQ B;  4AQY T;  2YDS A;  1SA0 E;  4LML A;  2VB6 A;  2IDO B;  2LSG A;  1D0Y A;  1WFD A;  3UUL A;  3K1S A;  3ZC1 A;  1YKE B;  2J4G A;  3ESL A;  3N9O A;  5LG3 A;  1Y64 B;  4DV6 T;  4GK5 E;  1DU2 A;  1T7S A;  1UUR A;  4IHJ E;  3KV4 A;  3ZST A;  4X64 T;  5DJQ C;  2J47 A;  3Q5E A;  1HG2 A;  5FVL A;  2YOE A;  4TV8 E;  4H63 H;  2W61 A;  3RX6 A;  2CLY C;  2EHO D;  1W9R A;  3O9X A;  3JCF A;  3RQU A;  4O4I E;  3N2G E;  5JDQ A;  4UIG A;  4DUZ T;  2XAS B;  4HN9 A;  1MNE A;  4TZ4 C;  1UX5 A;  4C91 A;  5FY0 A;  5F5W A;  4Q25 A;  2H88 A;  3SFD A;  2LOP A;  3AEB A;  3I9W A;  3W15 B;  3VR9 A;  4J2C A;  2MAW A;  5LOV E;  4YSY A;  4H9R C;  1W09 A;  2B76 A;  2LM9 A;  3QB5 A;  1XWM A;  1I94 T;  2NR4 A;  2YKS A;  4TWD A;  2UXD T;  2DCF A;  3DTO A;  1YXR A;  4IDO A;  5JDG A;  2XUE A;  5FYM A;  5JTG A;  3UUN A;  4X66 T;  4U2Z A;  1WLX A;  4UF0 B;  1WCR A;  2WU5 A;  4ISS A;  4YTN A;  2CLY B;  2D2S A;  3E22 E;  4YTM A;  2WDQ A;  3L8R A;  3ZT6 A;  4HWF A;  4ZI2 C;  5KDM C;  1E1H B;  1FEW A;  2K3W A;  2VKH A;  5JVD E;  5LP6 E;  4U2Y A;  4UEM A;  2I59 A;  3FZM B;  5HEH A;  3RPU A;  4A98 A;  4H9S E;  1KEY A;  1JNZ A;  2YU1 A;  5DAB A;  4Z91 A;  1LKX A;  3EUH A;  3VKH A;  4QXC B;  2W66 A;  3ZMZ B;  4QX7 B;  2HPL A;  3FHN A;  5EK2 A;  4JI1 T;  3N9M A;  4AKL A;  4O2B E;  1HNZ T;  1HX1 B;  5FNV E;  3GN5 A;  2Y48 B;  3NRX A;  4HTE A;  3D0T A;  4YJ2 E;  4ZI3 C;  3RC8 A;  1N36 T;  3UFE A;  2XAJ B;  3B13 A;  2IAK A;  4MFR A;  5JDL A;  4H9P C;  1HTJ F;  4UVC B;  1N32 T;  4YSZ A;  4IGU A;  3RF1 A;  4IE6 A;  2SPC A;  2BBH A;  2N2N A;  4PK5 A;  1UUS A;  3N9Q A;  2DWK A;  2FJE A;  3KDS E;  5JDM A;  2A72 A;  2LM2 A;  4EXT A;  3T1Y T;  2V5C A;  3CWZ B;  3RLF F;  5L3E B;  2LSI A;  5C8Y E;  5LNK A;  2PG8 A;  4U72 A;  4WW0 A;  3N5L A;  4EED A;  5CFB A;  1J1J A;  3M3Z B;  2Y8D A;  2H7O A;  4P0B A;  4DVD A;  5JR9 C;  5LGT B;  5EK4 A;  4C90 A;  4B6X A;  4NXN T;  4X1Y E;  4PJJ A;  4JI8 T;  2W00 A;  1YQ4 A;  2LOS A;  2YU2 A;  2HN1 A;  2XQ4 A;  3ONL C;  4JEU B;  4PK4 A;  4TN7 B;  2WM9 A;  5AQG B;  3OPC A;  3R84 B;  3RIU C;  4EAH A;  5ABF A;  2G0U A;  2EHO B;  3B5M A;  3C50 A;  3NKZ A;  4BJN A;  3ZJ1 A;  4OHF A;  1QLB A;  2V8S V;  2WS3 A;  1R8I A;  3OJA A;  3PU3 A;  1ZHC A;  4H9O C;  3VR8 A;  3L09 A;  3ZLI A;  2HHH T;  1XDP A;  4MHC A;  2IC6 A;  4ADZ A;  4B3S T;  1EZ3 A;  2LRL A;  3FBZ A;  2X9X A;  2WWV A;  4E7Z A;  2VQE T;  2X66 A;  4EGW A;  2KWH A;  3ZN0 B;  5DQV A;  2CA5 A;  3AB3 B;  1HNX T;  4UV9 B;  1OXZ A;  2QRX A;  4X20 E;  2CXL A;  3VU7 H;  3F2E A;  4UVB B;  2X9H A;  3C4Z A;  4PW8 A;  1ZV4 X;  4QHO A;  3FZL B;  4PK6 A;  5F3J A;  2A2F X;  4L9I A;  2CRB A;  5LJM A;  2LT3 A;  2VK9 A;  4ZXL A;  5KX5 E;  2FJA A;  2IC9 A;  2KXP B;  3FZH B;  2Y6X A;  1BR2 A;  3ZT5 A;  3RH3 A;  4PFO A;  4PJL A;  5ETW A;  4U3C A;  3EHZ A;  4OK0 A;  1KF6 A;  2X9Y A;  3AE1 A;  3UU8 A;  5L47 A;  3V5S A;  1Y01 A;  2QGS A;  4QKN A;  4IL4 A;  4FJO A;  2JMK A;  5FXW A;  2XY8 B;  2CBJ A;  2XQ3 A;  2C5K T;  4JEH B;  3UU6 A;  2CEA A;  3PUG A;  4EEB A;  2LRK A;  2E5L T;  1ZP0 A;  3UU3 A;  4LF8 T;  3K3O A;  4IDP A;  2WMN A;  2VQF T;  1XNQ T;  2I0M A;  3AAE B;  4F8H A;  2DLR A;  2WU2 A;  3J7Y q;  3BQI A;  2ACX A;  1WR6 A;  2X9W A;  3CQX C;  3LBX B;  2UXN B;  4FI5 A;  4N78 D;  4NPP A;  4QH4 A;  4DR2 T;  1MIY A;  4X1I E;  3ZPO A;  2M6B A;  2PBI A;  2P9B A;  2C5J A;  2W62 A;  2CWY A;  3AE3 A;  3C51 A;  5C3J A;  4LF6 T;  3VRB A;  3LBX A;  2QYW A;  5AQV B;  3RRW A;  5J2U E;  5M4Y A;  2DHR A;  4A56 A;  3AA0 B;  1HR0 T;  3IF8 B;  3EI0 A;  2H7V C;  1LVK A;  3OYX A;  2KIN B;  3PUQ A;  4ANJ A;  5KXJ A;  4JYA T;  4KBM B;  4GYR A;  5FKY A;  4CI2 B;  3UUX B;  4GYS A;  1T72 A;  2XPK A;  3WAJ A;  4AKR B;  4AQF A;  2WBL A;  2X0Y A;  3ANW A;  3K3N A;  4H63 V;  4WBO A;  2ZMA A;  3ZYL A;  2XQ5 A;  3K8P C;  3ZCI A;  5F8P A;  1YD8 G;  3PJA A;  4ASK A;  1S35 A;  4YHH T;  4JI7 T;  2MTQ A;  2K48 A;  2N1G A;  1QUU A;  2D0T A;  1D1B A;  2BBJ A;  4ILC A;  2CCQ A;  2IHR 1;  2Q9Q C;  2RA1 A;  5JH7 E;  2CMR A;  2MPK A;  1L0V A;  5LMN T;  3VHL A;  5LB7 B;  2JRK A;  3MZK B;  5LMU T;  5JDH A;  5IUX A;  3RYH E;  4O4H E;  2KSR A;  2D5U A;  2VWA A;  5L3B B;  1XMQ T;  4ZEY A;  2CE7 A;  2LSJ A;  5LBM A;  2BG9 A;  2CBI A;  4PJM A;  3PDY A;  4ILB A;  3AA7 B;  1Z8U A;  3BQL A;  3JAD A;  4HE8 A;  3RIF A;  2V6X A;  1BR4 A;  3UTK A;  4COF A;  3Q5W A;  5JR9 A;  4TWH A;  4H9N C;  3AE9 A;  4IDZ A;  1X9B A;  4IE7 A;  5HEJ A;  4ZI7 E;  2YN6 A;  4M1P A;  2V7K A;  2XQ9 A;  3KVB A;  3HKB E;  4HFV A;  4KP3 C;  4TWF A;  2IIU A;  2V5D A;  3HL6 A;  1V9D A;  4YSX A;  2WDR A;  3N2O A;  5JRE A;  2XHE B;  3AEE A;  2PJQ A;  4O4L E;  2VL8 A;  5TAO A;  4KMC A;  2FJD A;  1T8B A;  4NIQ A;  2JQQ A;  3N9N A;  2NW8 A;  2V7L A;  3QNU A;  2J62 A;  4YT0 A;  2BZB A;  4B3T T;  4LFC T;  1BR0 A;  5HEO A;  5LHI B;  4DND A;  2MYS A;  2CHN A;  4LF5 T;  4IRE A;  3UU5 A;  4K0K T;  2M6I A;  4DMW A;  5AQP B;  2W0G A;  3AE7 A;  3L3P A;  4PJN A;  4TUY E;  3RI5 A;  3TLU A;  2NP9 A;  3FBL A;  3PUS A;  3HKE E;  2NOX A;  5IWA T;  2ZM6 T;  3AEC A;  4I4T E;  1MMD A;  3GWH A;  4HFB A;  2X68 A;  5FL1 A;  4QH1 A;  4TNW A;  3AVS A;  4ZZB A;  5HXE A;  2L9Q A;  2WY2 A;  2V6Y B;  3AE8 A;  4QXH B;  5AQU B;  5J2T E;  4XBF B;  3R6N A;  1S94 A;  3AEA A;  3EDV A;  1WR0 A;  3ONJ A;  2Q9Q D;  4IL9 A;  1E2A A;  1ZEE A;  4IST A;  3K3Q C;  4QX8 B;  5AQJ B;  3CVR A;  3ZMV B;  5LXT E;  3N9P A;  4X65 T;  2Q9Q A;  1N33 T;  3AXJ B;  2M67 A;  5FP3 A;  3X1D A;  2YEV C;  3HKD E;  1VOM A;  4TNV A;  3IEE A;  3O1H A;  4EOZ B;  2NW9 A;  1SHZ C;  4DID B;  4B3R T;  4GOU A;  4JBW F;  2VAS A;  3FZK B;  3KIN B;  3RIU A;  3WI3 A;  1VCS A;  5AQO B;  4MAL A;  3Q5D A;  2GK9 A;  3E0Z A;  3ONX A;  1HX8 A;  5FXX A;  3J9X 1;  3SRZ A;  2BKP A;  5LCY A;  4HWC A;  1KFY A;  3OKQ A;  4WNK A;  2EHO A;  2E9X B;  3GMI A;  4AIU A;  5KMG P;  2UUC T;  3QOF A;  4YHJ A;  4A5X A;  3AVR A;  4AI6 A;  4CN4 A;  4OYJ A;  2LKH A;  4EZH A;  1I6Z A;  3GN5 B;  2UXX B;  4PFP A;  5FY7 A;  1YKH B;  1XMO T;  3ZMU B;  3CQC B;  4ILA A;  4OYK A;  4UXN B;  3CQG B;  2ES0 A;  1YW0 A;  4JUY A;  4UF0 A;  4CZZ B;  2L8K A;  4X1K E;  4KI0 F;  4YLH A;  3L39 A;  3RYC E;  3HA4 A;  2LJL A;  1MMN A;  3LK2 B;  4YFS A;  3AA6 B;  4KHZ F;  1E7P A;  2XAF B;  3I0O A;  4OFZ A;  3RKO A;  2UXB T;  3AEF A;  4LMJ A;  1W0A A;  2H3R A;  4EYY R;  2XQ7 A;  2XM1 A;  2DNX A;  5LA6 E;  3KV6 A;  3QK6 A;  4EV6 A;  4ZI3 D;  2N9D A;  3P8C D;  5C2T A;  3N2K E;  1IBL T;  1N34 T;  4IIJ E;  2D0U A;  4K0U A;  5AQL B;  4IDN A;  3RRC A;  3ZN1 B;  4EZ4 A;  1O3X A;  3NZP A;  3ZEF B;  4ZHQ E;  5J1G A;  3LK3 B;  4DV5 T;  2NTY A; 
#chains in the Genus database with same CATH homology
 3FZL B;  3M3Z B;  3FZF B;  5AQV B;  1I6Z A;  4HWD A;  3FZH B;  1HX1 B;  4HWH A;  5AQT B;  5AQU B;  5AQK B;  1UGO A;  4HWI B;  5AQG B;  1M7K A;  5AQJ B;  5AQQ B;  1T7S A;  3FZK B;  1UK5 A;  5AQM B;  4HWF A;  5AQO B;  3LDQ B;  5AQH B;  5AQS B;  5AQI B;  1M62 A;  2D9D A;  3A8Y C;  3FZM B;  4HWC A;  5AQL B;  5AQP B;  5AQN B;  5AQR B;  5AQF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...