3FZLB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 48
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzlB00
3FZHB 5AQNB 4HWCA 4HWDA 1M7KA 5AQVB 1I6ZA 3FZFB 5AQSB 5AQHB 3M3ZB 5AQIB 5AQFB 5AQRB 1UGOA 5AQUB 4HWHA 5AQQB 5AQMB 1UK5A 5AQLB 5AQJB 4HWFA 1M62A 1HX1B 4HWIB 2D9DA 5AQGB 3FZLB 5AQOB 3A8YC 5AQTB 3LDQB 3FZMB 3FZKB 5AQPB 5AQKB 1T7SA
chains in the Genus database with same CATH superfamily
3AA7B 3F2EA 4HFVA 4AXPA 2A2FX 2KWIB 2XQ5A 2XUEA 2YU1A 3ZYKA 4AQFC 2CLYC 4ZEYA 2UXCT 1FMWA 2RP4A 2KLQA 3PUVF 2VKJA 3FBLA 4UV9B 2Q9QB 5HWYA 2W61A 2LOSA 4HGAA 3SFEA 1J1JA 4TX5A 1W09A 3ZT5A 3IEEA 4EOZB 5LMUT 4DNDA 2PG8A 3RYCE 4QXCB 4QXHB 2ODVA 5LBQB 1DU2A 2WQYA 1UX4A 2E9XC 1OEDE 3CMLA 3P4RA 3RYIE 1FMVA 2H7VC 4PFPA 1OWAA 2BBHA 2NTXA 3RIUA 1LVFA 3ZKRA 4DR3T 4G63A 5J1GA 4YJ2E 4TNWA 3NRXA 4DR7T 3JC6C 4HWIB 2CA5A 3FZLB 3A8YC 3N2OA 3UQ4A 3VR8A 1N32T 3AE4A 2VKHA 3FHNA 4HFEA 4DV5T 4CN1A 3UULA 1LVKA 3AE1A 3Q5XA 3AB3B 3B13A 3O1IA 4KHZF 4MLKA 5AQKB 3VRBA 4AI6A 1JNZA 5AQNB 2XTLA 3CPZA 3ZLIA 5FXVA 5TAOA 3ZMZB 4EEDA 1HNWT 4F6RC 3N9PA 3UFEA 4E7ZA 1EZ3A 3AE3A 5LHGB 3UTKA 3C4XA 3FXEB 3T1YT 3C4WA 4X1KE 3T8OA 2DWKA 4FI5A 2SPCA 3I9WA 2W62A 4HFHA 3ZMSB 4YTPA 5KDMC 4YLHA 2LHNA 5L4HA 3AEEA 3Q5EA 5AQUB 2LOPA 2A72A 2VKOA 5L3EB 4ZZBA 4X62T 2XZEA 1KF6A 2FJBA 1QLBA 5F8PA 4YHJA 3AA1B 1QSDA 2XAJB 2AXDS 4PJLA 2CM0A 1SUMB 2D9DA 3GA8A 3O4XE 1VCTA 2LLYA 3ZJ1A 4DV4T 2IUBA 3AEBA 4HFIA 4EAHA 3I0QA 4AKIA 1YKHB 2R6GF 1VRBA 5CB4E 3QB5K 5A1LA 4NUUA 4ERRA 2XSAA 5HEJA 2FUPA 4HEAA 4CXYA 3TLUA 4JI5T 1MIWA 2WDVA 3EDVA 3ZC0A 2XAQB 4GKKT 2K9AA 5JRCA 4UEMA 2LE8A 2YDQA 3ABVA 3SRZA 2HN1A 2C5IT 5JRCB 3K3NA 4ZI2C 3EI0A 1HS7A 1VCSA 2VK9A 3KV9A 1UUSA 2LHRA 3K1SA 3CK6A 2FJEA 4IL4A 2QVAA 3L8RA 3Q5DA 3ZYMA 4AIUA 4ZI3D 2XQ8A 4LF8T 2MOZA 5JDLA 5HXRA 3AE9A 4X65T 4DUZT 1HNZT 2QRXA 2BKOA 5AQMB 1IBLT 4K0KT 2HN2A 2I59A 4UV8B 4KBMB 4LMLA 4PJJA 5JDFA 2XASB 2JMHA 3ONLC 4H63V 4F8HA 2E5LT 4QX7B 4ANJA 3D0TA 2QYWA 1GQEA 4E7SA 3KBTA 2B76A 2I0MA 2N9DA 2V7LA 3H3MA 4EZ4A 4AKLA 2LT3A 1XNRT 4JI2T 2WWVA 2UUBT 1N34T 3LJCA 5CA1E 1BR2A 3AVRA 1MNDA 2WS3A 2E8IA 2X51A 3RI5A 2Q9QD 3NRYA 2N1GA 4HKAA 2KT9A 4MBQA 4UR9A 2CXLA 1MMAA 4ILAA 4PK6A 5EZYE 3UUXB 4ZHQE 4DV0T 2EHOC 2BVMA 1N33T 1B7TA 1BR4A 1MIYA 2XQYA 4COFA 3O9XA 1KNRA 2ZMAA 4BA9A 5HXEA 2WDQA 2H7OA 2IC9A 1YW0A 2DNXA 2WAUA 4ZOLE 5FP3A 1UURA 2W66A 5L3DB 3DP7A 5L3GB 2CMRA 3AE8A 3PV0F 2MBGA 3ZMUB 2J1DG 3ZEFB 4A98A 3P4SA 4WNKA 1X9BA 4JI0T 2CCQA 4DV1T 1E1HB 4GIWA 1WR6A 3SS1A 4IHJE 5LGUB 2ZLYA 4QWNB 2LSYA 1U5PA 4B6XA 4ZI2D 5L47A 2CXDA 2VKDA 2JIWA 3SFDA 3A5XA 2CLYB 4GKJT 3RKGA 2HHHT 2UUAT 4P09A 2WU5A 3RQWA 4X64T 3OPCA 5ABGA 4X20E 4LFCT 2RPAA 1IZNB 3PUYF 3LK2B 5FY7A 4DMVA 2M6BA 5HXHA 4JI6T 2HPLA 2XPKA 4QH4A 4DR5T 1OXZA 2CBJA 5AQRB 3ONJA 2LSGA 3N9OA 3U3IA 4GK0E 1HX8A 2K5BB 2XY8B 5IHYA 2K48A 5LYJE 4IDOA 5HEHA 3PUSA 4DR1T 4GYSA 3AA0B 2EHOD 2PBIA 4UXNB 4G2AA 4DO0A 3QNUA 1FIOA 2MPKA 2V26A 3AAAB 4NXMT 4CI1B 5AQOB 3ZT7A 4DBQA 2J62A 5HCMA 4EYUA 4LF4T 5KMGP 3AA6B 2UUCT 3P4PA 3CQGB 2AE9A 2NW8A 3HI2A 3N2GE 4N78D 1X79A 4H63H 3UFGA 4YXDA 2BG9B 3EAMA 3RRCA 2BG9A 3P50A 4DV3T 1D1BA 3GN5A 2D0UA 2HPJA 3FZHB 4ZS3A 2CPTA 3GN5B 2LKHA 2J47A 3OYXA 4UF0A 5ABEA 5LJMA 4AQYT 2V5CA 2V5DA 4HN9A 4XBFB 1I6ZA 1SE7A 2PFVA 1G73A 2NTYA 1XWMA 1YQ4A 2W67A 1AJ3A 4TN7B 3E08A 3ZT6A 2KWHA 2H88A 3RQUA 5J0ZA 2IAKA 5EK3A 5GONE 2BS4A 5C8YE 4YY3T 2PJQA 1S35A 3WAKA 1MMGA 3UQ7A 4IDZA 5FKYA 3HKDE 4HWHA 1T8BA 3CKDA 3JC6D 3N9LA 1W0BA 2LSKA 4Z8XA 4EV6A 3PE0A 5BMVE 3O1HA 4EB6E 3P4QA 3VKGA 1OEDC 2DL1A 1HCIA 2V8SV 4IE5A 2D2SA 5CGMA 3NZQA 1MNEA 2X9HA 2WCAA 3FB2A 5IUXA 1XDPA 4QX8B 1MMNA 2NOXA 4EIWA 4LF5T 5LMNT 3FZKB 1CUNA 1V9DA 2WMNA 2WZIA 2WY2A 3CWZB 4TWDA 4OK0A 4XAXB 4O8SA 1IJ5A 3SOLA 3U78A 4KHPT 1XMOT 1XMQT 2Y48B 2CE7A 4IGUA 4GOUA 2XM1A 2DLRA 4ILBA 5JDNA 1IAPA 5LNKA 1S94A 4TNVA 5L4EA 2DI4A 3QC9A 2VASA 2CWOA 4IIJE 4QKNA 5FVLA 3UUBA 4BJMA 3UU4A 1WCRA 2PTFA 4KUMB 2B1EA 2H89A 5AQQB 4HE8A 1T98A 1US7B 2XM2A 4PW8A 2XQ9A 4PK4A 2WSSV 5AQGB 2XSBA 2DCFA 3H3AA 4NXNT 3RYFE 2ZM6T 3C98B 2IC6A 2P9BA 1ZEEA 3JADA 3KINB 4U3CA 4DUYT 5AQPB 3PUQA 5KXJA 2Y6XA 3AE2A 4DV2T 3JCFA 4IDNA 1LRZA 3EVYA 3IF8B 4UIGA 2RA1A 4WW0A 4HWDA 4WYVA 5HYAA 2C5JA 3T1HT 4B3RT 3I9YA 4JI3T 4AKHA 4LMKA 2LRKA 4WBNE 1T72A 3S4UA 5LJNA 5IYZE 1I94T 5AQIB 4HTEA 4ILUA 2VB6A 2E2AA 1UX5A 5JDGA 3CVRA 5JQGE 4DR2T 5H6RB 3IBPA 2M6IA 5JREA 4U33A 4IE6A 4B3ST 5DABA 4EYYR 4TV9E 3GMIA 3KV6A 1HF8A 2WZHA 1HX1B 5LCYA 5FNVE 2JQHA 1W9RA 2VL8A 3NZPA 4BJNA 3GWHA 5CA0E 3MKDA 5DQVA 5L3CB 3ZN0B 3AE6A 1KNPA 2LSIA 2BKPA 2BKNA 4JI8T 2XHEB 4IL9A 2J4GA 3KFWX 4PJNA 4JYAT 4EZHA 4I4TE 1E7PA 4KP3C 4IT4A 3TLWA 2M67A 2LSJA 4H9QC 4MHCA 3PU3A 1VOMA 1YD8G 3HKCE 1J5WA 3UU8A 5FL0A 2VQFT 4DR4T 4NIQA 3CX7B 3PURA 4PAGA 2JMKA 2YDRA 4JI4T 4TWFA 2YN6A 4LFBT 5LHIB 4O4HE 2VL0A 2WDRA 3RYHE 3PU8A 5ABHA 2GK9A 4I43B 2D0TA 5LOVE 5LBMA 4DIDB 4EXTA 3Q5WA 3V5SA 3N9QA 3OYZA 4DMWA 1Y01A 2JPFA 2OLTA 3LG7A 2ZM0A 3BQLA 3CIRA 3I1AA 4AISA 2WMOA 1ZP0A 5FL1A 1UCUA 1XNQT 2A9UA 4IE0A 4H9PC 1IBMT 4UF0B 4QXBB 3ZYLA 4YJ3E 2V6YA 4H9OC 4OYJA 5FY0A 3P7IA 5HEOA 5JR9B 2V6YB 4L5GA 3L3PA 4JI7T 2LRLA 3C64A 4H9RC 5HWXA 1HNXT 4GK5E 3ZN1B 2DWGA 3A7MA 1HG2A 4NPPA 2X9WA 2X0YA 3OJAA 4Z91A 3RIAA 2CEAA 3RRWA 2NW9A 4A97A 4LF7T 4LF9T 1OEDA 2FJAA 3P8CD 3KV4A 1NWMX 2UXNB 4LFAT 1H7CA 4B3MT 3ANWB 5AQHB 1ZHCA 4IE4A 3WI3A 2UXBT 2YK0A 4TV8E 4CZZB 5HCJA 5LGTB 1R8IA 1WR0A 4KI0F 5KX5E 4O2BE 3AXJB 2K24A 2ZM8A 3DJBA 3SWHA 2N2NA 1UK5A 5AQLB 3MA9A 3UT5E 4QH1A 3IA3A 4DVDA 4YHHT 2CRBA 4HFBA 4JEHB 4YTMA 2LJLA 4TZ4C 2MYSA 5M4YA 2IHR1 4JI1T 4OFZA 4U72A 2BG9C 2IIUA 5AQTB 4JEUB 3UUMA 4JLEA 1W0AA 4U2YA 3ZCIA 2V7MA 3AE5A 2JQQA 2W63A 2YEVC 1NENA 3HA4A 3UU5A 4YSYA 5JH7E 3MK7C 4X1YE 2ODUA 5C2TA 4CI2B 4ILCA 4FJOA 2X0HA 3RKOA 3NWIA 4AKGA 2Q9QC 3KDSE 4ZZCA 1NAFA 5CJ5A 2BZBA 2XAHB 5LG3A 3H37A 3OTOT 4Z90A 4IDPA 3TLVA 2ES0A 5AQFB 4CN6A 2X9YA 3ZMTB 3AE7A 2KSRA 3AAEB 3QUJA 1WYCA 4O4LE 3CQCB 5JVDE 2JRKA 2E5VA 3G06A 2DHRA 2L8KA 4IDQA 5DJQC 3R84B 2Z6EA 4U7YA 4U74A 4U2ZA 2BVLA 2KXPB 1YXRA 2X9XA 2BG9E 2XAFB 2LM2A 2XAGB 1G8XA 3L39A 4L9IA 5ABFB 2WWUA 4AQGA 2UXDT 3TLSA 1KEYA 5BR8T 1D1CA 4CXWA 3HKEE 3OBVE 2L9QA 4K0UA 4EEBA 3O1JA 1KK7A 4MFRA 3RLFF 4LF6T 4ZI3C 1J5ET 2LM9A 3RC8A 5AQVB 2FJDA 5LGNB 5LHHB 2YINA 4JUYA 4O2AE 4WZXA 5FXWA 2V7JA 4P0BA 2XQ4A 2EHOB 3HKBE 4UELA 4J2CA 2QA7A 1QUUA 4MALA 2EHOA 5FVKA 3VRAA 2XJ7A 3LFMA 5JDQA 2CBIA 5EK2A 3AEAA 2IW5B 3ZCJA 3NKZA 4C91A 4TWHA 2HH7A 1D0XA 3VU7H 2YOEA 3KV5A 2V1DB 3W15B 1D0ZA 1WYBA 3ESLA 4QHOA 5F5WA 3MXZA 3MACA 2IMLA 4JBWF 2XQ6A 4H9SE 5ADXL 3PTRB 2W4XA 3RIFA 3VKHA 2BBJA 3N9MA 4UVBB 3AXJA 3FZMB 4GYRA 4O4JE 3KBUA 5FYMA 5FXZA 3ZPOA 3TKLB 3AEGA 1NEKA 3JAEA 2D5UA 1JNRA 2KZ7B 3AEFA 3CQXC 4ZS2A 3LBXA 5LXTE 4HWCA 4YT0A 1BR1A 4A56A 4DV6T 1M7KA 2QGSA 2XQAA 3ONXA 3B5MA 3QK6A 3FZFB 5L3FB 2L3LA 3HR0A 4X5TA 2Y8DA 3AVSA 3X1DA 1U4QA 3V5UA 5LP6E 3LK42 3M3ZB 1FJGT 3R6NA 3K3OA 5JDMA 3PDYA 2JQKA 4CN4A 5HXSA 1KNZA 4ISTA 4QH5A 5JDHA 2NW7A 3N5LA 4ZXLA 2NWBA 5DQWA 5AQJB 2Q9QA 3BQKA 5LG4A 3KVBA 3QB5A 4HFDA 4ZI7E 3Q9DA 2BS3A 2X67A 5ETWA 5HAXA 4EGWA 1HG5A 2ACXA 3HL6A 2YDSA 3RHWA 3UU3A 3ZSTA 1OEDB 2JJ9A 4X1IE 2LEHA 5EK4A 2VWAA 2UU9T 2W2UA 3ANWA 4OYKA 4YFSA 4OHFA 1WRDA 3UUNA 2CHOA 3K3QC 3PUGA 3AEDA 4U31A 1D0YA 5J2UE 4PK5A 1XDOA 3AAIA 2X0LB 3AECA 2X66A 3MZKB 5HEGA 1MIVA 1WFDA 2A3DA 4M1PA 5AQSB 5F3JA 2ZM2A 3C4ZA 3RC3A 5C3JA 4OX9T 4PJMA 2WM9A 3LSVA 3KVAA 1Z0PA 5ABFA 4B3TT 3B57A 3NBXX 4HFCA 3C51A 2JQ9A 1SHZC 3C50A 2VQET 3PJAJ 4DBRA 4YTNA 4JV5T 2K3WA 4UVAB 5FMNA 3ZSSA 1HTJF 2MAWA 2V7IA 4H9NC 3IHRA 4XZCA 1N36T 3OVUA 3PUXF 2E9XD 4PFOA 4DV7T 1Y64B 5FY1A 4C90A 4L0RA 2FBWA 4BAYB 5HEUA 3OKQA 1CHUA 2BDEA 2NR4A 2XQ3A 4I0UA 2MTQA 3LK3B 4TUYE 3RPUA 1E2AA 3ETVA 3E0ZA 2WBLA 4O4IE 3EDUA 4I50E 4CI3B 3RIUC 4DR6T 3K8PC 2LKGA 1XZYA 3N9NA 3PUZF 1Z8UA 3ZMVB 4ASKA 2E9XA 4KX6A 4AKRB 3MJXA 4YSXA 2E9XB 4V1Av 4P0AA 2KNDA 3F31A 2VURA 2KINB 3EABA 3FBZA 4A5XA 1FEWA 1ZV4X 1IJ6A 5L3BB 2NP9A 5L2LA 4HWFA 5H6QB 3J9X1 3TLTA 2YU2A 3BQIA 4AQFA 4CXXA 2V7KA 3UU6A 3FXDB 1KFYA 5LA6E 5HXCA 3BK9A 1IBKT 1SA0E 1YQ3A 1MMDA 3CX6B 2V6XA 1O3XA 3WAJA 5CFBA 3N2KE 3DTOA 3EHZA 3RX6A 3JAFA 1HFAA 2OA5A 5JR9A 4P1NA 2CWYA 2CHNA 3ETUA 2VVSA 3PJAA 1WLXA 3Q2MA 5LB7B 3RF1A 2I6HA 3L09A 3I0OA 3ZC1A 5J2TE 3J7Yq 2WU2A 2OV9A 4IREA 2VVNA 5E0OA 1L0VA 2WB5A 4KMCA 2KMFA 2C0SA 2C5KT 4NUVA 1HR0T 2F4VT 2IDOB 4IE7A 4I55E 2W00A 3PUWF 1BR0A 1UGOA 2H3RA 2UXXB 1ZOYA 3ZJ2A 2W0GA 1D1AA 3QOFA 4PNIA 3VHLA 1M62A 2G0UA 2BS2A 2X68A 2YKSA 3E22E 5IWAT 4Q25A 3EUHA 4YSZA 5AFUL 1ZKEA 3PUAA 4ISSA 3RGLA 3LBXB 4UVCB 3P4WA 4LMJA 3LDQB 4ADZA 5JR9C 2WP9A 3CX8B 1LKXA 3M65A 5JTGA 3NVOA 5FXXA 3VR9A 1YKEB 3RH3A 2XQ7A 4CQIA 2CXFA 3F57A 4X66T 2ACZA 4WBOA 1T7SA 4U7IA
chains in the Genus database with same CATH topology
3FZHB 5AQNB 4HWCA 4HWDA 1M7KA 5AQVB 1I6ZA 3FZFB 5AQSB 5AQHB 3M3ZB 5AQIB 5AQFB 5AQRB 1UGOA 5AQUB 4HWHA 5AQQB 5AQMB 1UK5A 5AQLB 5AQJB 4HWFA 1M62A 1HX1B 4HWIB 2D9DA 5AQGB 3FZLB 5AQOB 3A8YC 5AQTB 3LDQB 3FZMB 3FZKB 5AQPB 5AQKB 1T7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZH B;  5AQN B;  4HWC A;  4HWD A;  1M7K A;  5AQV B;  1I6Z A;  3FZF B;  5AQS B;  5AQH B;  3M3Z B;  5AQI B;  5AQF B;  5AQR B;  1UGO A;  5AQU B;  4HWH A;  5AQQ B;  5AQM B;  1UK5 A;  5AQL B;  5AQJ B;  4HWF A;  1M62 A;  1HX1 B;  4HWI B;  2D9D A;  5AQG B;  3FZL B;  5AQO B;  3A8Y C;  5AQT B;  3LDQ B;  3FZM B;  3FZK B;  5AQP B;  5AQK B;  1T7S A; 
#chains in the Genus database with same CATH topology
 3AA7 B;  3F2E A;  4HFV A;  4AXP A;  2A2F X;  2KWI B;  2XQ5 A;  2XUE A;  2YU1 A;  3ZYK A;  4AQF C;  2CLY C;  4ZEY A;  2UXC T;  1FMW A;  2RP4 A;  2KLQ A;  3PUV F;  2VKJ A;  3FBL A;  4UV9 B;  2Q9Q B;  5HWY A;  2W61 A;  2LOS A;  4HGA A;  3SFE A;  1J1J A;  4TX5 A;  1W09 A;  3ZT5 A;  3IEE A;  4EOZ B;  5LMU T;  4DND A;  2PG8 A;  3RYC E;  4QXC B;  4QXH B;  2ODV A;  5LBQ B;  1DU2 A;  2WQY A;  1UX4 A;  2E9X C;  1OED E;  3CML A;  3P4R A;  3RYI E;  1FMV A;  2H7V C;  4PFP A;  1OWA A;  2BBH A;  2NTX A;  3RIU A;  1LVF A;  3ZKR A;  4DR3 T;  4G63 A;  5J1G A;  4YJ2 E;  4TNW A;  3NRX A;  4DR7 T;  3JC6 C;  4HWI B;  2CA5 A;  3FZL B;  3A8Y C;  3N2O A;  3UQ4 A;  3VR8 A;  1N32 T;  3AE4 A;  2VKH A;  3FHN A;  4HFE A;  4DV5 T;  4CN1 A;  3UUL A;  1LVK A;  3AE1 A;  3Q5X A;  3AB3 B;  3B13 A;  3O1I A;  4KHZ F;  4MLK A;  5AQK B;  3VRB A;  4AI6 A;  1JNZ A;  5AQN B;  2XTL A;  3CPZ A;  3ZLI A;  5FXV A;  5TAO A;  3ZMZ B;  4EED A;  1HNW T;  4F6R C;  3N9P A;  3UFE A;  4E7Z A;  1EZ3 A;  3AE3 A;  5LHG B;  3UTK A;  3C4X A;  3FXE B;  3T1Y T;  3C4W A;  4X1K E;  3T8O A;  2DWK A;  4FI5 A;  2SPC A;  3I9W A;  2W62 A;  4HFH A;  3ZMS B;  4YTP A;  5KDM C;  4YLH A;  2LHN A;  5L4H A;  3AEE A;  3Q5E A;  5AQU B;  2LOP A;  2A72 A;  2VKO A;  5L3E B;  4ZZB A;  4X62 T;  2XZE A;  1KF6 A;  2FJB A;  1QLB A;  5F8P A;  4YHJ A;  3AA1 B;  1QSD A;  2XAJ B;  2AXD S;  4PJL A;  2CM0 A;  1SUM B;  2D9D A;  3GA8 A;  3O4X E;  1VCT A;  2LLY A;  3ZJ1 A;  4DV4 T;  2IUB A;  3AEB A;  4HFI A;  4EAH A;  3I0Q A;  4AKI A;  1YKH B;  2R6G F;  1VRB A;  5CB4 E;  3QB5 K;  5A1L A;  4NUU A;  4ERR A;  2XSA A;  5HEJ A;  2FUP A;  4HEA A;  4CXY A;  3TLU A;  4JI5 T;  1MIW A;  2WDV A;  3EDV A;  3ZC0 A;  2XAQ B;  4GKK T;  2K9A A;  5JRC A;  4UEM A;  2LE8 A;  2YDQ A;  3ABV A;  3SRZ A;  2HN1 A;  2C5I T;  5JRC B;  3K3N A;  4ZI2 C;  3EI0 A;  1HS7 A;  1VCS A;  2VK9 A;  3KV9 A;  1UUS A;  2LHR A;  3K1S A;  3CK6 A;  2FJE A;  4IL4 A;  2QVA A;  3L8R A;  3Q5D A;  3ZYM A;  4AIU A;  4ZI3 D;  2XQ8 A;  4LF8 T;  2MOZ A;  5JDL A;  5HXR A;  3AE9 A;  4X65 T;  4DUZ T;  1HNZ T;  2QRX A;  2BKO A;  5AQM B;  1IBL T;  4K0K T;  2HN2 A;  2I59 A;  4UV8 B;  4KBM B;  4LML A;  4PJJ A;  5JDF A;  2XAS B;  2JMH A;  3ONL C;  4H63 V;  4F8H A;  2E5L T;  4QX7 B;  4ANJ A;  3D0T A;  2QYW A;  1GQE A;  4E7S A;  3KBT A;  2B76 A;  2I0M A;  2N9D A;  2V7L A;  3H3M A;  4EZ4 A;  4AKL A;  2LT3 A;  1XNR T;  4JI2 T;  2WWV A;  2UUB T;  1N34 T;  3LJC A;  5CA1 E;  1BR2 A;  3AVR A;  1MND A;  2WS3 A;  2E8I A;  2X51 A;  3RI5 A;  2Q9Q D;  3NRY A;  2N1G A;  4HKA A;  2KT9 A;  4MBQ A;  4UR9 A;  2CXL A;  1MMA A;  4ILA A;  4PK6 A;  5EZY E;  3UUX B;  4ZHQ E;  4DV0 T;  2EHO C;  2BVM A;  1N33 T;  1B7T A;  1BR4 A;  1MIY A;  2XQY A;  4COF A;  3O9X A;  1KNR A;  2ZMA A;  4BA9 A;  5HXE A;  2WDQ A;  2H7O A;  2IC9 A;  1YW0 A;  2DNX A;  2WAU A;  4ZOL E;  5FP3 A;  1UUR A;  2W66 A;  5L3D B;  3DP7 A;  5L3G B;  2CMR A;  3AE8 A;  3PV0 F;  2MBG A;  3ZMU B;  2J1D G;  3ZEF B;  4A98 A;  3P4S A;  4WNK A;  1X9B A;  4JI0 T;  2CCQ A;  4DV1 T;  1E1H B;  4GIW A;  1WR6 A;  3SS1 A;  4IHJ E;  5LGU B;  2ZLY A;  4QWN B;  2LSY A;  1U5P A;  4B6X A;  4ZI2 D;  5L47 A;  2CXD A;  2VKD A;  2JIW A;  3SFD A;  3A5X A;  2CLY B;  4GKJ T;  3RKG A;  2HHH T;  2UUA T;  4P09 A;  2WU5 A;  3RQW A;  4X64 T;  3OPC A;  5ABG A;  4X20 E;  4LFC T;  2RPA A;  1IZN B;  3PUY F;  3LK2 B;  5FY7 A;  4DMV A;  2M6B A;  5HXH A;  4JI6 T;  2HPL A;  2XPK A;  4QH4 A;  4DR5 T;  1OXZ A;  2CBJ A;  5AQR B;  3ONJ A;  2LSG A;  3N9O A;  3U3I A;  4GK0 E;  1HX8 A;  2K5B B;  2XY8 B;  5IHY A;  2K48 A;  5LYJ E;  4IDO A;  5HEH A;  3PUS A;  4DR1 T;  4GYS A;  3AA0 B;  2EHO D;  2PBI A;  4UXN B;  4G2A A;  4DO0 A;  3QNU A;  1FIO A;  2MPK A;  2V26 A;  3AAA B;  4NXM T;  4CI1 B;  5AQO B;  3ZT7 A;  4DBQ A;  2J62 A;  5HCM A;  4EYU A;  4LF4 T;  5KMG P;  3AA6 B;  2UUC T;  3P4P A;  3CQG B;  2AE9 A;  2NW8 A;  3HI2 A;  3N2G E;  4N78 D;  1X79 A;  4H63 H;  3UFG A;  4YXD A;  2BG9 B;  3EAM A;  3RRC A;  2BG9 A;  3P50 A;  4DV3 T;  1D1B A;  3GN5 A;  2D0U A;  2HPJ A;  3FZH B;  4ZS3 A;  2CPT A;  3GN5 B;  2LKH A;  2J47 A;  3OYX A;  4UF0 A;  5ABE A;  5LJM A;  4AQY T;  2V5C A;  2V5D A;  4HN9 A;  4XBF B;  1I6Z A;  1SE7 A;  2PFV A;  1G73 A;  2NTY A;  1XWM A;  1YQ4 A;  2W67 A;  1AJ3 A;  4TN7 B;  3E08 A;  3ZT6 A;  2KWH A;  2H88 A;  3RQU A;  5J0Z A;  2IAK A;  5EK3 A;  5GON E;  2BS4 A;  5C8Y E;  4YY3 T;  2PJQ A;  1S35 A;  3WAK A;  1MMG A;  3UQ7 A;  4IDZ A;  5FKY A;  3HKD E;  4HWH A;  1T8B A;  3CKD A;  3JC6 D;  3N9L A;  1W0B A;  2LSK A;  4Z8X A;  4EV6 A;  3PE0 A;  5BMV E;  3O1H A;  4EB6 E;  3P4Q A;  3VKG A;  1OED C;  2DL1 A;  1HCI A;  2V8S V;  4IE5 A;  2D2S A;  5CGM A;  3NZQ A;  1MNE A;  2X9H A;  2WCA A;  3FB2 A;  5IUX A;  1XDP A;  4QX8 B;  1MMN A;  2NOX A;  4EIW A;  4LF5 T;  5LMN T;  3FZK B;  1CUN A;  1V9D A;  2WMN A;  2WZI A;  2WY2 A;  3CWZ B;  4TWD A;  4OK0 A;  4XAX B;  4O8S A;  1IJ5 A;  3SOL A;  3U78 A;  4KHP T;  1XMO T;  1XMQ T;  2Y48 B;  2CE7 A;  4IGU A;  4GOU A;  2XM1 A;  2DLR A;  4ILB A;  5JDN A;  1IAP A;  5LNK A;  1S94 A;  4TNV A;  5L4E A;  2DI4 A;  3QC9 A;  2VAS A;  2CWO A;  4IIJ E;  4QKN A;  5FVL A;  3UUB A;  4BJM A;  3UU4 A;  1WCR A;  2PTF A;  4KUM B;  2B1E A;  2H89 A;  5AQQ B;  4HE8 A;  1T98 A;  1US7 B;  2XM2 A;  4PW8 A;  2XQ9 A;  4PK4 A;  2WSS V;  5AQG B;  2XSB A;  2DCF A;  3H3A A;  4NXN T;  3RYF E;  2ZM6 T;  3C98 B;  2IC6 A;  2P9B A;  1ZEE A;  3JAD A;  3KIN B;  4U3C A;  4DUY T;  5AQP B;  3PUQ A;  5KXJ A;  2Y6X A;  3AE2 A;  4DV2 T;  3JCF A;  4IDN A;  1LRZ A;  3EVY A;  3IF8 B;  4UIG A;  2RA1 A;  4WW0 A;  4HWD A;  4WYV A;  5HYA A;  2C5J A;  3T1H T;  4B3R T;  3I9Y A;  4JI3 T;  4AKH A;  4LMK A;  2LRK A;  4WBN E;  1T72 A;  3S4U A;  5LJN A;  5IYZ E;  1I94 T;  5AQI B;  4HTE A;  4ILU A;  2VB6 A;  2E2A A;  1UX5 A;  5JDG A;  3CVR A;  5JQG E;  4DR2 T;  5H6R B;  3IBP A;  2M6I A;  5JRE A;  4U33 A;  4IE6 A;  4B3S T;  5DAB A;  4EYY R;  4TV9 E;  3GMI A;  3KV6 A;  1HF8 A;  2WZH A;  1HX1 B;  5LCY A;  5FNV E;  2JQH A;  1W9R A;  2VL8 A;  3NZP A;  4BJN A;  3GWH A;  5CA0 E;  3MKD A;  5DQV A;  5L3C B;  3ZN0 B;  3AE6 A;  1KNP A;  2LSI A;  2BKP A;  2BKN A;  4JI8 T;  2XHE B;  4IL9 A;  2J4G A;  3KFW X;  4PJN A;  4JYA T;  4EZH A;  4I4T E;  1E7P A;  4KP3 C;  4IT4 A;  3TLW A;  2M67 A;  2LSJ A;  4H9Q C;  4MHC A;  3PU3 A;  1VOM A;  1YD8 G;  3HKC E;  1J5W A;  3UU8 A;  5FL0 A;  2VQF T;  4DR4 T;  4NIQ A;  3CX7 B;  3PUR A;  4PAG A;  2JMK A;  2YDR A;  4JI4 T;  4TWF A;  2YN6 A;  4LFB T;  5LHI B;  4O4H E;  2VL0 A;  2WDR A;  3RYH E;  3PU8 A;  5ABH A;  2GK9 A;  4I43 B;  2D0T A;  5LOV E;  5LBM A;  4DID B;  4EXT A;  3Q5W A;  3V5S A;  3N9Q A;  3OYZ A;  4DMW A;  1Y01 A;  2JPF A;  2OLT A;  3LG7 A;  2ZM0 A;  3BQL A;  3CIR A;  3I1A A;  4AIS A;  2WMO A;  1ZP0 A;  5FL1 A;  1UCU A;  1XNQ T;  2A9U A;  4IE0 A;  4H9P C;  1IBM T;  4UF0 B;  4QXB B;  3ZYL A;  4YJ3 E;  2V6Y A;  4H9O C;  4OYJ A;  5FY0 A;  3P7I A;  5HEO A;  5JR9 B;  2V6Y B;  4L5G A;  3L3P A;  4JI7 T;  2LRL A;  3C64 A;  4H9R C;  5HWX A;  1HNX T;  4GK5 E;  3ZN1 B;  2DWG A;  3A7M A;  1HG2 A;  4NPP A;  2X9W A;  2X0Y A;  3OJA A;  4Z91 A;  3RIA A;  2CEA A;  3RRW A;  2NW9 A;  4A97 A;  4LF7 T;  4LF9 T;  1OED A;  2FJA A;  3P8C D;  3KV4 A;  1NWM X;  2UXN B;  4LFA T;  1H7C A;  4B3M T;  3ANW B;  5AQH B;  1ZHC A;  4IE4 A;  3WI3 A;  2UXB T;  2YK0 A;  4TV8 E;  4CZZ B;  5HCJ A;  5LGT B;  1R8I A;  1WR0 A;  4KI0 F;  5KX5 E;  4O2B E;  3AXJ B;  2K24 A;  2ZM8 A;  3DJB A;  3SWH A;  2N2N A;  1UK5 A;  5AQL B;  3MA9 A;  3UT5 E;  4QH1 A;  3IA3 A;  4DVD A;  4YHH T;  2CRB A;  4HFB A;  4JEH B;  4YTM A;  2LJL A;  4TZ4 C;  2MYS A;  5M4Y A;  2IHR 1;  4JI1 T;  4OFZ A;  4U72 A;  2BG9 C;  2IIU A;  5AQT B;  4JEU B;  3UUM A;  4JLE A;  1W0A A;  4U2Y A;  3ZCI A;  2V7M A;  3AE5 A;  2JQQ A;  2W63 A;  2YEV C;  1NEN A;  3HA4 A;  3UU5 A;  4YSY A;  5JH7 E;  3MK7 C;  4X1Y E;  2ODU A;  5C2T A;  4CI2 B;  4ILC A;  4FJO A;  2X0H A;  3RKO A;  3NWI A;  4AKG A;  2Q9Q C;  3KDS E;  4ZZC A;  1NAF A;  5CJ5 A;  2BZB A;  2XAH B;  5LG3 A;  3H37 A;  3OTO T;  4Z90 A;  4IDP A;  3TLV A;  2ES0 A;  5AQF B;  4CN6 A;  2X9Y A;  3ZMT B;  3AE7 A;  2KSR A;  3AAE B;  3QUJ A;  1WYC A;  4O4L E;  3CQC B;  5JVD E;  2JRK A;  2E5V A;  3G06 A;  2DHR A;  2L8K A;  4IDQ A;  5DJQ C;  3R84 B;  2Z6E A;  4U7Y A;  4U74 A;  4U2Z A;  2BVL A;  2KXP B;  1YXR A;  2X9X A;  2BG9 E;  2XAF B;  2LM2 A;  2XAG B;  1G8X A;  3L39 A;  4L9I A;  5ABF B;  2WWU A;  4AQG A;  2UXD T;  3TLS A;  1KEY A;  5BR8 T;  1D1C A;  4CXW A;  3HKE E;  3OBV E;  2L9Q A;  4K0U A;  4EEB A;  3O1J A;  1KK7 A;  4MFR A;  3RLF F;  4LF6 T;  4ZI3 C;  1J5E T;  2LM9 A;  3RC8 A;  5AQV B;  2FJD A;  5LGN B;  5LHH B;  2YIN A;  4JUY A;  4O2A E;  4WZX A;  5FXW A;  2V7J A;  4P0B A;  2XQ4 A;  2EHO B;  3HKB E;  4UEL A;  4J2C A;  2QA7 A;  1QUU A;  4MAL A;  2EHO A;  5FVK A;  3VRA A;  2XJ7 A;  3LFM A;  5JDQ A;  2CBI A;  5EK2 A;  3AEA A;  2IW5 B;  3ZCJ A;  3NKZ A;  4C91 A;  4TWH A;  2HH7 A;  1D0X A;  3VU7 H;  2YOE A;  3KV5 A;  2V1D B;  3W15 B;  1D0Z A;  1WYB A;  3ESL A;  4QHO A;  5F5W A;  3MXZ A;  3MAC A;  2IML A;  4JBW F;  2XQ6 A;  4H9S E;  5ADX L;  3PTR B;  2W4X A;  3RIF A;  3VKH A;  2BBJ A;  3N9M A;  4UVB B;  3AXJ A;  3FZM B;  4GYR A;  4O4J E;  3KBU A;  5FYM A;  5FXZ A;  3ZPO A;  3TKL B;  3AEG A;  1NEK A;  3JAE A;  2D5U A;  1JNR A;  2KZ7 B;  3AEF A;  3CQX C;  4ZS2 A;  3LBX A;  5LXT E;  4HWC A;  4YT0 A;  1BR1 A;  4A56 A;  4DV6 T;  1M7K A;  2QGS A;  2XQA A;  3ONX A;  3B5M A;  3QK6 A;  3FZF B;  5L3F B;  2L3L A;  3HR0 A;  4X5T A;  2Y8D A;  3AVS A;  3X1D A;  1U4Q A;  3V5U A;  5LP6 E;  3LK4 2;  3M3Z B;  1FJG T;  3R6N A;  3K3O A;  5JDM A;  3PDY A;  2JQK A;  4CN4 A;  5HXS A;  1KNZ A;  4IST A;  4QH5 A;  5JDH A;  2NW7 A;  3N5L A;  4ZXL A;  2NWB A;  5DQW A;  5AQJ B;  2Q9Q A;  3BQK A;  5LG4 A;  3KVB A;  3QB5 A;  4HFD A;  4ZI7 E;  3Q9D A;  2BS3 A;  2X67 A;  5ETW A;  5HAX A;  4EGW A;  1HG5 A;  2ACX A;  3HL6 A;  2YDS A;  3RHW A;  3UU3 A;  3ZST A;  1OED B;  2JJ9 A;  4X1I E;  2LEH A;  5EK4 A;  2VWA A;  2UU9 T;  2W2U A;  3ANW A;  4OYK A;  4YFS A;  4OHF A;  1WRD A;  3UUN A;  2CHO A;  3K3Q C;  3PUG A;  3AED A;  4U31 A;  1D0Y A;  5J2U E;  4PK5 A;  1XDO A;  3AAI A;  2X0L B;  3AEC A;  2X66 A;  3MZK B;  5HEG A;  1MIV A;  1WFD A;  2A3D A;  4M1P A;  5AQS B;  5F3J A;  2ZM2 A;  3C4Z A;  3RC3 A;  5C3J A;  4OX9 T;  4PJM A;  2WM9 A;  3LSV A;  3KVA A;  1Z0P A;  5ABF A;  4B3T T;  3B57 A;  3NBX X;  4HFC A;  3C51 A;  2JQ9 A;  1SHZ C;  3C50 A;  2VQE T;  3PJA J;  4DBR A;  4YTN A;  4JV5 T;  2K3W A;  4UVA B;  5FMN A;  3ZSS A;  1HTJ F;  2MAW A;  2V7I A;  4H9N C;  3IHR A;  4XZC A;  1N36 T;  3OVU A;  3PUX F;  2E9X D;  4PFO A;  4DV7 T;  1Y64 B;  5FY1 A;  4C90 A;  4L0R A;  2FBW A;  4BAY B;  5HEU A;  3OKQ A;  1CHU A;  2BDE A;  2NR4 A;  2XQ3 A;  4I0U A;  2MTQ A;  3LK3 B;  4TUY E;  3RPU A;  1E2A A;  3ETV A;  3E0Z A;  2WBL A;  4O4I E;  3EDU A;  4I50 E;  4CI3 B;  3RIU C;  4DR6 T;  3K8P C;  2LKG A;  1XZY A;  3N9N A;  3PUZ F;  1Z8U A;  3ZMV B;  4ASK A;  2E9X A;  4KX6 A;  4AKR B;  3MJX A;  4YSX A;  2E9X B;  4V1A v;  4P0A A;  2KND A;  3F31 A;  2VUR A;  2KIN B;  3EAB A;  3FBZ A;  4A5X A;  1FEW A;  1ZV4 X;  1IJ6 A;  5L3B B;  2NP9 A;  5L2L A;  4HWF A;  5H6Q B;  3J9X 1;  3TLT A;  2YU2 A;  3BQI A;  4AQF A;  4CXX A;  2V7K A;  3UU6 A;  3FXD B;  1KFY A;  5LA6 E;  5HXC A;  3BK9 A;  1IBK T;  1SA0 E;  1YQ3 A;  1MMD A;  3CX6 B;  2V6X A;  1O3X A;  3WAJ A;  5CFB A;  3N2K E;  3DTO A;  3EHZ A;  3RX6 A;  3JAF A;  1HFA A;  2OA5 A;  5JR9 A;  4P1N A;  2CWY A;  2CHN A;  3ETU A;  2VVS A;  3PJA A;  1WLX A;  3Q2M A;  5LB7 B;  3RF1 A;  2I6H A;  3L09 A;  3I0O A;  3ZC1 A;  5J2T E;  3J7Y q;  2WU2 A;  2OV9 A;  4IRE A;  2VVN A;  5E0O A;  1L0V A;  2WB5 A;  4KMC A;  2KMF A;  2C0S A;  2C5K T;  4NUV A;  1HR0 T;  2F4V T;  2IDO B;  4IE7 A;  4I55 E;  2W00 A;  3PUW F;  1BR0 A;  1UGO A;  2H3R A;  2UXX B;  1ZOY A;  3ZJ2 A;  2W0G A;  1D1A A;  3QOF A;  4PNI A;  3VHL A;  1M62 A;  2G0U A;  2BS2 A;  2X68 A;  2YKS A;  3E22 E;  5IWA T;  4Q25 A;  3EUH A;  4YSZ A;  5AFU L;  1ZKE A;  3PUA A;  4ISS A;  3RGL A;  3LBX B;  4UVC B;  3P4W A;  4LMJ A;  3LDQ B;  4ADZ A;  5JR9 C;  2WP9 A;  3CX8 B;  1LKX A;  3M65 A;  5JTG A;  3NVO A;  5FXX A;  3VR9 A;  1YKE B;  3RH3 A;  2XQ7 A;  4CQI A;  2CXF A;  3F57 A;  4X66 T;  2ACZ A;  4WBO A;  1T7S A;  4U7I A; 
#chains in the Genus database with same CATH homology
 3FZH B;  5AQN B;  4HWC A;  4HWD A;  1M7K A;  5AQV B;  1I6Z A;  3FZF B;  5AQS B;  5AQH B;  3M3Z B;  5AQI B;  5AQF B;  5AQR B;  1UGO A;  5AQU B;  4HWH A;  5AQQ B;  5AQM B;  1UK5 A;  5AQL B;  5AQJ B;  4HWF A;  1M62 A;  1HX1 B;  4HWI B;  2D9D A;  5AQG B;  3FZL B;  5AQO B;  3A8Y C;  5AQT B;  3LDQ B;  3FZM B;  3FZK B;  5AQP B;  5AQK B;  1T7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...