3FZMB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzmB00
5AQHB 3FZMB 5AQNB 4HWHA 4HWIB 1T7SA 5AQLB 4HWDA 5AQOB 5AQFB 3A8YC 3FZLB 1HX1B 5AQMB 5AQUB 4HWFA 3FZHB 1UGOA 5AQIB 3FZKB 5AQGB 3FZFB 5AQRB 3LDQB 1M7KA 5AQKB 5AQJB 5AQQB 1UK5A 5AQVB 2D9DA 4HWCA 5AQTB 5AQPB 5AQSB 1M62A 1I6ZA 3M3ZB
chains in the Genus database with same CATH superfamily
4IE7A 1D0ZA 3AE7A 1OEDE 4ERRA 2VQET 4CN4A 3RC3A 2LOPA 3EABA 1ZOYA 1IZNB 4QHOA 3F57A 4HN9A 5EK4A 3AE3A 4IL9A 3O4XE 4JEUB 2D0TA 1HNXT 5IHYA 4U2ZA 1KK7A 3VKGA 1QUUA 4DR5T 2KINB 1LRZA 3ZJ2A 4P0BA 4EYUA 2QVAA 3KV5A 3HA4A 2VWAA 3ANWA 3PDYA 3GMIA 2YU1A 3A8YC 4KHPT 3QC9A 5JRCA 1T8BA 3ZSTA 2XAQB 3UU6A 3T1YT 2YN6A 3RX6A 3CQGB 2Z6EA 3AEFA 2UXXB 4QH4A 3UUMA 5JREA 3ZKRA 5ABFA 5LJNA 4DV6T 4PJMA 4H9SE 2KSRA 1WFDA 1XDPA 3UUBA 2WU2A 3ANWB 4UR9A 5C8YE 5LG3A 4JBWF 2WSSV 4TNVA 1MNDA 4YSXA 4KHZF 2CWOA 4QXBB 4YTPA 5JRCB 3T1HT 5FXZA 2BKOA 2MOZA 2WZHA 3EUHA 4IIJE 5AQRB 3WAJA 1MMDA 4LFBT 5HAXA 3MJXA 3RYIE 3H37A 2ACXA 4MFRA 2J47A 1HG5A 4XAXB 4AKIA 2XASB 3AA6B 4JI6T 4CXXA 1HNWT 5ABFB 3KVBA 4IREA 2LHNA 3R6NA 1Z0PA 2JQ9A 4YY3T 5FNVE 3JADA 3WAKA 2VVNA 5ABEA 3BQKA 2BS4A 2XQ5A 5F5WA 1VRBA 3VRBA 3ZMSB 2CPTA 5HWYA 4KMCA 5FXWA 5M4YA 4AKRB 2EHOD 4HWHA 2W63A 2PBIA 5HXEA 2J1DG 2XAFB 4X5TA 2CLYB 4J2CA 1MIVA 3I1AA 4CN1A 4OYKA 4O4JE 2WWVA 4KX6A 2W00A 5AQHB 3IA3A 2Q9QC 2NW9A 5F3JA 5H6RB 4NPPA 2K3WA 2LJLA 5GONE 5JDNA 2F4VT 3ZYLA 4H63H 1D1BA 2YDRA 2QYWA 3JAFA 4ILCA 4YSYA 4DIDB 3P4RA 4IE6A 4IE0A 2E5LT 5LNKA 3RGLA 4UEMA 3FXEB 2FJBA 2WS3A 1N34T 1LKXA 1G73A 2KT9A 2LSJA 4K0UA 4P1NA 1FJGT 2M6BA 4A56A 4Z8XA 2ZM0A 1JNZA 4ZZBA 2MTQA 2WDVA 3UUNA 5AQTB 3P4PA 4GYSA 1D1AA 3RIFA 2LHRA 3TLUA 2ZM2A 4OK0A 3D0TA 4AI6A 2DCFA 1BR1A 4DR2T 4JI2T 4CI2B 2DWGA 5L3EB 3H3MA 1N36T 2J62A 2XAJB 1MMNA 3Q5XA 2G0UA 2MAWA 1FMWA 2X0HA 4MHCA 3LK3B 3QUJA 4YLHA 1UURA 1IBMT 3PUYF 1YW0A 3UQ4A 1WYCA 2WP9A 5HXSA 2DL1A 3C50A 2JIWA 2E9XD 4LMJA 4YJ2E 3N9NA 4P0AA 2UXNB 2H7OA 3ZMVB 5LHGB 5TAOA 2V7KA 5JTGA 3KV6A 3DP7A 3KV4A 4GK0E 2LM9A 5LJMA 3P50A 2I0MA 3RYCE 4TWFA 1FMVA 4WW0A 1LVKA 3RRCA 2L8KA 5HXCA 2DWKA 3HKCE 4CXYA 3S4UA 2AE9A 3N9QA 3SFEA 1CHUA 3FB2A 1DU2A 1M62A 3OYZA 2XQ6A 3UUXB 5CGMA 2N1GA 5FP3A 5LBMA 5L3DB 4JI8T 4H9NC 2X66A 3AEBA 2W2UA 2RA1A 4HEAA 3J7Yq 5FXVA 3E0ZA 1NENA 2BBJA 1D0YA 3RKGA 3LFMA 2LLYA 4CXWA 1VOMA 3DTOA 3AE8A 2L9QA 4JI4T 2V6YA 3QB5K 4AKHA 1HTJF 2CM0A 3MA9A 5L3BB 4A98A 1BR2A 4P09A 3RYFE 3I9WA 1HFAA 2DNXA 2H88A 5FKYA 3FXDB 4JI7T 3ZC1A 3ZSSA 2Y6XA 5AQLB 5LOVE 5AFUL 4A97A 5C3JA 2QGSA 3A5XA 2E5VA 2CWYA 1YKEB 2JQHA 1SA0E 1X79A 1L0VA 4EGWA 2JRKA 2NTXA 3RF1A 2XJ7A 2V6YB 2OLTA 5FVKA 4DUZT 2DLRA 1NWMX 5L3CB 5CA0E 5FVLA 2IMLA 3NZQA 1UX4A 2VL8A 2IC6A 4TN7B 3CX6B 2KMFA 2XPKA 3O9XA 3UU5A 5ABHA 2UUBT 3RIUA 3GN5A 4LF4T 2UXCT 3CWZB 2BBHA 4DMVA 3R84B 3UULA 3LK2B 3E22E 3JAEA 3OKQA 2YKSA 2X67A 5EK2A 1XMQT 2XTLA 3QK6A 4HWIB 1R8IA 2IUBA 2XUEA 3FBLA 4LF6T 4IDNA 3CMLA 4JV5T 3OTOT 2V6XA 4CQIA 4DR1T 3GN5B 5IYZE 5AQSB 3IBPA 3LK42 5L2LA 1AJ3A 3ZCJA 1OWAA 3PJAJ 5AQQB 3AXJA 1OXZA 4L0RA 4CI1B 4C90A 4AISA 3N9OA 4X64T 2XQ4A 3P4WA 3C51A 4MBQA 2X51A 2XY8B 4HFHA 4GOUA 4UF0A 3Q5WA 3NZPA 5J2TE 3AVSA 4U3CA 4PK4A 1D0XA 3KV9A 3N9MA 5DQVA 4EYYR 1NEKA 4O8SA 2BZBA 3AXJB 1HX1B 3V5SA 4NUUA 2C5KT 4LF5T 2WAUA 4B3MT 5CA1E 2LKGA 4JEHB 4DNDA 4DMWA 4UF0B 4GK5E 3ZCIA 5JQGE 4DR3T 3EI0A 2KZ7B 4HE8A 4M1PA 4F6RC 3ZT5A 2VKOA 2M6IA 2IIUA 2ACZA 4PK6A 2EHOA 2Q9QD 4KP3C 3EAMA 2PJQA 3P4SA 3JC6C 5LMNT 3GA8A 2LSGA 2NP9A 2WCAA 3OBVE 2BG9C 3MZKB 1M7KA 2OV9A 4U72A 3AA7B 2JPFA 3BQIA 5FYMA 3QOFA 4QKNA 4TX5A 2H3RA 5FMNA 1WR0A 4O4IE 3SFDA 3UQ7A 2WQYA 4YSZA 2L3LA 5CB4E 4DO0A 3ZT7A 4UVAB 1XZYA 2A2FX 3P4QA 3HKEE 2EHOB 2VURA 3TLTA 4UELA 4N78D 2ZLYA 4PFPA 2IHR1 1OEDC 2XM2A 1HX8A 3FZHB 4EV6A 2LE8A 3BK9A 2NOXA 3EDVA 1YD8G 4GKJT 4X1YE 4LF9T 4O2BE 4IDQA 4MLKA 3AE5A 1HG2A 3JCFA 3N2GE 3B13A 2JQQA 2XQ3A 1NAFA 2C5JA 3GWHA 3HL6A 3RIAA 2V5DA 2JQKA 2QRXA 3EDUA 2V7MA 2D9DA 5HCJA 4JI5T 3PU3A 2C5IT 5J2UE 5AQOB 3RQUA 4QWNB 1KNRA 4LMLA 2E9XA 3G06A 5J1GA 3T8OA 4IDZA 2XAHB 4I0UA 3X1DA 3AAEB 5KX5E 4AXPA 2JMKA 4DUYT 4IDOA 1IJ6A 2V5CA 1H7CA 2K24A 4YTMA 3RQWA 3KINB 3L3PA 2WB5A 3RPUA 2XZEA 4H9OC 1ZKEA 1U4QA 3L09A 4G63A 4HFCA 2OA5A 4AQGA 1VCSA 5JDQA 4Q25A 2E9XB 3CVRA 1IBLT 4AKLA 1BR4A 2CHNA 2XQ8A 3PUWF 2HN2A 5LGUB 2WMOA 1LVFA 4PFOA 3OVUA 4CZZB 2VKDA 2DHRA 1WYBA 3UFEA 4OYJA 2XM1A 4ZZCA 1X9BA 1N32T 2UUAT 1HF8A 3E08A 4IT4A 4JUYA 3HKBE 3ZLIA 2W4XA 3FZFB 2PG8A 3LDQB 1UK5A 3HI2A 4COFA 4YT0A 2IDOB 2LOSA 2NW7A 3HR0A 3N9PA 5HEOA 4LFAT 3TLVA 4U2YA 3AEDA 5E0OA 3IF8B 1J1JA 2A72A 2LSYA 3NBXX 4DBRA 3RLFF 2VL0A 3UU8A 4DV7T 1WLXA 2VVSA 2ODVA 3AECA 4YXDA 4UXNB 2P9BA 1BR0A 5LMUT 2MBGA 2VKHA 3PUZF 4CN6A 2YU2A 1FIOA 3MXZA 5LHIB 3SS1A 1ZEEA 4X66T 2FJDA 2K48A 2CHOA 4I4TE 5LBQB 3FZLB 4ISTA 5FY1A 1KNPA 4EZHA 1FEWA 2ODUA 3QNUA 4LMKA 3RC8A 2QA7A 4E7ZA 4KI0F 3FZMB 3LBXA 2WDRA 4YFSA 3ZPOA 3H3AA 2RP4A 2XQ7A 5L47A 4OX9T 3RYHE 1IAPA 4LF8T 2UUCT 3AVRA 3Q5EA 2RPAA 4DV3T 3EVYA 4WNKA 1I6ZA 3IEEA 4G2AA 2XHEB 4O4HE 3AEEA 4EEDA 1XWMA 3RI5A 5JDHA 5JVDE 2CRBA 4LFCT 4BJMA 2XQAA 2BKNA 3SOLA 1IBKT 2MYSA 3Q2MA 3CPZA 5C2TA 2CBIA 4EB6E 3PUAA 4KBMB 5FL1A 4TUYE 4ISSA 5LP6E 5HEJA 3PUGA 5HXRA 2D2SA 2WU5A 1W0AA 2JJ9A 2HPLA 2W61A 2A3DA 2LSIA 1E1HB 4ZXLA 3MK7C 4ZEYA 3PU8A 5AQGB 5FXXA 4HFBA 3ZC0A 3MKDA 3M3ZB 4Z90A 2W66A 1GQEA 5LCYA 3L8RA 3P8CD 5DJQC 4I50E 2HN1A 3AE9A 3U3IA 3AB3B 3SWHA 5KXJA 2HHHT 1MNEA 3ETUA 5LG4A 3RH3A 2HPJA 3O1JA 5AQFB 5EZYE 3JC6D 3AEAA 3BQLA 5L3FB 3KBUA 3CQCB 1KFYA 4QXHB 3L39A 2CXDA 2CLYC 4PNIA 1MIWA 2X9XA 3RKOA 2BDEA 4BAYB 2D5UA 4HWFA 4B3TT 2YOEA 4L5GA 2W67A 4TV9E 5CFBA 4TWDA 3UU4A 3ESLA 3HKDE 4ZI2C 3PE0A 3PTRB 2I6HA 5AQNB 3ZEFB 1WR6A 4WYVA 4HWDA 2WMNA 1SE7A 5ETWA 2CE7A 4FJOA 3ZN1B 2X9YA 2DI4A 4X1KE 2V7LA 4I55E 1XNQT 5LGTB 3U78A 4X1IE 5JDGA 3VKHA 4V1Av 4NIQA 3AA0B 3CX8B 3NRXA 2H89A 1WCRA 1IJ5A 3ETVA 3ZN0B 3ZYKA 1XNRT 3I0QA 4EEBA 5A1LA 2AXDS 1U5PA 5HEUA 1N33T 4F8HA 1W9RA 3N9LA 4QH5A 2W0GA 4NXNT 2YDSA 5DABA 2IW5B 3CK6A 5FY0A 5HEHA 3PUQA 3OPCA 4ZOLE 3O1IA 2UU9T 2WZIA 2BVLA 4KUMB 5KMGP 4DR4T 3TLSA 1YKHB 3PUSA 2PFVA 5KDMC 1QSDA 3PV0F 4YHHT 3TKLB 2V7IA 2N9DA 1J5ET 3NWIA 2NWBA 2YDQA 2N2NA 5EK3A 2LRLA 2C0SA 3A7MA 5HWXA 1CUNA 5L4EA 4ILBA 3CKDA 5FL0A 2WWUA 5ABGA 4YJ3E 4DR7T 4B3ST 3ONJA 4ZI3C 1O3XA 3J9X1 2V26A 3LSVA 3WI3A 4AQFA 3FBZA 2NTYA 2BVMA 1SHZC 1KNZA 2B76A 1Z8UA 3ZMZB 4UV9B 3QB5A 2HH7A 4QX7B 5F8PA 5JR9A 4A5XA 4GYRA 4JLEA 3P7IA 1VCTA 1G8XA 2W62A 4U31A 3C4XA 2FBWA 5AQPB 4DV5T 4B3RT 5IWAT 1WRDA 1JNRA 3C4ZA 2Y8DA 2D0UA 3C4WA 3UU3A 2XQ9A 3AA1B 3VR8A 4IL4A 3AAAB 4H9QC 2YEVC 4MALA 5HXHA 4H63V 2LSKA 5JR9B 1HS7A 1YQ3A 2V8SV 4K0KT 4HFDA 3I9YA 3K3NA 4BJNA 3B57A 2KXPB 2LRKA 4U7IA 2ZM6T 2NW8A 2WY2A 2UXBT 4E7SA 1V9DA 4AKGA 3C64A 1MMAA 2XAGB 4AQYT 1I94T 2CEAA 2XQYA 4PAGA 2VASA 4H9PC 1Y01A 5L4HA 3RIUC 2B1EA 4ILUA 3W15B 4HTEA 3PUVF 4L9IA 4AIUA 4FI5A 4X65T 5J0ZA 5AQMB 2I59A 2IC9A 3Q9DA 5BR8T 3IHRA 4IHJE 4UIGA 3UTKA 4ZI7E 2GK9A 3N2KE 2J4GA 2ZMAA 1MIYA 4OHFA 2LT3A 3CX7B 5H6QB 2KWHA 4B6XA 2KLQA 5HCMA 1ZV4X 1HNZT 3V5UA 2E8IA 2BKPA 2CA5A 4U7YA 3AE6A 3KDSE 1HCIA 3MACA 4O4LE 1KF6A 2SPCA 3RHWA 1W09A 3M65A 3OJAA 4EAHA 3VHLA 4ZS2A 3AEGA 3ZMTB 2H7VC 1UX5A 3K8PC 4QH1A 1ZHCA 4X20E 2LEHA 3ZYMA 1YXRA 4PJJA 4XBFB 3ZMUB 5AQIB 1T72A 3EHZA 4QXCB 4DR6T 4UV8B 5LYJE 3K3OA 2CXLA 3PUXF 4WZXA 4HFEA 2YINA 1US7B 3Q5DA 2ZM8A 2VK9A 3KVAA 5LHHB 3CQXC 2V1DB 3LJCA 3K3QC 4IE5A 2LM2A 3VRAA 2BG9A 1SUMB 4HWCA 4XZCA 4GIWA 4IGUA 1KEYA 4U33A 4ZI2D 2UXDT 2K9AA 4DV2T 5LGNB 3FHNA 5BMVE 2CXFA 3F31A 3AAIA 3N2OA 2XSBA 4NXMT 3LBXB 1E7PA 2EHOC 2E2AA 4HFVA 3CIRA 1T7SA 2BG9B 1OEDA 3AE1A 3KBTA 2LKHA 4C91A 4ZHQE 3ZJ1A 4JI0T 4GKKT 3TLWA 1XMOT 3PURA 4AQFC 2FJEA 3ZT6A 2VQFT 3PJAA 4DBQA 4EXTA 5FY7A 4H9RC 4U74A 2WM9A 4HKAA 4HGAA 4QX8B 4LF7T 2NR4A 3NRYA 3ONLC 1OEDB 4TWHA 4DV0T 4O2AE 5JR9C 4EZ4A 2CMRA 3AE4A 2XSAA 3LG7A 4EIWA 2MPKA 1YQ4A 4Z91A 2CBJA 2BS2A 4UVBB 5AQKB 3ABVA 5LXTE 4WBNE 3NVOA 1EZ3A 3N5LA 1S35A 5CJ5A 4IDPA 3VR9A 2BS3A 1Y64B 1S94A 4DV4T 3SRZA 2X9HA 2KNDA 4WBOA 5HEGA 1J5WA 3FZKB 3VU7H 4TV8E 4PK5A 5AQVB 4PJNA 2IAKA 4CI3B 2V7JA 4BA9A 1D1CA 4DV1T 2ES0A 2Q9QA 4JYAT 4ZI3D 2FUPA 2E9XC 3B5MA 1UGOA 4ASKA 2R6GF 1B7TA 1UCUA 5L3GB 3F2EA 2PTFA 4OFZA 4YTNA 1E2AA 2VB6A 2X0YA 4TNWA 1ZP0A 4NUVA 4UVCB 2WBLA 5JDMA 5JDFA 5HYAA 4ANJA 5IUXA 2X68A 3I0OA 3NKZA 2X9WA 1QLBA 4PW8A 4DVDA 2VKJA 1T98A 1W0BA 2Q9QB 5JH7E 2A9UA 2FJAA 3RRWA 3ONXA 4PJLA 4ADZA 2Y48B 4HFIA 3C98B 2KWIB 2WDQA 3K1SA 5AQUB 2BG9E 5JDLA 3UFGA 3UT5E 4JI1T 2CCQA 3KFWX 4YHJA 1MMGA 5ADXL 2YK0A 2JMHA 5LB7B 3DJBA 2M67A 1HR0T 4EOZB 1UUSA 2K5BB 3AE2A 4X62T 3OYXA 4ILAA 5DQWA 5LA6E 4I43B 4ZS3A 4JI3T 5AQJB 1XDOA 4IE4A 4TZ4C 3O1HA 2X0LB
chains in the Genus database with same CATH topology
5AQHB 3FZMB 5AQNB 4HWHA 4HWIB 1T7SA 5AQLB 4HWDA 5AQOB 5AQFB 3A8YC 3FZLB 1HX1B 5AQMB 5AQUB 4HWFA 3FZHB 1UGOA 5AQIB 3FZKB 5AQGB 3FZFB 5AQRB 3LDQB 1M7KA 5AQKB 5AQJB 5AQQB 1UK5A 5AQVB 2D9DA 4HWCA 5AQTB 5AQPB 5AQSB 1M62A 1I6ZA 3M3ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQH B;  3FZM B;  5AQN B;  4HWH A;  4HWI B;  1T7S A;  5AQL B;  4HWD A;  5AQO B;  5AQF B;  3A8Y C;  3FZL B;  1HX1 B;  5AQM B;  5AQU B;  4HWF A;  3FZH B;  1UGO A;  5AQI B;  3FZK B;  5AQG B;  3FZF B;  5AQR B;  3LDQ B;  1M7K A;  5AQK B;  5AQJ B;  5AQQ B;  1UK5 A;  5AQV B;  2D9D A;  4HWC A;  5AQT B;  5AQP B;  5AQS B;  1M62 A;  1I6Z A;  3M3Z B; 
#chains in the Genus database with same CATH topology
 4IE7 A;  1D0Z A;  3AE7 A;  1OED E;  4ERR A;  2VQE T;  4CN4 A;  3RC3 A;  2LOP A;  3EAB A;  1ZOY A;  1IZN B;  4QHO A;  3F57 A;  4HN9 A;  5EK4 A;  3AE3 A;  4IL9 A;  3O4X E;  4JEU B;  2D0T A;  1HNX T;  5IHY A;  4U2Z A;  1KK7 A;  3VKG A;  1QUU A;  4DR5 T;  2KIN B;  1LRZ A;  3ZJ2 A;  4P0B A;  4EYU A;  2QVA A;  3KV5 A;  3HA4 A;  2VWA A;  3ANW A;  3PDY A;  3GMI A;  2YU1 A;  3A8Y C;  4KHP T;  3QC9 A;  5JRC A;  1T8B A;  3ZST A;  2XAQ B;  3UU6 A;  3T1Y T;  2YN6 A;  3RX6 A;  3CQG B;  2Z6E A;  3AEF A;  2UXX B;  4QH4 A;  3UUM A;  5JRE A;  3ZKR A;  5ABF A;  5LJN A;  4DV6 T;  4PJM A;  4H9S E;  2KSR A;  1WFD A;  1XDP A;  3UUB A;  2WU2 A;  3ANW B;  4UR9 A;  5C8Y E;  5LG3 A;  4JBW F;  2WSS V;  4TNV A;  1MND A;  4YSX A;  4KHZ F;  2CWO A;  4QXB B;  4YTP A;  5JRC B;  3T1H T;  5FXZ A;  2BKO A;  2MOZ A;  2WZH A;  3EUH A;  4IIJ E;  5AQR B;  3WAJ A;  1MMD A;  4LFB T;  5HAX A;  3MJX A;  3RYI E;  3H37 A;  2ACX A;  4MFR A;  2J47 A;  1HG5 A;  4XAX B;  4AKI A;  2XAS B;  3AA6 B;  4JI6 T;  4CXX A;  1HNW T;  5ABF B;  3KVB A;  4IRE A;  2LHN A;  3R6N A;  1Z0P A;  2JQ9 A;  4YY3 T;  5FNV E;  3JAD A;  3WAK A;  2VVN A;  5ABE A;  3BQK A;  2BS4 A;  2XQ5 A;  5F5W A;  1VRB A;  3VRB A;  3ZMS B;  2CPT A;  5HWY A;  4KMC A;  5FXW A;  5M4Y A;  4AKR B;  2EHO D;  4HWH A;  2W63 A;  2PBI A;  5HXE A;  2J1D G;  2XAF B;  4X5T A;  2CLY B;  4J2C A;  1MIV A;  3I1A A;  4CN1 A;  4OYK A;  4O4J E;  2WWV A;  4KX6 A;  2W00 A;  5AQH B;  3IA3 A;  2Q9Q C;  2NW9 A;  5F3J A;  5H6R B;  4NPP A;  2K3W A;  2LJL A;  5GON E;  5JDN A;  2F4V T;  3ZYL A;  4H63 H;  1D1B A;  2YDR A;  2QYW A;  3JAF A;  4ILC A;  4YSY A;  4DID B;  3P4R A;  4IE6 A;  4IE0 A;  2E5L T;  5LNK A;  3RGL A;  4UEM A;  3FXE B;  2FJB A;  2WS3 A;  1N34 T;  1LKX A;  1G73 A;  2KT9 A;  2LSJ A;  4K0U A;  4P1N A;  1FJG T;  2M6B A;  4A56 A;  4Z8X A;  2ZM0 A;  1JNZ A;  4ZZB A;  2MTQ A;  2WDV A;  3UUN A;  5AQT B;  3P4P A;  4GYS A;  1D1A A;  3RIF A;  2LHR A;  3TLU A;  2ZM2 A;  4OK0 A;  3D0T A;  4AI6 A;  2DCF A;  1BR1 A;  4DR2 T;  4JI2 T;  4CI2 B;  2DWG A;  5L3E B;  3H3M A;  1N36 T;  2J62 A;  2XAJ B;  1MMN A;  3Q5X A;  2G0U A;  2MAW A;  1FMW A;  2X0H A;  4MHC A;  3LK3 B;  3QUJ A;  4YLH A;  1UUR A;  1IBM T;  3PUY F;  1YW0 A;  3UQ4 A;  1WYC A;  2WP9 A;  5HXS A;  2DL1 A;  3C50 A;  2JIW A;  2E9X D;  4LMJ A;  4YJ2 E;  3N9N A;  4P0A A;  2UXN B;  2H7O A;  3ZMV B;  5LHG B;  5TAO A;  2V7K A;  5JTG A;  3KV6 A;  3DP7 A;  3KV4 A;  4GK0 E;  2LM9 A;  5LJM A;  3P50 A;  2I0M A;  3RYC E;  4TWF A;  1FMV A;  4WW0 A;  1LVK A;  3RRC A;  2L8K A;  5HXC A;  2DWK A;  3HKC E;  4CXY A;  3S4U A;  2AE9 A;  3N9Q A;  3SFE A;  1CHU A;  3FB2 A;  1DU2 A;  1M62 A;  3OYZ A;  2XQ6 A;  3UUX B;  5CGM A;  2N1G A;  5FP3 A;  5LBM A;  5L3D B;  4JI8 T;  4H9N C;  2X66 A;  3AEB A;  2W2U A;  2RA1 A;  4HEA A;  3J7Y q;  5FXV A;  3E0Z A;  1NEN A;  2BBJ A;  1D0Y A;  3RKG A;  3LFM A;  2LLY A;  4CXW A;  1VOM A;  3DTO A;  3AE8 A;  2L9Q A;  4JI4 T;  2V6Y A;  3QB5 K;  4AKH A;  1HTJ F;  2CM0 A;  3MA9 A;  5L3B B;  4A98 A;  1BR2 A;  4P09 A;  3RYF E;  3I9W A;  1HFA A;  2DNX A;  2H88 A;  5FKY A;  3FXD B;  4JI7 T;  3ZC1 A;  3ZSS A;  2Y6X A;  5AQL B;  5LOV E;  5AFU L;  4A97 A;  5C3J A;  2QGS A;  3A5X A;  2E5V A;  2CWY A;  1YKE B;  2JQH A;  1SA0 E;  1X79 A;  1L0V A;  4EGW A;  2JRK A;  2NTX A;  3RF1 A;  2XJ7 A;  2V6Y B;  2OLT A;  5FVK A;  4DUZ T;  2DLR A;  1NWM X;  5L3C B;  5CA0 E;  5FVL A;  2IML A;  3NZQ A;  1UX4 A;  2VL8 A;  2IC6 A;  4TN7 B;  3CX6 B;  2KMF A;  2XPK A;  3O9X A;  3UU5 A;  5ABH A;  2UUB T;  3RIU A;  3GN5 A;  4LF4 T;  2UXC T;  3CWZ B;  2BBH A;  4DMV A;  3R84 B;  3UUL A;  3LK2 B;  3E22 E;  3JAE A;  3OKQ A;  2YKS A;  2X67 A;  5EK2 A;  1XMQ T;  2XTL A;  3QK6 A;  4HWI B;  1R8I A;  2IUB A;  2XUE A;  3FBL A;  4LF6 T;  4IDN A;  3CML A;  4JV5 T;  3OTO T;  2V6X A;  4CQI A;  4DR1 T;  3GN5 B;  5IYZ E;  5AQS B;  3IBP A;  3LK4 2;  5L2L A;  1AJ3 A;  3ZCJ A;  1OWA A;  3PJA J;  5AQQ B;  3AXJ A;  1OXZ A;  4L0R A;  4CI1 B;  4C90 A;  4AIS A;  3N9O A;  4X64 T;  2XQ4 A;  3P4W A;  3C51 A;  4MBQ A;  2X51 A;  2XY8 B;  4HFH A;  4GOU A;  4UF0 A;  3Q5W A;  3NZP A;  5J2T E;  3AVS A;  4U3C A;  4PK4 A;  1D0X A;  3KV9 A;  3N9M A;  5DQV A;  4EYY R;  1NEK A;  4O8S A;  2BZB A;  3AXJ B;  1HX1 B;  3V5S A;  4NUU A;  2C5K T;  4LF5 T;  2WAU A;  4B3M T;  5CA1 E;  2LKG A;  4JEH B;  4DND A;  4DMW A;  4UF0 B;  4GK5 E;  3ZCI A;  5JQG E;  4DR3 T;  3EI0 A;  2KZ7 B;  4HE8 A;  4M1P A;  4F6R C;  3ZT5 A;  2VKO A;  2M6I A;  2IIU A;  2ACZ A;  4PK6 A;  2EHO A;  2Q9Q D;  4KP3 C;  3EAM A;  2PJQ A;  3P4S A;  3JC6 C;  5LMN T;  3GA8 A;  2LSG A;  2NP9 A;  2WCA A;  3OBV E;  2BG9 C;  3MZK B;  1M7K A;  2OV9 A;  4U72 A;  3AA7 B;  2JPF A;  3BQI A;  5FYM A;  3QOF A;  4QKN A;  4TX5 A;  2H3R A;  5FMN A;  1WR0 A;  4O4I E;  3SFD A;  3UQ7 A;  2WQY A;  4YSZ A;  2L3L A;  5CB4 E;  4DO0 A;  3ZT7 A;  4UVA B;  1XZY A;  2A2F X;  3P4Q A;  3HKE E;  2EHO B;  2VUR A;  3TLT A;  4UEL A;  4N78 D;  2ZLY A;  4PFP A;  2IHR 1;  1OED C;  2XM2 A;  1HX8 A;  3FZH B;  4EV6 A;  2LE8 A;  3BK9 A;  2NOX A;  3EDV A;  1YD8 G;  4GKJ T;  4X1Y E;  4LF9 T;  4O2B E;  4IDQ A;  4MLK A;  3AE5 A;  1HG2 A;  3JCF A;  3N2G E;  3B13 A;  2JQQ A;  2XQ3 A;  1NAF A;  2C5J A;  3GWH A;  3HL6 A;  3RIA A;  2V5D A;  2JQK A;  2QRX A;  3EDU A;  2V7M A;  2D9D A;  5HCJ A;  4JI5 T;  3PU3 A;  2C5I T;  5J2U E;  5AQO B;  3RQU A;  4QWN B;  1KNR A;  4LML A;  2E9X A;  3G06 A;  5J1G A;  3T8O A;  4IDZ A;  2XAH B;  4I0U A;  3X1D A;  3AAE B;  5KX5 E;  4AXP A;  2JMK A;  4DUY T;  4IDO A;  1IJ6 A;  2V5C A;  1H7C A;  2K24 A;  4YTM A;  3RQW A;  3KIN B;  3L3P A;  2WB5 A;  3RPU A;  2XZE A;  4H9O C;  1ZKE A;  1U4Q A;  3L09 A;  4G63 A;  4HFC A;  2OA5 A;  4AQG A;  1VCS A;  5JDQ A;  4Q25 A;  2E9X B;  3CVR A;  1IBL T;  4AKL A;  1BR4 A;  2CHN A;  2XQ8 A;  3PUW F;  2HN2 A;  5LGU B;  2WMO A;  1LVF A;  4PFO A;  3OVU A;  4CZZ B;  2VKD A;  2DHR A;  1WYB A;  3UFE A;  4OYJ A;  2XM1 A;  4ZZC A;  1X9B A;  1N32 T;  2UUA T;  1HF8 A;  3E08 A;  4IT4 A;  4JUY A;  3HKB E;  3ZLI A;  2W4X A;  3FZF B;  2PG8 A;  3LDQ B;  1UK5 A;  3HI2 A;  4COF A;  4YT0 A;  2IDO B;  2LOS A;  2NW7 A;  3HR0 A;  3N9P A;  5HEO A;  4LFA T;  3TLV A;  4U2Y A;  3AED A;  5E0O A;  3IF8 B;  1J1J A;  2A72 A;  2LSY A;  3NBX X;  4DBR A;  3RLF F;  2VL0 A;  3UU8 A;  4DV7 T;  1WLX A;  2VVS A;  2ODV A;  3AEC A;  4YXD A;  4UXN B;  2P9B A;  1BR0 A;  5LMU T;  2MBG A;  2VKH A;  3PUZ F;  4CN6 A;  2YU2 A;  1FIO A;  3MXZ A;  5LHI B;  3SS1 A;  1ZEE A;  4X66 T;  2FJD A;  2K48 A;  2CHO A;  4I4T E;  5LBQ B;  3FZL B;  4IST A;  5FY1 A;  1KNP A;  4EZH A;  1FEW A;  2ODU A;  3QNU A;  4LMK A;  3RC8 A;  2QA7 A;  4E7Z A;  4KI0 F;  3FZM B;  3LBX A;  2WDR A;  4YFS A;  3ZPO A;  3H3A A;  2RP4 A;  2XQ7 A;  5L47 A;  4OX9 T;  3RYH E;  1IAP A;  4LF8 T;  2UUC T;  3AVR A;  3Q5E A;  2RPA A;  4DV3 T;  3EVY A;  4WNK A;  1I6Z A;  3IEE A;  4G2A A;  2XHE B;  4O4H E;  3AEE A;  4EED A;  1XWM A;  3RI5 A;  5JDH A;  5JVD E;  2CRB A;  4LFC T;  4BJM A;  2XQA A;  2BKN A;  3SOL A;  1IBK T;  2MYS A;  3Q2M A;  3CPZ A;  5C2T A;  2CBI A;  4EB6 E;  3PUA A;  4KBM B;  5FL1 A;  4TUY E;  4ISS A;  5LP6 E;  5HEJ A;  3PUG A;  5HXR A;  2D2S A;  2WU5 A;  1W0A A;  2JJ9 A;  2HPL A;  2W61 A;  2A3D A;  2LSI A;  1E1H B;  4ZXL A;  3MK7 C;  4ZEY A;  3PU8 A;  5AQG B;  5FXX A;  4HFB A;  3ZC0 A;  3MKD A;  3M3Z B;  4Z90 A;  2W66 A;  1GQE A;  5LCY A;  3L8R A;  3P8C D;  5DJQ C;  4I50 E;  2HN1 A;  3AE9 A;  3U3I A;  3AB3 B;  3SWH A;  5KXJ A;  2HHH T;  1MNE A;  3ETU A;  5LG4 A;  3RH3 A;  2HPJ A;  3O1J A;  5AQF B;  5EZY E;  3JC6 D;  3AEA A;  3BQL A;  5L3F B;  3KBU A;  3CQC B;  1KFY A;  4QXH B;  3L39 A;  2CXD A;  2CLY C;  4PNI A;  1MIW A;  2X9X A;  3RKO A;  2BDE A;  4BAY B;  2D5U A;  4HWF A;  4B3T T;  2YOE A;  4L5G A;  2W67 A;  4TV9 E;  5CFB A;  4TWD A;  3UU4 A;  3ESL A;  3HKD E;  4ZI2 C;  3PE0 A;  3PTR B;  2I6H A;  5AQN B;  3ZEF B;  1WR6 A;  4WYV A;  4HWD A;  2WMN A;  1SE7 A;  5ETW A;  2CE7 A;  4FJO A;  3ZN1 B;  2X9Y A;  2DI4 A;  4X1K E;  2V7L A;  4I55 E;  1XNQ T;  5LGT B;  3U78 A;  4X1I E;  5JDG A;  3VKH A;  4V1A v;  4NIQ A;  3AA0 B;  3CX8 B;  3NRX A;  2H89 A;  1WCR A;  1IJ5 A;  3ETV A;  3ZN0 B;  3ZYK A;  1XNR T;  3I0Q A;  4EEB A;  5A1L A;  2AXD S;  1U5P A;  5HEU A;  1N33 T;  4F8H A;  1W9R A;  3N9L A;  4QH5 A;  2W0G A;  4NXN T;  2YDS A;  5DAB A;  2IW5 B;  3CK6 A;  5FY0 A;  5HEH A;  3PUQ A;  3OPC A;  4ZOL E;  3O1I A;  2UU9 T;  2WZI A;  2BVL A;  4KUM B;  5KMG P;  4DR4 T;  3TLS A;  1YKH B;  3PUS A;  2PFV A;  5KDM C;  1QSD A;  3PV0 F;  4YHH T;  3TKL B;  2V7I A;  2N9D A;  1J5E T;  3NWI A;  2NWB A;  2YDQ A;  2N2N A;  5EK3 A;  2LRL A;  2C0S A;  3A7M A;  5HWX A;  1CUN A;  5L4E A;  4ILB A;  3CKD A;  5FL0 A;  2WWU A;  5ABG A;  4YJ3 E;  4DR7 T;  4B3S T;  3ONJ A;  4ZI3 C;  1O3X A;  3J9X 1;  2V26 A;  3LSV A;  3WI3 A;  4AQF A;  3FBZ A;  2NTY A;  2BVM A;  1SHZ C;  1KNZ A;  2B76 A;  1Z8U A;  3ZMZ B;  4UV9 B;  3QB5 A;  2HH7 A;  4QX7 B;  5F8P A;  5JR9 A;  4A5X A;  4GYR A;  4JLE A;  3P7I A;  1VCT A;  1G8X A;  2W62 A;  4U31 A;  3C4X A;  2FBW A;  5AQP B;  4DV5 T;  4B3R T;  5IWA T;  1WRD A;  1JNR A;  3C4Z A;  2Y8D A;  2D0U A;  3C4W A;  3UU3 A;  2XQ9 A;  3AA1 B;  3VR8 A;  4IL4 A;  3AAA B;  4H9Q C;  2YEV C;  4MAL A;  5HXH A;  4H63 V;  2LSK A;  5JR9 B;  1HS7 A;  1YQ3 A;  2V8S V;  4K0K T;  4HFD A;  3I9Y A;  3K3N A;  4BJN A;  3B57 A;  2KXP B;  2LRK A;  4U7I A;  2ZM6 T;  2NW8 A;  2WY2 A;  2UXB T;  4E7S A;  1V9D A;  4AKG A;  3C64 A;  1MMA A;  2XAG B;  4AQY T;  1I94 T;  2CEA A;  2XQY A;  4PAG A;  2VAS A;  4H9P C;  1Y01 A;  5L4H A;  3RIU C;  2B1E A;  4ILU A;  3W15 B;  4HTE A;  3PUV F;  4L9I A;  4AIU A;  4FI5 A;  4X65 T;  5J0Z A;  5AQM B;  2I59 A;  2IC9 A;  3Q9D A;  5BR8 T;  3IHR A;  4IHJ E;  4UIG A;  3UTK A;  4ZI7 E;  2GK9 A;  3N2K E;  2J4G A;  2ZMA A;  1MIY A;  4OHF A;  2LT3 A;  3CX7 B;  5H6Q B;  2KWH A;  4B6X A;  2KLQ A;  5HCM A;  1ZV4 X;  1HNZ T;  3V5U A;  2E8I A;  2BKP A;  2CA5 A;  4U7Y A;  3AE6 A;  3KDS E;  1HCI A;  3MAC A;  4O4L E;  1KF6 A;  2SPC A;  3RHW A;  1W09 A;  3M65 A;  3OJA A;  4EAH A;  3VHL A;  4ZS2 A;  3AEG A;  3ZMT B;  2H7V C;  1UX5 A;  3K8P C;  4QH1 A;  1ZHC A;  4X20 E;  2LEH A;  3ZYM A;  1YXR A;  4PJJ A;  4XBF B;  3ZMU B;  5AQI B;  1T72 A;  3EHZ A;  4QXC B;  4DR6 T;  4UV8 B;  5LYJ E;  3K3O A;  2CXL A;  3PUX F;  4WZX A;  4HFE A;  2YIN A;  1US7 B;  3Q5D A;  2ZM8 A;  2VK9 A;  3KVA A;  5LHH B;  3CQX C;  2V1D B;  3LJC A;  3K3Q C;  4IE5 A;  2LM2 A;  3VRA A;  2BG9 A;  1SUM B;  4HWC A;  4XZC A;  4GIW A;  4IGU A;  1KEY A;  4U33 A;  4ZI2 D;  2UXD T;  2K9A A;  4DV2 T;  5LGN B;  3FHN A;  5BMV E;  2CXF A;  3F31 A;  3AAI A;  3N2O A;  2XSB A;  4NXM T;  3LBX B;  1E7P A;  2EHO C;  2E2A A;  4HFV A;  3CIR A;  1T7S A;  2BG9 B;  1OED A;  3AE1 A;  3KBT A;  2LKH A;  4C91 A;  4ZHQ E;  3ZJ1 A;  4JI0 T;  4GKK T;  3TLW A;  1XMO T;  3PUR A;  4AQF C;  2FJE A;  3ZT6 A;  2VQF T;  3PJA A;  4DBQ A;  4EXT A;  5FY7 A;  4H9R C;  4U74 A;  2WM9 A;  4HKA A;  4HGA A;  4QX8 B;  4LF7 T;  2NR4 A;  3NRY A;  3ONL C;  1OED B;  4TWH A;  4DV0 T;  4O2A E;  5JR9 C;  4EZ4 A;  2CMR A;  3AE4 A;  2XSA A;  3LG7 A;  4EIW A;  2MPK A;  1YQ4 A;  4Z91 A;  2CBJ A;  2BS2 A;  4UVB B;  5AQK B;  3ABV A;  5LXT E;  4WBN E;  3NVO A;  1EZ3 A;  3N5L A;  1S35 A;  5CJ5 A;  4IDP A;  3VR9 A;  2BS3 A;  1Y64 B;  1S94 A;  4DV4 T;  3SRZ A;  2X9H A;  2KND A;  4WBO A;  5HEG A;  1J5W A;  3FZK B;  3VU7 H;  4TV8 E;  4PK5 A;  5AQV B;  4PJN A;  2IAK A;  4CI3 B;  2V7J A;  4BA9 A;  1D1C A;  4DV1 T;  2ES0 A;  2Q9Q A;  4JYA T;  4ZI3 D;  2FUP A;  2E9X C;  3B5M A;  1UGO A;  4ASK A;  2R6G F;  1B7T A;  1UCU A;  5L3G B;  3F2E A;  2PTF A;  4OFZ A;  4YTN A;  1E2A A;  2VB6 A;  2X0Y A;  4TNW A;  1ZP0 A;  4NUV A;  4UVC B;  2WBL A;  5JDM A;  5JDF A;  5HYA A;  4ANJ A;  5IUX A;  2X68 A;  3I0O A;  3NKZ A;  2X9W A;  1QLB A;  4PW8 A;  4DVD A;  2VKJ A;  1T98 A;  1W0B A;  2Q9Q B;  5JH7 E;  2A9U A;  2FJA A;  3RRW A;  3ONX A;  4PJL A;  4ADZ A;  2Y48 B;  4HFI A;  3C98 B;  2KWI B;  2WDQ A;  3K1S A;  5AQU B;  2BG9 E;  5JDL A;  3UFG A;  3UT5 E;  4JI1 T;  2CCQ A;  3KFW X;  4YHJ A;  1MMG A;  5ADX L;  2YK0 A;  2JMH A;  5LB7 B;  3DJB A;  2M67 A;  1HR0 T;  4EOZ B;  1UUS A;  2K5B B;  3AE2 A;  4X62 T;  3OYX A;  4ILA A;  5DQW A;  5LA6 E;  4I43 B;  4ZS3 A;  4JI3 T;  5AQJ B;  1XDO A;  4IE4 A;  4TZ4 C;  3O1H A;  2X0L B; 
#chains in the Genus database with same CATH homology
 5AQH B;  3FZM B;  5AQN B;  4HWH A;  4HWI B;  1T7S A;  5AQL B;  4HWD A;  5AQO B;  5AQF B;  3A8Y C;  3FZL B;  1HX1 B;  5AQM B;  5AQU B;  4HWF A;  3FZH B;  1UGO A;  5AQI B;  3FZK B;  5AQG B;  3FZF B;  5AQR B;  3LDQ B;  1M7K A;  5AQK B;  5AQJ B;  5AQQ B;  1UK5 A;  5AQV B;  2D9D A;  4HWC A;  5AQT B;  5AQP B;  5AQS B;  1M62 A;  1I6Z A;  3M3Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...