3FZMB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
111
structure length
111
Chain Sequence
b'GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
molecule tags Chaperone
source organism Homo sapiens
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
total genus 46
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzmB00
4HWIB 5AQNB 3FZLB 5AQOB 3M3ZB 4HWCA 5AQIB 5AQFB 3FZMB 5AQHB 1UK5A 5AQPB 5AQLB 1I6ZA 1UGOA 4HWFA 5AQJB 1M62A 3A8YC 5AQUB 1M7KA 4HWDA 5AQGB 5AQQB 5AQMB 1T7SA 5AQKB 3FZKB 2D9DA 3LDQB 5AQRB 1HX1B 5AQVB 4HWHA 3FZHB 5AQTB 3FZFB 5AQSB
chains in the Genus database with same CATH superfamily
5JVDE 4LFBT 2X51A 4P0AA 3I1AA 4ZI3D 4I0UA 1HCIA 1MMAA 2CBJA 2CWYA 4AQYT 2CE7A 2XM2A 5AQIB 4EV6A 5JDLA 2J4GA 2WS3A 2LRLA 3RF1A 4ILCA 4TUYE 3MZKB 3E0ZA 4HWFA 2PG8A 2DHRA 3IA3A 3ZMSB 4U7YA 4ZZBA 4HFVA 3NBXX 2V7IA 2V5CA 3AAIA 2C0SA 1D1AA 4UEMA 3AB3B 4X1IE 3C4ZA 3LBXA 1LRZA 4H9NC 3GMIA 4JBWF 4EYYR 5JDNA 4PJJA 4DV3T 5LGNB 1IBKT 4AI6A 3K8PC 2BG9A 3MXZA 4HE8A 4HFBA 4EGWA 4WW0A 1HNZT 2CA5A 3ZC1A 3CQGB 2UUAT 2KWIB 2MAWA 1GQEA 3EABA 3KV6A 5EZYE 1S94A 2WDRA 2BDEA 5L3EB 4IGUA 5CA0E 4X1YE 5J1GA 5LYJE 3EHZA 3P7IA 4EZ4A 2BG9B 2BZBA 3VKGA 1OEDA 1KEYA 2GK9A 2JRKA 2WM9A 3AVRA 3EDVA 5HEUA 3RPUA 1LVFA 2XY8B 3NRYA 2XQYA 1UX5A 2R6GF 3N2OA 2WU2A 3EAMA 5FNVE 2ACXA 5HEHA 3ZYMA 2NW7A 3C4XA 5HXCA 2CPTA 1W09A 3ZMTB 2IC6A 4QH1A 5AQUB 3VRAA 4YTMA 4X20E 2F4VT 1U4QA 3HA4A 4B3RT 4DBQA 3AA6B 3PUGA 3Q5WA 4U31A 3AEFA 1WFDA 4DIDB 4AXPA 2HN2A 2VKDA 2V7LA 3ZMZB 4CI3B 3IEEA 2XQ9A 4NIQA 3TLWA 5AFUL 1XDOA 2UU9T 4KHPT 3OYXA 2C5JA 3ZSSA 3UUNA 2UXCT 4ERRA 4TN7B 5ABHA 5ABFB 2BKOA 5H6RB 4JI8T 3ANWB 2BS2A 2X68A 3N5LA 2QVAA 3N9QA 4ILBA 2IMLA 4LMJA 5LG3A 3ZT7A 4DR5T 3QNUA 4LF4T 4ILUA 3CK6A 4CQIA 3F57A 1QLBA 1FMWA 2MBGA 2E9XD 3GWHA 4DV1T 4HFHA 1L0VA 1D1BA 2WZIA 5J0ZA 4QX7B 2KINB 3NRXA 2VWAA 4IHJE 4LMKA 3J9X1 3U3IA 2EHOA 3KINB 2A72A 2JIWA 5FXWA 3RKGA 4YY3T 1FMVA 2E9XC 3C98B 4DUYT 4UF0A 1SE7A 2KXPB 1N32T 3N9PA 4QH5A 2Z6EA 3AA7B 4KI0F 1MIVA 3KBTA 4IL4A 2UUCT 3AAEB 3AEBA 4YTPA 3F2EA 4DV5T 3ZCIA 3T1HT 2XQ4A 5CJ5A 4XAXB 5C8YE 1JNZA 4YJ3E 2LSYA 2XQ6A 4IE5A 3HKDE 2LEHA 2YOEA 4YLHA 2HHHT 2VKOA 4JI7T 1UK5A 1J5WA 4LF9T 4JYAT 1AJ3A 4I4TE 4JI2T 1I6ZA 2D2SA 3PUSA 3N2GE 2XZEA 5JDMA 2NTYA 4IE6A 3J7Yq 4JV5T 1OXZA 5JDQA 4AKHA 2CLYC 3LBXB 4KUMB 3AXJA 3OVUA 4GYRA 3KBUA 2WMNA 2YU1A 3PUYF 4GYSA 4PJMA 1EZ3A 3VU7H 4CXXA 4DV6T 3TLUA 2HPLA 4YSYA 3ETUA 5HYAA 3WAJA 4JI4T 3RC8A 1X9BA 4HTEA 1T8BA 3ONJA 3LK3B 1B7TA 5J2TE 4ZOLE 3ETVA 3RC3A 1BR1A 4DO0A 1N33T 2FJDA 3K3QC 2WQYA 3R84B 2A9UA 3WAKA 2N1GA 4H9RC 3AXJB 4U7IA 4U2ZA 2FUPA 3UULA 3EVYA 5FY1A 2N2NA 1FIOA 2WSSV 3OYZA 3UU3A 3ZKRA 4IREA 4DVDA 2ODUA 2XHEB 3FZLB 4H9QC 1HTJF 3UFEA 4H63V 4H9PC 5LB7B 4EAHA 4AQFC 4ZHQE 3B5MA 1VCTA 2W0GA 1D1CA 3ZCJA 2KSRA 3ZYKA 3UT5E 2E9XA 3N9NA 2JPFA 4LFAT 3K1SA 5AQJB 4CN6A 4NXMT 2BS4A 1E1HB 3T8OA 1M7KA 1NAFA 3C4WA 3IF8B 5FXVA 3JADA 2VKHA 1MMGA 1VCSA 2LM9A 4IDZA 5FVKA 4NUUA 4YSZA 5FL1A 2A3DA 1SHZC 2XQ8A 2ZM0A 1G8XA 2J47A 1QUUA 2LT3A 2Y48B 4HFIA 4TWFA 3N9MA 2HPJA 3UU6A 4IIJE 3ZMUB 4AKGA 3CPZA 4E7SA 4OX9T 3LSVA 5FXZA 2WCAA 5F3JA 3RYHE 3CX8B 4LF8T 4LF5T 4L9IA 4DR6T 2BKPA 4LF6T 1YKHB 2W62A 2X0YA 2KT9A 3SOLA 5CB4E 2X67A 3G06A 4DR2T 4COFA 2I6HA 2YEVC 1YQ3A 2M6IA 2X9XA 1HF8A 4IDQA 4OFZA 3VRBA 3SFEA 5BMVE 1WYBA 5L3BB 1HR0T 2H88A 3VKHA 3LJCA 2ODVA 3BK9A 5JH7E 2QRXA 4IE0A 2UXDT 5DQWA 3RYFE 4HKAA 1M62A 2JMKA 1LVKA 4YHHT 3MK7C 5KX5E 3ABVA 2OA5A 2J1DG 2XSBA 4UVCB 5CFBA 5JREA 3OTOT 4CZZB 3O1IA 2KWHA 5EK4A 3T1YT 2IIUA 3AE5A 1X79A 3AE7A 4BJNA 4WYVA 1Z8UA 2JQHA 3GN5B 4IDPA 4O2BE 4P1NA 4HGAA 3CX6B 3GN5A 3IHRA 4KBMB 5LBQB 3S4UA 4A97A 3NZQA 2WDVA 3Q5XA 3ZSTA 4JUYA 4HFEA 4HWCA 2DCFA 4OHFA 3EDUA 3ONXA 3P4PA 3CQCB 1WR0A 2CCQA 2UXXB 5E0OA 5FXXA 3KVAA 2B76A 5LHIB 4QXBB 3ZEFB 1ZHCA 2CHOA 3H3AA 4YT0A 4KP3C 2NR4A 2ZM2A 2KNDA 2BG9C 5ABGA 3JCFA 4DV4T 1N36T 3ZT6A 2X0HA 2V5DA 1W9RA 4ISTA 4H9OC 4K0UA 4X5TA 4EEBA 3RIFA 1IAPA 2DNXA 4G63A 1XNQT 3RI5A 4NXNT 4MBQA 3HR0A 4HWDA 3UTKA 2DWGA 4YTNA 2WBLA 2W2UA 3RIAA 3B13A 4X64T 2ACZA 2I0MA 4ZI3C 2YU2A 1U5PA 4U72A 4EIWA 4O2AE 4PK6A 4B3ST 3L8RA 2XQ7A 4Z91A 1HX1B 4BJMA 2BBHA 2BS3A 3P4QA 3OKQA 5JR9A 1HG5A 2JQQA 3CWZB 5H6QB 3ZN1B 2WMOA 4F6RC 2UXBT 2VL8A 3FZFB 4GK0E 4H63H 2WDQA 3I0QA 3KV9A 5AQOB 3UUBA 3ESLA 4EB6E 3O1JA 3ZN0B 4E7ZA 1YKEB 3HL6A 4A5XA 5JRCB 3AVSA 4QHOA 5HCJA 5HEOA 1XMQT 3E22E 3FZMB 3QB5A 1WLXA 5DABA 3FXDB 3SWHA 2K5BB 1FJGT 1MNEA 3F31A 4OK0A 2D0TA 1Z0PA 2D0UA 2E2AA 2J62A 2YINA 1JNRA 2BKNA 4C91A 4XZCA 3PU8A 4ZS2A 5LHGB 2NW9A 3PJAJ 1YXRA 2XUEA 2VVSA 4M1PA 4B6XA 4NPPA 3LK2B 3Q9DA 2VASA 3FB2A 4HFDA 4V1Av 3ZMVB 1HX8A 4JI6T 2ES0A 3HI2A 4AKRB 2P9BA 2Y6XA 1ZKEA 3BQIA 4F8HA 1UCUA 4P0BA 1ZP0A 2L9QA 3CQXC 2H7OA 1HFAA 3PUWF 1LKXA 4FJOA 3KV4A 3QB5K 3U78A 2YDSA 3FZHB 1YW0A 3ONLC 3PV0F 5AQTB 4EYUA 3R6NA 2VL0A 4TNVA 2FJEA 2A2FX 4UELA 3AEAA 2NWBA 5DJQC 5ABFA 4AIUA 4JI5T 1KF6A 4X66T 3AECA 4U74A 2EHOC 5LGUB 5AQPB 5HEJA 4DMVA 2K9AA 4ADZA 1IBLT 1OEDE 1US7B 2JQKA 3AE4A 3RQWA 1BR2A 3OPCA 2V6XA 3PDYA 1CHUA 3N2KE 4YHJA 2VQET 2Q9QD 1O3XA 4MALA 2FJBA 4PK4A 5LCYA 3UU4A 3ZJ2A 5HEGA 4A56A 1D0ZA 1HG2A 3AEEA 3CMLA 3O1HA 1J5ET 1VOMA 4B3TT 3L39A 2CHNA 3AE3A 3L09A 2MYSA 3RX6A 3LDQB 3ZLIA 5FKYA 2LSJA 2X9HA 5LG4A 4Q25A 3FBLA 3UUXB 1OEDB 2XPKA 4DMWA 4ZI2C 2WY2A 3D0TA 5JDGA 5IWAT 2VB6A 1OWAA 4QX8B 3RYIE 4O4IE 1BR0A 2W61A 2XAFB 2UUBT 3BQKA 1CUNA 3LG7A 2LSKA 4PNIA 3C50A 1XWMA 4QXHB 1SA0E 3RRCA 4BAYB 2XQ5A 5IUXA 4QH4A 5LP6E 2QYWA 3MKDA 3BQLA 4ZI2D 5A1LA 5AQFB 2YK0A 2PFVA 2RPAA 3A5XA 5HXHA 5DQVA 5BR8T 2E5LT 1UGOA 2NW8A 3RH3A 4YJ2E 5FP3A 4KX6A 1OEDC 3AA0B 5FY0A 4UIGA 3PUZF 4DR3T 4UVAB 3Q5DA 4IL9A 2E9XB 2MTQA 3TLVA 1UX4A 2Q9QB 1Y64B 1J1JA 2FJAA 3EI0A 5M4YA 1N34T 3L3PA 4GK5E 3KVBA 4PFOA 1D0XA 2WZHA 2D5UA 1VRBA 2LE8A 2MPKA 5ETWA 5AQVB 3Q2MA 4KMCA 4QKNA 4TWHA 4PJLA 3VHLA 4AKIA 3QK6A 2ZM8A 4FI5A 1E7PA 1G73A 3NWIA 2X9WA 4H9SE 5FMNA 3M3ZB 4DBRA 4OYKA 2NOXA 3ZYLA 3UFGA 1IJ6A 4ZXLA 2DLRA 5AQHB 1XZYA 3CVRA 4HN9A 1NEKA 2JQ9A 3RYCE 1QSDA 1D0YA 2CXFA 2LSIA 3LFMA 3M65A 4PJNA 2LLYA 2XAGB 5HWYA 4UVBB 2LKHA 2MOZA 1UUSA 2LSGA 4UXNB 2RA1A 5KDMC 4DV2T 1IZNB 4JEUB 3RRWA 5HWXA 2CEAA 5FYMA 2QGSA 4CN1A 4L0RA 4UF0B 1WRDA 4YXDA 5LGTB 3SRZA 2VQFT 5TAOA 5AQKB 4KHZF 4HEAA 3GA8A 3IBPA 3PURA 3P4SA 3NKZA 3I9WA 3UQ4A 3I0OA 2IC9A 2V6YB 5EK2A 2EHOB 2OV9A 4AQFA 5LJMA 1NWMX 2E5VA 2IUBA 5LJNA 2LHRA 4LF7T 2WU5A 4DR7T 3CX7B 4CXYA 4DV0T 5AQNB 3AE2A 4U2YA 1Y01A 3AE8A 2CM0A 2KMFA 4MFRA 4JI1T 1V9DA 2BG9E 5HXSA 2YKSA 1YQ4A 1XMOT 2V7KA 3JAEA 4ZI7E 4PFPA 2W66A 2H89A 2QA7A 4UV9B 4DV7T 3V5UA 5F5WA 3KFWX 4AKLA 1KK7A 3UUMA 3HKEE 2BVLA 2ZLYA 4ZS3A 3RIUC 4DUZT 4K0KT 2B1EA 3B57A 1XDPA 1H7CA 2Y8DA 2K24A 3P50A 5AQMB 5HCMA 2X0LB 1T7SA 1ZV4X 3FHNA 4TWDA 4YFSA 4AQGA 4L5GA 4I50E 2WP9A 2BBJA 4P09A 2KZ7B 1I94T 3LK42 4IDNA 5J2UE 1XNRT 2C5IT 3PUVF 5L3FB 4O4JE 4CI1B 2CXDA 4UR9A 2C5KT 2EHOD 4ASKA 4X1KE 1S35A 3RGLA 3V5SA 2XSAA 5LXTE 4CN4A 2DWKA 3X1DA 2XM1A 2V7JA 4G2AA 3PUAA 4Z90A 4O8SA 3PU3A 5JQGE 3A7MA 5L3CB 4X65T 3C64A 4LFCT 2Q9QC 5JDFA 2N9DA 4X62T 2LOSA 2IHR1 4CXWA 4GOUA 3KV5A 2G0UA 4I55E 3NVOA 4QXCB 2HH7A 5LMNT 4C90A 1E2AA 1FEWA 1KNRA 4N78D 3VR9A 2XAHB 4A98A 2CBIA 2CMRA 2LRKA 4WZXA 1YD8G 3NZPA 2V8SV 2WWVA 4ANJA 3FBZA 2VURA 4IE7A 4UV8B 3AA1B 3DP7A 2AE9A 5GONE 2PBIA 1T72A 2PJQA 4DR1T 5L3GB 3ZPOA 3UU8A 3AE9A 5L2LA 4HWIB 3EUHA 3P4RA 5CA1E 5IYZE 4TZ4C 2VVNA 4DNDA 2H7VC 2RP4A 5LBMA 4PK5A 3C51A 2V6YA 3K3NA 4U33A 3RKOA 2E8IA 4Z8XA 3TLTA 4PAGA 3ZJ1A 2I59A 3AE1A 3PUQA 2DL1A 4O4HE 5EK3A 3H37A 1R8IA 4JEHB 1MMDA 2FBWA 3I9YA 3Q5EA 2XJ7A 4HFCA 2BVMA 4NUVA 3WI3A 2ZM6T 1MIYA 4EZHA 4GKKT 3JC6D 2WAUA 1UURA 2X66A 4GKJT 3AEDA 5AQGB 4JI3T 5AQQB 1W0AA 2DI4A 5JR9C 2SPCA 3MJXA 3FZKB 3RQUA 5CGMA 2D9DA 3O4XE 2HN1A 2XTLA 4CI2B 3ZT5A 2XASB 2K3WA 2JJ9A 2W4XA 3VR8A 5HXRA 4YSXA 4ILAA 4PW8A 5F8PA 4ZZCA 2KLQA 1W0BA 1WCRA 3QUJA 5C3JA 5JTGA 1HNXT 4XBFB 3ZC0A 3AAAB 3CKDA 4EEDA 3P4WA 3PJAA 2NTXA 2Q9QA 5LMUT 1ZEEA 1MNDA 2M67A 2V26A 3OJAA 5LNKA 1WYCA 3UQ7A 2VK9A 4U3CA 1MMNA 3FXEB 2IW5B 3N9LA 3A8YC 3P8CD 4MLKA 3DTOA 4TX5A 2ZMAA 5L3DB 3RIUA 3MACA 4EOZB 4ZEYA 1IBMT 3RHWA 1NENA 2VKJA 5JR9B 2W67A 2AXDS 2M6BA 2XQ3A 3SFDA 4BA9A 1HNWT 2W00A 3OBVE 2X9YA 4LMLA 1HS7A 4MHCA 5L47A 1KFYA 2CWOA 4TV8E 5L4HA 4ISSA 5AQRB 1IJ5A 4EXTA 3O9XA 4DR4T 3HKCE 3DJBA 2LOPA 3PE0A 2CLYB 5JRCA 2L3LA 4J2CA 2LKGA 4WNKA 3CIRA 5AQSB 4IT4A 5KMGP 2XQAA 1WR6A 2LHNA 2XAJB 4OYJA 5LHHB 2WWUA 4GIWA 4IDOA 2XAQB 1KNPA 2NP9A 4WBOA 4TNWA 5HAXA 2H3RA 1MIWA 3MA9A 3ANWA 5AQLB 3HKBE 4WBNE 5LOVE 2V7MA 3UU5A 5FY7A 5ADXL 5ABEA 3KDSE 4I43B 2LJLA 3W15B 2K48A 1T98A 1ZOYA 2WB5A 2YDQA 3AEGA 2LM2A 1SUMB 4TV9E 3H3MA 5C2TA 3E08A 3PTRB 2UXNB 5FL0A 3QC9A 2YN6A 3TLSA 4IE4A 2CRBA 2YDRA 3JAFA 3QOFA 5LA6E 3PUXF 3JC6C 5FVLA 3TKLB 5KXJA 2V1DB 3K3OA 4B3MT 1DU2A 2L8KA 3RLFF 5L4EA 3N9OA 4AISA 3SS1A 3AE6A 2W63A 2IAKA 4O4LE 2CXLA 4QWNB 5HXEA 2OLTA 4HWHA 4JLEA 1BR4A 5IHYA 5JDHA 2IDOB 2PTFA 1KNZA 2JMHA 4JI0T
chains in the Genus database with same CATH topology
4HWIB 5AQNB 3FZLB 5AQOB 3M3ZB 4HWCA 5AQIB 5AQFB 3FZMB 5AQHB 1UK5A 5AQPB 5AQLB 1I6ZA 1UGOA 4HWFA 5AQJB 1M62A 3A8YC 5AQUB 1M7KA 4HWDA 5AQGB 5AQQB 5AQMB 1T7SA 5AQKB 3FZKB 2D9DA 3LDQB 5AQRB 1HX1B 5AQVB 4HWHA 3FZHB 5AQTB 3FZFB 5AQSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWI B;  5AQN B;  3FZL B;  5AQO B;  3M3Z B;  4HWC A;  5AQI B;  5AQF B;  3FZM B;  5AQH B;  1UK5 A;  5AQP B;  5AQL B;  1I6Z A;  1UGO A;  4HWF A;  5AQJ B;  1M62 A;  3A8Y C;  5AQU B;  1M7K A;  4HWD A;  5AQG B;  5AQQ B;  5AQM B;  1T7S A;  5AQK B;  3FZK B;  2D9D A;  3LDQ B;  5AQR B;  1HX1 B;  5AQV B;  4HWH A;  3FZH B;  5AQT B;  3FZF B;  5AQS B; 
#chains in the Genus database with same CATH topology
 5JVD E;  4LFB T;  2X51 A;  4P0A A;  3I1A A;  4ZI3 D;  4I0U A;  1HCI A;  1MMA A;  2CBJ A;  2CWY A;  4AQY T;  2CE7 A;  2XM2 A;  5AQI B;  4EV6 A;  5JDL A;  2J4G A;  2WS3 A;  2LRL A;  3RF1 A;  4ILC A;  4TUY E;  3MZK B;  3E0Z A;  4HWF A;  2PG8 A;  2DHR A;  3IA3 A;  3ZMS B;  4U7Y A;  4ZZB A;  4HFV A;  3NBX X;  2V7I A;  2V5C A;  3AAI A;  2C0S A;  1D1A A;  4UEM A;  3AB3 B;  4X1I E;  3C4Z A;  3LBX A;  1LRZ A;  4H9N C;  3GMI A;  4JBW F;  4EYY R;  5JDN A;  4PJJ A;  4DV3 T;  5LGN B;  1IBK T;  4AI6 A;  3K8P C;  2BG9 A;  3MXZ A;  4HE8 A;  4HFB A;  4EGW A;  4WW0 A;  1HNZ T;  2CA5 A;  3ZC1 A;  3CQG B;  2UUA T;  2KWI B;  2MAW A;  1GQE A;  3EAB A;  3KV6 A;  5EZY E;  1S94 A;  2WDR A;  2BDE A;  5L3E B;  4IGU A;  5CA0 E;  4X1Y E;  5J1G A;  5LYJ E;  3EHZ A;  3P7I A;  4EZ4 A;  2BG9 B;  2BZB A;  3VKG A;  1OED A;  1KEY A;  2GK9 A;  2JRK A;  2WM9 A;  3AVR A;  3EDV A;  5HEU A;  3RPU A;  1LVF A;  2XY8 B;  3NRY A;  2XQY A;  1UX5 A;  2R6G F;  3N2O A;  2WU2 A;  3EAM A;  5FNV E;  2ACX A;  5HEH A;  3ZYM A;  2NW7 A;  3C4X A;  5HXC A;  2CPT A;  1W09 A;  3ZMT B;  2IC6 A;  4QH1 A;  5AQU B;  3VRA A;  4YTM A;  4X20 E;  2F4V T;  1U4Q A;  3HA4 A;  4B3R T;  4DBQ A;  3AA6 B;  3PUG A;  3Q5W A;  4U31 A;  3AEF A;  1WFD A;  4DID B;  4AXP A;  2HN2 A;  2VKD A;  2V7L A;  3ZMZ B;  4CI3 B;  3IEE A;  2XQ9 A;  4NIQ A;  3TLW A;  5AFU L;  1XDO A;  2UU9 T;  4KHP T;  3OYX A;  2C5J A;  3ZSS A;  3UUN A;  2UXC T;  4ERR A;  4TN7 B;  5ABH A;  5ABF B;  2BKO A;  5H6R B;  4JI8 T;  3ANW B;  2BS2 A;  2X68 A;  3N5L A;  2QVA A;  3N9Q A;  4ILB A;  2IML A;  4LMJ A;  5LG3 A;  3ZT7 A;  4DR5 T;  3QNU A;  4LF4 T;  4ILU A;  3CK6 A;  4CQI A;  3F57 A;  1QLB A;  1FMW A;  2MBG A;  2E9X D;  3GWH A;  4DV1 T;  4HFH A;  1L0V A;  1D1B A;  2WZI A;  5J0Z A;  4QX7 B;  2KIN B;  3NRX A;  2VWA A;  4IHJ E;  4LMK A;  3J9X 1;  3U3I A;  2EHO A;  3KIN B;  2A72 A;  2JIW A;  5FXW A;  3RKG A;  4YY3 T;  1FMV A;  2E9X C;  3C98 B;  4DUY T;  4UF0 A;  1SE7 A;  2KXP B;  1N32 T;  3N9P A;  4QH5 A;  2Z6E A;  3AA7 B;  4KI0 F;  1MIV A;  3KBT A;  4IL4 A;  2UUC T;  3AAE B;  3AEB A;  4YTP A;  3F2E A;  4DV5 T;  3ZCI A;  3T1H T;  2XQ4 A;  5CJ5 A;  4XAX B;  5C8Y E;  1JNZ A;  4YJ3 E;  2LSY A;  2XQ6 A;  4IE5 A;  3HKD E;  2LEH A;  2YOE A;  4YLH A;  2HHH T;  2VKO A;  4JI7 T;  1UK5 A;  1J5W A;  4LF9 T;  4JYA T;  1AJ3 A;  4I4T E;  4JI2 T;  1I6Z A;  2D2S A;  3PUS A;  3N2G E;  2XZE A;  5JDM A;  2NTY A;  4IE6 A;  3J7Y q;  4JV5 T;  1OXZ A;  5JDQ A;  4AKH A;  2CLY C;  3LBX B;  4KUM B;  3AXJ A;  3OVU A;  4GYR A;  3KBU A;  2WMN A;  2YU1 A;  3PUY F;  4GYS A;  4PJM A;  1EZ3 A;  3VU7 H;  4CXX A;  4DV6 T;  3TLU A;  2HPL A;  4YSY A;  3ETU A;  5HYA A;  3WAJ A;  4JI4 T;  3RC8 A;  1X9B A;  4HTE A;  1T8B A;  3ONJ A;  3LK3 B;  1B7T A;  5J2T E;  4ZOL E;  3ETV A;  3RC3 A;  1BR1 A;  4DO0 A;  1N33 T;  2FJD A;  3K3Q C;  2WQY A;  3R84 B;  2A9U A;  3WAK A;  2N1G A;  4H9R C;  3AXJ B;  4U7I A;  4U2Z A;  2FUP A;  3UUL A;  3EVY A;  5FY1 A;  2N2N A;  1FIO A;  2WSS V;  3OYZ A;  3UU3 A;  3ZKR A;  4IRE A;  4DVD A;  2ODU A;  2XHE B;  3FZL B;  4H9Q C;  1HTJ F;  3UFE A;  4H63 V;  4H9P C;  5LB7 B;  4EAH A;  4AQF C;  4ZHQ E;  3B5M A;  1VCT A;  2W0G A;  1D1C A;  3ZCJ A;  2KSR A;  3ZYK A;  3UT5 E;  2E9X A;  3N9N A;  2JPF A;  4LFA T;  3K1S A;  5AQJ B;  4CN6 A;  4NXM T;  2BS4 A;  1E1H B;  3T8O A;  1M7K A;  1NAF A;  3C4W A;  3IF8 B;  5FXV A;  3JAD A;  2VKH A;  1MMG A;  1VCS A;  2LM9 A;  4IDZ A;  5FVK A;  4NUU A;  4YSZ A;  5FL1 A;  2A3D A;  1SHZ C;  2XQ8 A;  2ZM0 A;  1G8X A;  2J47 A;  1QUU A;  2LT3 A;  2Y48 B;  4HFI A;  4TWF A;  3N9M A;  2HPJ A;  3UU6 A;  4IIJ E;  3ZMU B;  4AKG A;  3CPZ A;  4E7S A;  4OX9 T;  3LSV A;  5FXZ A;  2WCA A;  5F3J A;  3RYH E;  3CX8 B;  4LF8 T;  4LF5 T;  4L9I A;  4DR6 T;  2BKP A;  4LF6 T;  1YKH B;  2W62 A;  2X0Y A;  2KT9 A;  3SOL A;  5CB4 E;  2X67 A;  3G06 A;  4DR2 T;  4COF A;  2I6H A;  2YEV C;  1YQ3 A;  2M6I A;  2X9X A;  1HF8 A;  4IDQ A;  4OFZ A;  3VRB A;  3SFE A;  5BMV E;  1WYB A;  5L3B B;  1HR0 T;  2H88 A;  3VKH A;  3LJC A;  2ODV A;  3BK9 A;  5JH7 E;  2QRX A;  4IE0 A;  2UXD T;  5DQW A;  3RYF E;  4HKA A;  1M62 A;  2JMK A;  1LVK A;  4YHH T;  3MK7 C;  5KX5 E;  3ABV A;  2OA5 A;  2J1D G;  2XSB A;  4UVC B;  5CFB A;  5JRE A;  3OTO T;  4CZZ B;  3O1I A;  2KWH A;  5EK4 A;  3T1Y T;  2IIU A;  3AE5 A;  1X79 A;  3AE7 A;  4BJN A;  4WYV A;  1Z8U A;  2JQH A;  3GN5 B;  4IDP A;  4O2B E;  4P1N A;  4HGA A;  3CX6 B;  3GN5 A;  3IHR A;  4KBM B;  5LBQ B;  3S4U A;  4A97 A;  3NZQ A;  2WDV A;  3Q5X A;  3ZST A;  4JUY A;  4HFE A;  4HWC A;  2DCF A;  4OHF A;  3EDU A;  3ONX A;  3P4P A;  3CQC B;  1WR0 A;  2CCQ A;  2UXX B;  5E0O A;  5FXX A;  3KVA A;  2B76 A;  5LHI B;  4QXB B;  3ZEF B;  1ZHC A;  2CHO A;  3H3A A;  4YT0 A;  4KP3 C;  2NR4 A;  2ZM2 A;  2KND A;  2BG9 C;  5ABG A;  3JCF A;  4DV4 T;  1N36 T;  3ZT6 A;  2X0H A;  2V5D A;  1W9R A;  4IST A;  4H9O C;  4K0U A;  4X5T A;  4EEB A;  3RIF A;  1IAP A;  2DNX A;  4G63 A;  1XNQ T;  3RI5 A;  4NXN T;  4MBQ A;  3HR0 A;  4HWD A;  3UTK A;  2DWG A;  4YTN A;  2WBL A;  2W2U A;  3RIA A;  3B13 A;  4X64 T;  2ACZ A;  2I0M A;  4ZI3 C;  2YU2 A;  1U5P A;  4U72 A;  4EIW A;  4O2A E;  4PK6 A;  4B3S T;  3L8R A;  2XQ7 A;  4Z91 A;  1HX1 B;  4BJM A;  2BBH A;  2BS3 A;  3P4Q A;  3OKQ A;  5JR9 A;  1HG5 A;  2JQQ A;  3CWZ B;  5H6Q B;  3ZN1 B;  2WMO A;  4F6R C;  2UXB T;  2VL8 A;  3FZF B;  4GK0 E;  4H63 H;  2WDQ A;  3I0Q A;  3KV9 A;  5AQO B;  3UUB A;  3ESL A;  4EB6 E;  3O1J A;  3ZN0 B;  4E7Z A;  1YKE B;  3HL6 A;  4A5X A;  5JRC B;  3AVS A;  4QHO A;  5HCJ A;  5HEO A;  1XMQ T;  3E22 E;  3FZM B;  3QB5 A;  1WLX A;  5DAB A;  3FXD B;  3SWH A;  2K5B B;  1FJG T;  1MNE A;  3F31 A;  4OK0 A;  2D0T A;  1Z0P A;  2D0U A;  2E2A A;  2J62 A;  2YIN A;  1JNR A;  2BKN A;  4C91 A;  4XZC A;  3PU8 A;  4ZS2 A;  5LHG B;  2NW9 A;  3PJA J;  1YXR A;  2XUE A;  2VVS A;  4M1P A;  4B6X A;  4NPP A;  3LK2 B;  3Q9D A;  2VAS A;  3FB2 A;  4HFD A;  4V1A v;  3ZMV B;  1HX8 A;  4JI6 T;  2ES0 A;  3HI2 A;  4AKR B;  2P9B A;  2Y6X A;  1ZKE A;  3BQI A;  4F8H A;  1UCU A;  4P0B A;  1ZP0 A;  2L9Q A;  3CQX C;  2H7O A;  1HFA A;  3PUW F;  1LKX A;  4FJO A;  3KV4 A;  3QB5 K;  3U78 A;  2YDS A;  3FZH B;  1YW0 A;  3ONL C;  3PV0 F;  5AQT B;  4EYU A;  3R6N A;  2VL0 A;  4TNV A;  2FJE A;  2A2F X;  4UEL A;  3AEA A;  2NWB A;  5DJQ C;  5ABF A;  4AIU A;  4JI5 T;  1KF6 A;  4X66 T;  3AEC A;  4U74 A;  2EHO C;  5LGU B;  5AQP B;  5HEJ A;  4DMV A;  2K9A A;  4ADZ A;  1IBL T;  1OED E;  1US7 B;  2JQK A;  3AE4 A;  3RQW A;  1BR2 A;  3OPC A;  2V6X A;  3PDY A;  1CHU A;  3N2K E;  4YHJ A;  2VQE T;  2Q9Q D;  1O3X A;  4MAL A;  2FJB A;  4PK4 A;  5LCY A;  3UU4 A;  3ZJ2 A;  5HEG A;  4A56 A;  1D0Z A;  1HG2 A;  3AEE A;  3CML A;  3O1H A;  1J5E T;  1VOM A;  4B3T T;  3L39 A;  2CHN A;  3AE3 A;  3L09 A;  2MYS A;  3RX6 A;  3LDQ B;  3ZLI A;  5FKY A;  2LSJ A;  2X9H A;  5LG4 A;  4Q25 A;  3FBL A;  3UUX B;  1OED B;  2XPK A;  4DMW A;  4ZI2 C;  2WY2 A;  3D0T A;  5JDG A;  5IWA T;  2VB6 A;  1OWA A;  4QX8 B;  3RYI E;  4O4I E;  1BR0 A;  2W61 A;  2XAF B;  2UUB T;  3BQK A;  1CUN A;  3LG7 A;  2LSK A;  4PNI A;  3C50 A;  1XWM A;  4QXH B;  1SA0 E;  3RRC A;  4BAY B;  2XQ5 A;  5IUX A;  4QH4 A;  5LP6 E;  2QYW A;  3MKD A;  3BQL A;  4ZI2 D;  5A1L A;  5AQF B;  2YK0 A;  2PFV A;  2RPA A;  3A5X A;  5HXH A;  5DQV A;  5BR8 T;  2E5L T;  1UGO A;  2NW8 A;  3RH3 A;  4YJ2 E;  5FP3 A;  4KX6 A;  1OED C;  3AA0 B;  5FY0 A;  4UIG A;  3PUZ F;  4DR3 T;  4UVA B;  3Q5D A;  4IL9 A;  2E9X B;  2MTQ A;  3TLV A;  1UX4 A;  2Q9Q B;  1Y64 B;  1J1J A;  2FJA A;  3EI0 A;  5M4Y A;  1N34 T;  3L3P A;  4GK5 E;  3KVB A;  4PFO A;  1D0X A;  2WZH A;  2D5U A;  1VRB A;  2LE8 A;  2MPK A;  5ETW A;  5AQV B;  3Q2M A;  4KMC A;  4QKN A;  4TWH A;  4PJL A;  3VHL A;  4AKI A;  3QK6 A;  2ZM8 A;  4FI5 A;  1E7P A;  1G73 A;  3NWI A;  2X9W A;  4H9S E;  5FMN A;  3M3Z B;  4DBR A;  4OYK A;  2NOX A;  3ZYL A;  3UFG A;  1IJ6 A;  4ZXL A;  2DLR A;  5AQH B;  1XZY A;  3CVR A;  4HN9 A;  1NEK A;  2JQ9 A;  3RYC E;  1QSD A;  1D0Y A;  2CXF A;  2LSI A;  3LFM A;  3M65 A;  4PJN A;  2LLY A;  2XAG B;  5HWY A;  4UVB B;  2LKH A;  2MOZ A;  1UUS A;  2LSG A;  4UXN B;  2RA1 A;  5KDM C;  4DV2 T;  1IZN B;  4JEU B;  3RRW A;  5HWX A;  2CEA A;  5FYM A;  2QGS A;  4CN1 A;  4L0R A;  4UF0 B;  1WRD A;  4YXD A;  5LGT B;  3SRZ A;  2VQF T;  5TAO A;  5AQK B;  4KHZ F;  4HEA A;  3GA8 A;  3IBP A;  3PUR A;  3P4S A;  3NKZ A;  3I9W A;  3UQ4 A;  3I0O A;  2IC9 A;  2V6Y B;  5EK2 A;  2EHO B;  2OV9 A;  4AQF A;  5LJM A;  1NWM X;  2E5V A;  2IUB A;  5LJN A;  2LHR A;  4LF7 T;  2WU5 A;  4DR7 T;  3CX7 B;  4CXY A;  4DV0 T;  5AQN B;  3AE2 A;  4U2Y A;  1Y01 A;  3AE8 A;  2CM0 A;  2KMF A;  4MFR A;  4JI1 T;  1V9D A;  2BG9 E;  5HXS A;  2YKS A;  1YQ4 A;  1XMO T;  2V7K A;  3JAE A;  4ZI7 E;  4PFP A;  2W66 A;  2H89 A;  2QA7 A;  4UV9 B;  4DV7 T;  3V5U A;  5F5W A;  3KFW X;  4AKL A;  1KK7 A;  3UUM A;  3HKE E;  2BVL A;  2ZLY A;  4ZS3 A;  3RIU C;  4DUZ T;  4K0K T;  2B1E A;  3B57 A;  1XDP A;  1H7C A;  2Y8D A;  2K24 A;  3P50 A;  5AQM B;  5HCM A;  2X0L B;  1T7S A;  1ZV4 X;  3FHN A;  4TWD A;  4YFS A;  4AQG A;  4L5G A;  4I50 E;  2WP9 A;  2BBJ A;  4P09 A;  2KZ7 B;  1I94 T;  3LK4 2;  4IDN A;  5J2U E;  1XNR T;  2C5I T;  3PUV F;  5L3F B;  4O4J E;  4CI1 B;  2CXD A;  4UR9 A;  2C5K T;  2EHO D;  4ASK A;  4X1K E;  1S35 A;  3RGL A;  3V5S A;  2XSA A;  5LXT E;  4CN4 A;  2DWK A;  3X1D A;  2XM1 A;  2V7J A;  4G2A A;  3PUA A;  4Z90 A;  4O8S A;  3PU3 A;  5JQG E;  3A7M A;  5L3C B;  4X65 T;  3C64 A;  4LFC T;  2Q9Q C;  5JDF A;  2N9D A;  4X62 T;  2LOS A;  2IHR 1;  4CXW A;  4GOU A;  3KV5 A;  2G0U A;  4I55 E;  3NVO A;  4QXC B;  2HH7 A;  5LMN T;  4C90 A;  1E2A A;  1FEW A;  1KNR A;  4N78 D;  3VR9 A;  2XAH B;  4A98 A;  2CBI A;  2CMR A;  2LRK A;  4WZX A;  1YD8 G;  3NZP A;  2V8S V;  2WWV A;  4ANJ A;  3FBZ A;  2VUR A;  4IE7 A;  4UV8 B;  3AA1 B;  3DP7 A;  2AE9 A;  5GON E;  2PBI A;  1T72 A;  2PJQ A;  4DR1 T;  5L3G B;  3ZPO A;  3UU8 A;  3AE9 A;  5L2L A;  4HWI B;  3EUH A;  3P4R A;  5CA1 E;  5IYZ E;  4TZ4 C;  2VVN A;  4DND A;  2H7V C;  2RP4 A;  5LBM A;  4PK5 A;  3C51 A;  2V6Y A;  3K3N A;  4U33 A;  3RKO A;  2E8I A;  4Z8X A;  3TLT A;  4PAG A;  3ZJ1 A;  2I59 A;  3AE1 A;  3PUQ A;  2DL1 A;  4O4H E;  5EK3 A;  3H37 A;  1R8I A;  4JEH B;  1MMD A;  2FBW A;  3I9Y A;  3Q5E A;  2XJ7 A;  4HFC A;  2BVM A;  4NUV A;  3WI3 A;  2ZM6 T;  1MIY A;  4EZH A;  4GKK T;  3JC6 D;  2WAU A;  1UUR A;  2X66 A;  4GKJ T;  3AED A;  5AQG B;  4JI3 T;  5AQQ B;  1W0A A;  2DI4 A;  5JR9 C;  2SPC A;  3MJX A;  3FZK B;  3RQU A;  5CGM A;  2D9D A;  3O4X E;  2HN1 A;  2XTL A;  4CI2 B;  3ZT5 A;  2XAS B;  2K3W A;  2JJ9 A;  2W4X A;  3VR8 A;  5HXR A;  4YSX A;  4ILA A;  4PW8 A;  5F8P A;  4ZZC A;  2KLQ A;  1W0B A;  1WCR A;  3QUJ A;  5C3J A;  5JTG A;  1HNX T;  4XBF B;  3ZC0 A;  3AAA B;  3CKD A;  4EED A;  3P4W A;  3PJA A;  2NTX A;  2Q9Q A;  5LMU T;  1ZEE A;  1MND A;  2M67 A;  2V26 A;  3OJA A;  5LNK A;  1WYC A;  3UQ7 A;  2VK9 A;  4U3C A;  1MMN A;  3FXE B;  2IW5 B;  3N9L A;  3A8Y C;  3P8C D;  4MLK A;  3DTO A;  4TX5 A;  2ZMA A;  5L3D B;  3RIU A;  3MAC A;  4EOZ B;  4ZEY A;  1IBM T;  3RHW A;  1NEN A;  2VKJ A;  5JR9 B;  2W67 A;  2AXD S;  2M6B A;  2XQ3 A;  3SFD A;  4BA9 A;  1HNW T;  2W00 A;  3OBV E;  2X9Y A;  4LML A;  1HS7 A;  4MHC A;  5L47 A;  1KFY A;  2CWO A;  4TV8 E;  5L4H A;  4ISS A;  5AQR B;  1IJ5 A;  4EXT A;  3O9X A;  4DR4 T;  3HKC E;  3DJB A;  2LOP A;  3PE0 A;  2CLY B;  5JRC A;  2L3L A;  4J2C A;  2LKG A;  4WNK A;  3CIR A;  5AQS B;  4IT4 A;  5KMG P;  2XQA A;  1WR6 A;  2LHN A;  2XAJ B;  4OYJ A;  5LHH B;  2WWU A;  4GIW A;  4IDO A;  2XAQ B;  1KNP A;  2NP9 A;  4WBO A;  4TNW A;  5HAX A;  2H3R A;  1MIW A;  3MA9 A;  3ANW A;  5AQL B;  3HKB E;  4WBN E;  5LOV E;  2V7M A;  3UU5 A;  5FY7 A;  5ADX L;  5ABE A;  3KDS E;  4I43 B;  2LJL A;  3W15 B;  2K48 A;  1T98 A;  1ZOY A;  2WB5 A;  2YDQ A;  3AEG A;  2LM2 A;  1SUM B;  4TV9 E;  3H3M A;  5C2T A;  3E08 A;  3PTR B;  2UXN B;  5FL0 A;  3QC9 A;  2YN6 A;  3TLS A;  4IE4 A;  2CRB A;  2YDR A;  3JAF A;  3QOF A;  5LA6 E;  3PUX F;  3JC6 C;  5FVL A;  3TKL B;  5KXJ A;  2V1D B;  3K3O A;  4B3M T;  1DU2 A;  2L8K A;  3RLF F;  5L4E A;  3N9O A;  4AIS A;  3SS1 A;  3AE6 A;  2W63 A;  2IAK A;  4O4L E;  2CXL A;  4QWN B;  5HXE A;  2OLT A;  4HWH A;  4JLE A;  1BR4 A;  5IHY A;  5JDH A;  2IDO B;  2PTF A;  1KNZ A;  2JMH A;  4JI0 T; 
#chains in the Genus database with same CATH homology
 4HWI B;  5AQN B;  3FZL B;  5AQO B;  3M3Z B;  4HWC A;  5AQI B;  5AQF B;  3FZM B;  5AQH B;  1UK5 A;  5AQP B;  5AQL B;  1I6Z A;  1UGO A;  4HWF A;  5AQJ B;  1M62 A;  3A8Y C;  5AQU B;  1M7K A;  4HWD A;  5AQG B;  5AQQ B;  5AQM B;  1T7S A;  5AQK B;  3FZK B;  2D9D A;  3LDQ B;  5AQR B;  1HX1 B;  5AQV B;  4HWH A;  3FZH B;  5AQT B;  3FZF B;  5AQS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...