3FZMB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
111
structure length
111
Chain Sequence
b'GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzmB00
4HWCA 5AQNB 1M7KA 3A8YC 5AQHB 1M62A 3FZLB 3FZKB 3LDQB 5AQMB 5AQJB 4HWIB 5AQUB 4HWDA 5AQKB 1HX1B 5AQGB 5AQSB 3FZFB 4HWHA 4HWFA 3M3ZB 5AQRB 1UGOA 5AQQB 5AQIB 5AQLB 5AQOB 1UK5A 5AQVB 5AQTB 2D9DA 3FZMB 5AQFB 1I6ZA 1T7SA 5AQPB 3FZHB
chains in the Genus database with same CATH superfamily
3I9YA 3ZYLA 1W09A 1UCUA 5LJNA 3O1IA 3OYXA 5ABGA 2HPJA 2LT3A 2NTXA 3AEFA 4HFCA 2QGSA 5HWXA 2YKSA 1HNWT 4DV2T 5L3CB 4CN6A 2CMRA 3N2KE 4TX5A 1JNZA 3ANWB 3LK3B 3PUGA 3KV9A 4HWIB 2N9DA 4AKLA 4QH4A 1WYBA 1KNRA 3ZMVB 2M67A 3O1JA 3T1YT 3MZKB 1NWMX 4JEUB 2JQQA 4MLKA 3ZYKA 1MNEA 4I55E 3WAKA 2LSJA 5HCMA 3S4UA 3C50A 3UU8A 5H6QB 4WW0A 5FXWA 3EHZA 3P4QA 3PUVF 3OVUA 1KNPA 2ACXA 1X79A 3LBXB 2XASB 5LMUT 4IREA 2WDVA 1X9BA 1Z0PA 2K48A 4JI7T 3UUNA 4YSYA 2PFVA 5J0ZA 2Q9QA 5JRCA 1D1BA 5L3GB 3GN5B 3RX6A 3RC8A 2LM2A 2LRKA 4UVCB 3LK2B 2V7JA 2XQYA 2E9XC 1KK7A 4DR3T 5ADXL 1WRDA 4ZZBA 3TLUA 4JI5T 2XQ8A 3LDQB 3P8CD 1KF6A 3N2GE 3KINB 2CBIA 3CK6A 5AQRB 5CB4E 5JTGA 4HFIA 3PJAA 3P4WA 4H63V 3NRXA 4NXNT 4AQFC 3RIUC 2DCFA 2K3WA 4Q25A 3ONXA 1HTJF 2KINB 3ZKRA 1G73A 3FZLB 4CI2B 2RA1A 5TAOA 4EYYR 2YDSA 3AEEA 1OXZA 5LBMA 4ZEYA 5AQLB 2KWHA 4IE5A 1NENA 3N9QA 5C8YE 2X0LB 2LSKA 4DMVA 2X66A 4DV6T 3A8YC 3IF8B 2VL8A 4Z8XA 3I9WA 2VURA 3F57A 3SS1A 2WDQA 3RKGA 5CGMA 2QYWA 5LG4A 4B3ST 4NIQA 3FZMB 4YY3T 2I0MA 4QXBB 1MNDA 3CMLA 2X9WA 3KV4A 2YDRA 3W15B 3AA7B 1T72A 4FJOA 1LKXA 1WLXA 3MACA 2UU9T 4IDOA 1US7B 3VU7H 5LNKA 2OLTA 1SHZC 2ZM2A 5FY0A 3F31A 2I6HA 2LSIA 5JDFA 4IDNA 4I0UA 4CQIA 2V7LA 2UXDT 3B5MA 2XZEA 2CRBA 4ZI2C 1IAPA 4EZ4A 4PAGA 3CQGB 5FNVE 2XQ4A 4WZXA 5AQKB 5HEOA 4YTMA 1G8XA 2LEHA 5L47A 2V7KA 4ZS3A 5HCJA 2W62A 4CN1A 2WMOA 4QWNB 1N32T 2IAKA 2C5KT 3WI3A 3TLVA 4P0BA 4LFCT 3PUSA 3HR0A 1SA0E 2E2AA 3PU8A 4DIDB 1UK5A 4TZ4C 2UUAT 4JI4T 4MALA 4DNDA 4I4TE 3P50A 4IE0A 4YHHT 2BVLA 2ZLYA 4JI6T 4H9PC 3WAJA 4PJLA 4JLEA 2XJ7A 2ES0A 5GONE 4YSZA 2QA7A 2CLYB 2KMFA 3SRZA 2X51A 1ZOYA 2EHOD 4H9RC 2DI4A 2X68A 5FXXA 4HKAA 2PG8A 5JDNA 4EV6A 5HEJA 5AQUB 4O4LE 3K8PC 3ZLIA 4ZI3C 5C2TA 1T98A 2XAHB 4HEAA 3QB5K 3TLSA 3MK7C 2N1GA 5F8PA 4EYUA 3AECA 1H7CA 3PV0F 5JH7E 1OEDA 5F5WA 3RRWA 5L3BB 1DU2A 3UFGA 2WS3A 5JQGE 1QLBA 4ZHQE 2BVMA 4CZZB 3I0QA 1VCTA 3ZEFB 1IBKT 2VVNA 1E1HB 3IHRA 3JADA 1N34T 5HWYA 3RRCA 2H3RA 4ILAA 1T7SA 2KLQA 2Y48B 2ZMAA 3OPCA 2DWGA 3N9PA 2XQ5A 4YXDA 2KT9A 4MFRA 1W0AA 3B13A 5AQSB 1WFDA 4HGAA 4BAYB 5EK4A 2H7OA 2QRXA 4UF0B 4F8HA 4PFPA 2JQ9A 2J4GA 4AXPA 3HA4A 1BR2A 3N5LA 3NZQA 2MOZA 1L0VA 4MBQA 5CJ5A 5ABFB 4DV4T 5HXSA 4YT0A 4ILCA 1W9RA 2EHOA 4KP3C 4O2BE 1XDPA 5FVKA 5KDMC 4GK0E 5FY7A 2WY2A 3AE7A 4LFAT 2L3LA 5HXEA 1LRZA 3KVBA 1HNXT 4NPPA 4HFDA 3U78A 4EGWA 2J47A 3TLWA 2BKPA 4PNIA 3UUMA 4LF9T 4YLHA 5JREA 1UGOA 3AE6A 1S35A 2AXDS 2CWOA 4LMLA 4U3CA 3CX6B 1QUUA 2ZM6T 2IIUA 4QH1A 4A97A 3RYHE 5H6RB 4DR5T 1D0YA 1M62A 2WM9A 2XAGB 2V5CA 2CLYC 1YQ3A 2VQFT 2OV9A 4O2AE 3GMIA 2E8IA 4IIJE 3JAEA 2GK9A 4DR1T 1O3XA 3PDYA 3PUXF 4ASKA 5HYAA 3I1AA 5CA1E 1YD8G 3EABA 2IC6A 3L8RA 1ZKEA 4JV5T 4EZHA 1CHUA 4ZI2D 2V6YA 4OFZA 4JBWF 3QUJA 4UELA 3AE2A 5FXZA 2LLYA 5LXTE 4GIWA 1XWMA 3KDSE 4H9NC 3DJBA 3ZT5A 3OJAA 1GQEA 2WB5A 1UUSA 3MJXA 1XNRT 1IBMT 4AQFA 5LYJE 3Q5EA 4AI6A 1D0ZA 2FJBA 5ETWA 3ZMSB 1HR0T 2N2NA 2DLRA 1MMGA 4N78D 5JVDE 5HAXA 3JC6D 1S94A 1HNZT 4CN4A 4DBRA 2YEVC 5EZYE 3ZJ1A 3J7Yq 3P7IA 3AEBA 2CEAA 3AXJB 5DQVA 5LA6E 4HFBA 3UU4A 4COFA 3N9NA 3EVYA 4OK0A 3AEDA 2YU1A 3KVAA 5LMNT 3A5XA 2XPKA 5CFBA 2FBWA 1NEKA 4DR4T 3FB2A 2V1DB 4H9QC 4UVAB 2G0UA 5ABEA 4TV9E 2W61A 4X1IE 1WR0A 4IT4A 1LVKA 1J1JA 4U2YA 2KXPB 3SWHA 4DV1T 4AQGA 3ANWA 3RC3A 1LVFA 2WBLA 3V5UA 3NWIA 4YTNA 4CXWA 1NAFA 3RYIE 5HEHA 4LF5T 2KSRA 4KI0F 1W0BA 4P1NA 2VB6A 2UXBT 2E5LT 4AISA 4LFBT 5L3DB 3DP7A 2XQ3A 5HXRA 4DV3T 4KX6A 4WNKA 2WSSV 2C0SA 1MMDA 1FMWA 3VR8A 1BR1A 2VL0A 3ZCJA 5AQMB 4ZS2A 1IBLT 3ESLA 3PE0A 2C5JA 4XBFB 1XNQT 3EDUA 3GN5A 4KUMB 5FY1A 3KBUA 5JR9B 3C4ZA 4JI2T 2BS3A 4TV8E 2WP9A 5LB7B 3BQIA 3IA3A 2BG9B 3UQ4A 2HHHT 2KWIB 4ILBA 3RLFF 3AE9A 4JI1T 5JDMA 1HX8A 3C4WA 1YW0A 2X0HA 2W2UA 2LOSA 2FJDA 3KFWX 3F2EA 3Q5DA 2UXNB 3EAMA 3H37A 2H89A 2XAQB 3UULA 1BR0A 4DO0A 2NW8A 2DHRA 4GOUA 4ZI7E 2FJEA 2CCQA 4Z90A 3DTOA 4JEHB 2LHNA 1ZP0A 2HN2A 3B57A 4KHPT 4HWHA 2E5VA 3RI5A 4YJ2E 4JI3T 1KEYA 3C98B 4QX8B 4ISSA 4L9IA 4EEBA 4IGUA 4HFHA 3AE1A 3NZPA 4QKNA 2JMHA 3LSVA 2D2SA 1XDOA 2IDOB 1HFAA 3ZSSA 3LG7A 1MIWA 2B76A 2J62A 3QB5A 2IMLA 2JIWA 3OTOT 2VK9A 3E22E 3KV5A 4PK5A 3N2OA 4HWCA 4I43B 5BR8T 3H3MA 2KNDA 1D1AA 3VHLA 2WCAA 2V5DA 3ETVA 4PJMA 5LP6E 5AQIB 3AA0B 3HKBE 4HE8A 4UXNB 5LGTB 2YK0A 3PUZF 4A98A 1VOMA 3JCFA 4C90A 2LRLA 1M7KA 3IBPA 2BBHA 2XUEA 4WYVA 1KNZA 3NKZA 5AQGB 5DABA 3P4PA 3L3PA 2NOXA 2MYSA 5AQTB 2A2FX 3CIRA 3AE5A 2LSYA 3QC9A 2W00A 2W0GA 1E2AA 3FBZA 2IUBA 3EI0A 5JR9C 2HPLA 3ONLC 3V5SA 4TN7B 4ERRA 5LCYA 2BG9C 2PTFA 5LBQB 1B7TA 1MMNA 1FMVA 2WU2A 5ABHA 2WZHA 4I50E 1N36T 3LK42 5HXHA 4DV5T 4IDPA 4DMWA 4E7SA 4U7YA 2LJLA 2UUBT 2BKNA 5FL1A 3JAFA 4C91A 5DJQC 4X5TA 3E0ZA 4G2AA 2CXFA 4H9SE 3MKDA 4U33A 2LM9A 4LF6T 3UUBA 1HF8A 4QX7B 2FUPA 3HKDE 2CHNA 2ODVA 3KBTA 1I94T 2VASA 3AAIA 3FHNA 4TUYE 4U74A 2VVSA 3FZFB 4XAXB 3CVRA 1SUMB 4GKKT 2E9XD 2DL1A 4YTPA 2XQ7A 2QVAA 2BBJA 2NW7A 4AQYT 3I0OA 2HN1A 2VKDA 5LHHB 5HXCA 2W63A 2SPCA 4XZCA 2EHOB 2W66A 4DR2T 2VKOA 2NWBA 2L9QA 2K5BB 2BS2A 2H88A 2LKGA 2MAWA 3PTRB 2Z6EA 2XM1A 1UX4A 4F6RC 2BG9E 4V1Av 5L4HA 3RQUA 3LFMA 5J1GA 1EZ3A 4OX9T 1HX1B 4GYRA 1YKHB 4DV7T 4M1PA 4OYKA 1VRBA 3OBVE 1XMQT 3AVRA 2W67A 5IYZE 2YOEA 3AEGA 5IHYA 2J1DG 1AJ3A 2OA5A 4JI0T 2P9BA 5AQQB 3VKHA 2XAJB 4YFSA 2A3DA 3PU3A 4IE7A 4J2CA 2X0YA 4BJNA 4JYAT 1ZV4X 5C3JA 4ADZA 2ZM8A 2K9AA 3CKDA 3K1SA 4IE4A 1FEWA 5AQOB 3AAAB 4LMJA 2YU2A 5AQHB 3UFEA 2BS4A 2E9XA 2NW9A 3BQKA 2XTLA 2YDQA 5EK3A 3ZJ2A 3Q5XA 2DNXA 2M6IA 1IJ6A 3NBXX 3VRBA 1FIOA 3CWZB 3ZN1B 3ZMTB 3CQCB 2IW5B 3QOFA 5E0OA 3FBLA 2KZ7B 3RIUA 3EUHA 1WYCA 4EIWA 3M3ZB 2PBIA 3Q5WA 2B1EA 2NP9A 2V7IA 4QXCB 2ZM0A 4ISTA 2Y8DA 1OWAA 1HG5A 4K0KT 4DR7T 4MHCA 3OKQA 5L3EB 3VKGA 3AA6B 2XSBA 4P09A 3ZMUB 2XM2A 3ZC1A 4KHZF 4HWFA 4GKJT 3FXEB 2NTYA 2VQET 2EHOC 2LKHA 4NXMT 2BZBA 1WCRA 4KBMB 3CQXC 4PW8A 5LJMA 3MA9A 1HG2A 5FP3A 3HL6A 2Y6XA 4ZI3D 4PJNA 2YINA 3ZPOA 1U4QA 3ZYMA 3AXJA 3NVOA 3O9XA 3ONJA 1OEDE 4LMKA 3N9LA 4AKIA 2D5UA 3L39A 1VCSA 5LHIB 5L4EA 3AB3B 1BR4A 3RKOA 4IL9A 3RIAA 3ZCIA 4CI1B 2A72A 2JJ9A 3ETUA 2D9DA 3AE3A 4BA9A 2I59A 4B3RT 4B3TT 4PK4A 2Q9QB 5JRCB 4G63A 2JMKA 2H7VC 3FXDB 2JRKA 3G06A 4ILUA 4O4JE 5KXJA 3D0TA 2BKOA 3C51A 4QH5A 2LSGA 1WR6A 3SOLA 2V7MA 5AQFB 3CX7B 1UX5A 3LBXA 2CBJA 4X1YE 1ZEEA 4FI5A 4TNVA 4EXTA 3N9OA 5F3JA 3AE4A 1ZHCA 4U31A 2L8KA 2X9XA 4B3MT 4GK5E 3UU5A 2CWYA 3ZC0A 3VR9A 4KMCA 4QXHB 3ZMZB 5M4YA 1V9DA 4HN9A 1U5PA 4K0UA 1HCIA 3HKCE 2LOPA 5L2LA 4EB6E 5JR9A 5AQPB 1CUNA 5KX5E 2MPKA 5DQWA 4UV8B 2UUCT 3K3NA 1D0XA 3T8OA 4WBOA 3BQLA 2BG9A 2MTQA 3IEEA 4X20E 5LG3A 3E08A 4IDZA 3AVSA 4H9OC 2XY8B 2WAUA 1N33T 5JDHA 4HWDA 4TWFA 3SFEA 2HH7A 3PUAA 4LF4T 4EOZB 5LGUB 4IE6A 5FVLA 4O8SA 2F4VT 2V8SV 1KFYA 2WU5A 2C5IT 4O4HE 3UQ7A 5HEUA 1J5ET 4L0RA 4TNWA 5A1LA 2D0UA 2M6BA 4YJ3E 4AKRB 1MIVA 2R6GF 1T8BA 2XHEB 4LF7T 4X62T 1YQ4A 3GWHA 4CI3B 3RQWA 2VWAA 2CHOA 2Q9QC 5CA0E 4BJMA 5JDLA 1D1CA 4DR6T 5L3FB 4TWHA 4H63H 4YSXA 3AE8A 1IJ5A 4U7IA 3C64A 2WMNA 4DUZT 2AE9A 3MXZA 1R8IA 3C4XA 3KV6A 3VRAA 5LHGB 4HFEA 4YHJA 3JC6C 2W4XA 3AEAA 1FJGT 1J5WA 2FJAA 2WDRA 3UU3A 2VKHA 3L09A 5LGNB 3RH3A 4EAHA 2CPTA 3RYFE 2X67A 2WQYA 1XZYA 4ZXLA 1OEDB 3TKLB 5J2TE 3ZSTA 4IL4A 4UVBB 5FXVA 4ZZCA 2UXCT 1IZNB 3P4RA 3X1DA 3ZN0B 5FL0A 5JDGA 4AKGA 2A9UA 3K3QC 4HFVA 3UUXB 2V26A 2WWUA 5AFUL 4P0AA 2CE7A 2IHR1 3PUWF 2V6XA 4TWDA 4X65T 2RPAA 5J2UE 3T1HT 5EK2A 4JI8T 5FMNA 3RF1A 4B6XA 2LHRA 3AA1B 2ACZA 4UR9A 4X66T 3U3IA 4QHOA 3QK6A 4IDQA 3EDVA 3RPUA 1YXRA 4HTEA 3GA8A 3PUQA 2VKJA 4AIUA 5BMVE 3CX8B 3Q2MA 2JQKA 2JPFA 3AAEB 4WBNE 4ZOLE 5AQNB 2NR4A 2CA5A 4CXYA 4UF0A 3LJCA 3ABVA 2XAFB 3M65A 1SE7A 4E7ZA 4IHJE 3BK9A 4NUUA 3RGLA 1JNRA 5ABFA 4LF8T 2BDEA 5HEGA 1Y01A 4OYJA 4GYSA 2LE8A 3R84B 1MIYA 4A56A 3FZKB 4DVDA 5KMGP 1Z8UA 2XQ9A 3QNUA 3K3OA 2YN6A 3SFDA 4DUYT 4EEDA 3OYZA 3HI2A 2X9YA 4X64T 4U72A 1YKEB 4O4IE 3CPZA 3N9MA 2CXLA 3ZT6A 2MBGA 4AKHA 4DBQA 3O4XE 3A7MA 5AQVB 5IUXA 1E7PA 2XQ6A 3UTKA 2ODUA 2V6YB 2K24A 2E9XB 3FZHB 1OEDC 1XMOT 1QSDA 3UT5E 4JUYA 2WWVA 4OHFA 4UIGA 4DV0T 4L5GA 2D0TA 3PURA 3PUYF 2CM0A 4UEMA 3UU6A 3HKEE 2UXXB 4UV9B 3Q9DA 5AQJB 2XQAA 1MMAA 4U2ZA 2X9HA 4NUVA 3RYCE 3P4SA 2PJQA 3R6NA 4CXXA 3H3AA 1HS7A 4PJJA 2WZIA 3PJAJ 5FKYA 2Q9QD 3O1HA 3ZT7A 3TLTA 3RHWA 4A5XA 1I6ZA 1UURA 1Y64B 5LOVE 2IC9A 2DWKA 2CXDA 3J9X1 2JQHA 4PK6A 5IWAT 3NRYA 2XSAA 4ANJA 3RIFA 5JDQA 4X1KE 2RP4A 5FYMA 4PFOA 4Z91A
chains in the Genus database with same CATH topology
4HWCA 5AQNB 1M7KA 3A8YC 5AQHB 1M62A 3FZLB 3FZKB 3LDQB 5AQMB 5AQJB 4HWIB 5AQUB 4HWDA 5AQKB 1HX1B 5AQGB 5AQSB 3FZFB 4HWHA 4HWFA 3M3ZB 5AQRB 1UGOA 5AQQB 5AQIB 5AQLB 5AQOB 1UK5A 5AQVB 5AQTB 2D9DA 3FZMB 5AQFB 1I6ZA 1T7SA 5AQPB 3FZHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWC A;  5AQN B;  1M7K A;  3A8Y C;  5AQH B;  1M62 A;  3FZL B;  3FZK B;  3LDQ B;  5AQM B;  5AQJ B;  4HWI B;  5AQU B;  4HWD A;  5AQK B;  1HX1 B;  5AQG B;  5AQS B;  3FZF B;  4HWH A;  4HWF A;  3M3Z B;  5AQR B;  1UGO A;  5AQQ B;  5AQI B;  5AQL B;  5AQO B;  1UK5 A;  5AQV B;  5AQT B;  2D9D A;  3FZM B;  5AQF B;  1I6Z A;  1T7S A;  5AQP B;  3FZH B; 
#chains in the Genus database with same CATH topology
 3I9Y A;  3ZYL A;  1W09 A;  1UCU A;  5LJN A;  3O1I A;  3OYX A;  5ABG A;  2HPJ A;  2LT3 A;  2NTX A;  3AEF A;  4HFC A;  2QGS A;  5HWX A;  2YKS A;  1HNW T;  4DV2 T;  5L3C B;  4CN6 A;  2CMR A;  3N2K E;  4TX5 A;  1JNZ A;  3ANW B;  3LK3 B;  3PUG A;  3KV9 A;  4HWI B;  2N9D A;  4AKL A;  4QH4 A;  1WYB A;  1KNR A;  3ZMV B;  2M67 A;  3O1J A;  3T1Y T;  3MZK B;  1NWM X;  4JEU B;  2JQQ A;  4MLK A;  3ZYK A;  1MNE A;  4I55 E;  3WAK A;  2LSJ A;  5HCM A;  3S4U A;  3C50 A;  3UU8 A;  5H6Q B;  4WW0 A;  5FXW A;  3EHZ A;  3P4Q A;  3PUV F;  3OVU A;  1KNP A;  2ACX A;  1X79 A;  3LBX B;  2XAS B;  5LMU T;  4IRE A;  2WDV A;  1X9B A;  1Z0P A;  2K48 A;  4JI7 T;  3UUN A;  4YSY A;  2PFV A;  5J0Z A;  2Q9Q A;  5JRC A;  1D1B A;  5L3G B;  3GN5 B;  3RX6 A;  3RC8 A;  2LM2 A;  2LRK A;  4UVC B;  3LK2 B;  2V7J A;  2XQY A;  2E9X C;  1KK7 A;  4DR3 T;  5ADX L;  1WRD A;  4ZZB A;  3TLU A;  4JI5 T;  2XQ8 A;  3LDQ B;  3P8C D;  1KF6 A;  3N2G E;  3KIN B;  2CBI A;  3CK6 A;  5AQR B;  5CB4 E;  5JTG A;  4HFI A;  3PJA A;  3P4W A;  4H63 V;  3NRX A;  4NXN T;  4AQF C;  3RIU C;  2DCF A;  2K3W A;  4Q25 A;  3ONX A;  1HTJ F;  2KIN B;  3ZKR A;  1G73 A;  3FZL B;  4CI2 B;  2RA1 A;  5TAO A;  4EYY R;  2YDS A;  3AEE A;  1OXZ A;  5LBM A;  4ZEY A;  5AQL B;  2KWH A;  4IE5 A;  1NEN A;  3N9Q A;  5C8Y E;  2X0L B;  2LSK A;  4DMV A;  2X66 A;  4DV6 T;  3A8Y C;  3IF8 B;  2VL8 A;  4Z8X A;  3I9W A;  2VUR A;  3F57 A;  3SS1 A;  2WDQ A;  3RKG A;  5CGM A;  2QYW A;  5LG4 A;  4B3S T;  4NIQ A;  3FZM B;  4YY3 T;  2I0M A;  4QXB B;  1MND A;  3CML A;  2X9W A;  3KV4 A;  2YDR A;  3W15 B;  3AA7 B;  1T72 A;  4FJO A;  1LKX A;  1WLX A;  3MAC A;  2UU9 T;  4IDO A;  1US7 B;  3VU7 H;  5LNK A;  2OLT A;  1SHZ C;  2ZM2 A;  5FY0 A;  3F31 A;  2I6H A;  2LSI A;  5JDF A;  4IDN A;  4I0U A;  4CQI A;  2V7L A;  2UXD T;  3B5M A;  2XZE A;  2CRB A;  4ZI2 C;  1IAP A;  4EZ4 A;  4PAG A;  3CQG B;  5FNV E;  2XQ4 A;  4WZX A;  5AQK B;  5HEO A;  4YTM A;  1G8X A;  2LEH A;  5L47 A;  2V7K A;  4ZS3 A;  5HCJ A;  2W62 A;  4CN1 A;  2WMO A;  4QWN B;  1N32 T;  2IAK A;  2C5K T;  3WI3 A;  3TLV A;  4P0B A;  4LFC T;  3PUS A;  3HR0 A;  1SA0 E;  2E2A A;  3PU8 A;  4DID B;  1UK5 A;  4TZ4 C;  2UUA T;  4JI4 T;  4MAL A;  4DND A;  4I4T E;  3P50 A;  4IE0 A;  4YHH T;  2BVL A;  2ZLY A;  4JI6 T;  4H9P C;  3WAJ A;  4PJL A;  4JLE A;  2XJ7 A;  2ES0 A;  5GON E;  4YSZ A;  2QA7 A;  2CLY B;  2KMF A;  3SRZ A;  2X51 A;  1ZOY A;  2EHO D;  4H9R C;  2DI4 A;  2X68 A;  5FXX A;  4HKA A;  2PG8 A;  5JDN A;  4EV6 A;  5HEJ A;  5AQU B;  4O4L E;  3K8P C;  3ZLI A;  4ZI3 C;  5C2T A;  1T98 A;  2XAH B;  4HEA A;  3QB5 K;  3TLS A;  3MK7 C;  2N1G A;  5F8P A;  4EYU A;  3AEC A;  1H7C A;  3PV0 F;  5JH7 E;  1OED A;  5F5W A;  3RRW A;  5L3B B;  1DU2 A;  3UFG A;  2WS3 A;  5JQG E;  1QLB A;  4ZHQ E;  2BVM A;  4CZZ B;  3I0Q A;  1VCT A;  3ZEF B;  1IBK T;  2VVN A;  1E1H B;  3IHR A;  3JAD A;  1N34 T;  5HWY A;  3RRC A;  2H3R A;  4ILA A;  1T7S A;  2KLQ A;  2Y48 B;  2ZMA A;  3OPC A;  2DWG A;  3N9P A;  2XQ5 A;  4YXD A;  2KT9 A;  4MFR A;  1W0A A;  3B13 A;  5AQS B;  1WFD A;  4HGA A;  4BAY B;  5EK4 A;  2H7O A;  2QRX A;  4UF0 B;  4F8H A;  4PFP A;  2JQ9 A;  2J4G A;  4AXP A;  3HA4 A;  1BR2 A;  3N5L A;  3NZQ A;  2MOZ A;  1L0V A;  4MBQ A;  5CJ5 A;  5ABF B;  4DV4 T;  5HXS A;  4YT0 A;  4ILC A;  1W9R A;  2EHO A;  4KP3 C;  4O2B E;  1XDP A;  5FVK A;  5KDM C;  4GK0 E;  5FY7 A;  2WY2 A;  3AE7 A;  4LFA T;  2L3L A;  5HXE A;  1LRZ A;  3KVB A;  1HNX T;  4NPP A;  4HFD A;  3U78 A;  4EGW A;  2J47 A;  3TLW A;  2BKP A;  4PNI A;  3UUM A;  4LF9 T;  4YLH A;  5JRE A;  1UGO A;  3AE6 A;  1S35 A;  2AXD S;  2CWO A;  4LML A;  4U3C A;  3CX6 B;  1QUU A;  2ZM6 T;  2IIU A;  4QH1 A;  4A97 A;  3RYH E;  5H6R B;  4DR5 T;  1D0Y A;  1M62 A;  2WM9 A;  2XAG B;  2V5C A;  2CLY C;  1YQ3 A;  2VQF T;  2OV9 A;  4O2A E;  3GMI A;  2E8I A;  4IIJ E;  3JAE A;  2GK9 A;  4DR1 T;  1O3X A;  3PDY A;  3PUX F;  4ASK A;  5HYA A;  3I1A A;  5CA1 E;  1YD8 G;  3EAB A;  2IC6 A;  3L8R A;  1ZKE A;  4JV5 T;  4EZH A;  1CHU A;  4ZI2 D;  2V6Y A;  4OFZ A;  4JBW F;  3QUJ A;  4UEL A;  3AE2 A;  5FXZ A;  2LLY A;  5LXT E;  4GIW A;  1XWM A;  3KDS E;  4H9N C;  3DJB A;  3ZT5 A;  3OJA A;  1GQE A;  2WB5 A;  1UUS A;  3MJX A;  1XNR T;  1IBM T;  4AQF A;  5LYJ E;  3Q5E A;  4AI6 A;  1D0Z A;  2FJB A;  5ETW A;  3ZMS B;  1HR0 T;  2N2N A;  2DLR A;  1MMG A;  4N78 D;  5JVD E;  5HAX A;  3JC6 D;  1S94 A;  1HNZ T;  4CN4 A;  4DBR A;  2YEV C;  5EZY E;  3ZJ1 A;  3J7Y q;  3P7I A;  3AEB A;  2CEA A;  3AXJ B;  5DQV A;  5LA6 E;  4HFB A;  3UU4 A;  4COF A;  3N9N A;  3EVY A;  4OK0 A;  3AED A;  2YU1 A;  3KVA A;  5LMN T;  3A5X A;  2XPK A;  5CFB A;  2FBW A;  1NEK A;  4DR4 T;  3FB2 A;  2V1D B;  4H9Q C;  4UVA B;  2G0U A;  5ABE A;  4TV9 E;  2W61 A;  4X1I E;  1WR0 A;  4IT4 A;  1LVK A;  1J1J A;  4U2Y A;  2KXP B;  3SWH A;  4DV1 T;  4AQG A;  3ANW A;  3RC3 A;  1LVF A;  2WBL A;  3V5U A;  3NWI A;  4YTN A;  4CXW A;  1NAF A;  3RYI E;  5HEH A;  4LF5 T;  2KSR A;  4KI0 F;  1W0B A;  4P1N A;  2VB6 A;  2UXB T;  2E5L T;  4AIS A;  4LFB T;  5L3D B;  3DP7 A;  2XQ3 A;  5HXR A;  4DV3 T;  4KX6 A;  4WNK A;  2WSS V;  2C0S A;  1MMD A;  1FMW A;  3VR8 A;  1BR1 A;  2VL0 A;  3ZCJ A;  5AQM B;  4ZS2 A;  1IBL T;  3ESL A;  3PE0 A;  2C5J A;  4XBF B;  1XNQ T;  3EDU A;  3GN5 A;  4KUM B;  5FY1 A;  3KBU A;  5JR9 B;  3C4Z A;  4JI2 T;  2BS3 A;  4TV8 E;  2WP9 A;  5LB7 B;  3BQI A;  3IA3 A;  2BG9 B;  3UQ4 A;  2HHH T;  2KWI B;  4ILB A;  3RLF F;  3AE9 A;  4JI1 T;  5JDM A;  1HX8 A;  3C4W A;  1YW0 A;  2X0H A;  2W2U A;  2LOS A;  2FJD A;  3KFW X;  3F2E A;  3Q5D A;  2UXN B;  3EAM A;  3H37 A;  2H89 A;  2XAQ B;  3UUL A;  1BR0 A;  4DO0 A;  2NW8 A;  2DHR A;  4GOU A;  4ZI7 E;  2FJE A;  2CCQ A;  4Z90 A;  3DTO A;  4JEH B;  2LHN A;  1ZP0 A;  2HN2 A;  3B57 A;  4KHP T;  4HWH A;  2E5V A;  3RI5 A;  4YJ2 E;  4JI3 T;  1KEY A;  3C98 B;  4QX8 B;  4ISS A;  4L9I A;  4EEB A;  4IGU A;  4HFH A;  3AE1 A;  3NZP A;  4QKN A;  2JMH A;  3LSV A;  2D2S A;  1XDO A;  2IDO B;  1HFA A;  3ZSS A;  3LG7 A;  1MIW A;  2B76 A;  2J62 A;  3QB5 A;  2IML A;  2JIW A;  3OTO T;  2VK9 A;  3E22 E;  3KV5 A;  4PK5 A;  3N2O A;  4HWC A;  4I43 B;  5BR8 T;  3H3M A;  2KND A;  1D1A A;  3VHL A;  2WCA A;  2V5D A;  3ETV A;  4PJM A;  5LP6 E;  5AQI B;  3AA0 B;  3HKB E;  4HE8 A;  4UXN B;  5LGT B;  2YK0 A;  3PUZ F;  4A98 A;  1VOM A;  3JCF A;  4C90 A;  2LRL A;  1M7K A;  3IBP A;  2BBH A;  2XUE A;  4WYV A;  1KNZ A;  3NKZ A;  5AQG B;  5DAB A;  3P4P A;  3L3P A;  2NOX A;  2MYS A;  5AQT B;  2A2F X;  3CIR A;  3AE5 A;  2LSY A;  3QC9 A;  2W00 A;  2W0G A;  1E2A A;  3FBZ A;  2IUB A;  3EI0 A;  5JR9 C;  2HPL A;  3ONL C;  3V5S A;  4TN7 B;  4ERR A;  5LCY A;  2BG9 C;  2PTF A;  5LBQ B;  1B7T A;  1MMN A;  1FMV A;  2WU2 A;  5ABH A;  2WZH A;  4I50 E;  1N36 T;  3LK4 2;  5HXH A;  4DV5 T;  4IDP A;  4DMW A;  4E7S A;  4U7Y A;  2LJL A;  2UUB T;  2BKN A;  5FL1 A;  3JAF A;  4C91 A;  5DJQ C;  4X5T A;  3E0Z A;  4G2A A;  2CXF A;  4H9S E;  3MKD A;  4U33 A;  2LM9 A;  4LF6 T;  3UUB A;  1HF8 A;  4QX7 B;  2FUP A;  3HKD E;  2CHN A;  2ODV A;  3KBT A;  1I94 T;  2VAS A;  3AAI A;  3FHN A;  4TUY E;  4U74 A;  2VVS A;  3FZF B;  4XAX B;  3CVR A;  1SUM B;  4GKK T;  2E9X D;  2DL1 A;  4YTP A;  2XQ7 A;  2QVA A;  2BBJ A;  2NW7 A;  4AQY T;  3I0O A;  2HN1 A;  2VKD A;  5LHH B;  5HXC A;  2W63 A;  2SPC A;  4XZC A;  2EHO B;  2W66 A;  4DR2 T;  2VKO A;  2NWB A;  2L9Q A;  2K5B B;  2BS2 A;  2H88 A;  2LKG A;  2MAW A;  3PTR B;  2Z6E A;  2XM1 A;  1UX4 A;  4F6R C;  2BG9 E;  4V1A v;  5L4H A;  3RQU A;  3LFM A;  5J1G A;  1EZ3 A;  4OX9 T;  1HX1 B;  4GYR A;  1YKH B;  4DV7 T;  4M1P A;  4OYK A;  1VRB A;  3OBV E;  1XMQ T;  3AVR A;  2W67 A;  5IYZ E;  2YOE A;  3AEG A;  5IHY A;  2J1D G;  1AJ3 A;  2OA5 A;  4JI0 T;  2P9B A;  5AQQ B;  3VKH A;  2XAJ B;  4YFS A;  2A3D A;  3PU3 A;  4IE7 A;  4J2C A;  2X0Y A;  4BJN A;  4JYA T;  1ZV4 X;  5C3J A;  4ADZ A;  2ZM8 A;  2K9A A;  3CKD A;  3K1S A;  4IE4 A;  1FEW A;  5AQO B;  3AAA B;  4LMJ A;  2YU2 A;  5AQH B;  3UFE A;  2BS4 A;  2E9X A;  2NW9 A;  3BQK A;  2XTL A;  2YDQ A;  5EK3 A;  3ZJ2 A;  3Q5X A;  2DNX A;  2M6I A;  1IJ6 A;  3NBX X;  3VRB A;  1FIO A;  3CWZ B;  3ZN1 B;  3ZMT B;  3CQC B;  2IW5 B;  3QOF A;  5E0O A;  3FBL A;  2KZ7 B;  3RIU A;  3EUH A;  1WYC A;  4EIW A;  3M3Z B;  2PBI A;  3Q5W A;  2B1E A;  2NP9 A;  2V7I A;  4QXC B;  2ZM0 A;  4IST A;  2Y8D A;  1OWA A;  1HG5 A;  4K0K T;  4DR7 T;  4MHC A;  3OKQ A;  5L3E B;  3VKG A;  3AA6 B;  2XSB A;  4P09 A;  3ZMU B;  2XM2 A;  3ZC1 A;  4KHZ F;  4HWF A;  4GKJ T;  3FXE B;  2NTY A;  2VQE T;  2EHO C;  2LKH A;  4NXM T;  2BZB A;  1WCR A;  4KBM B;  3CQX C;  4PW8 A;  5LJM A;  3MA9 A;  1HG2 A;  5FP3 A;  3HL6 A;  2Y6X A;  4ZI3 D;  4PJN A;  2YIN A;  3ZPO A;  1U4Q A;  3ZYM A;  3AXJ A;  3NVO A;  3O9X A;  3ONJ A;  1OED E;  4LMK A;  3N9L A;  4AKI A;  2D5U A;  3L39 A;  1VCS A;  5LHI B;  5L4E A;  3AB3 B;  1BR4 A;  3RKO A;  4IL9 A;  3RIA A;  3ZCI A;  4CI1 B;  2A72 A;  2JJ9 A;  3ETU A;  2D9D A;  3AE3 A;  4BA9 A;  2I59 A;  4B3R T;  4B3T T;  4PK4 A;  2Q9Q B;  5JRC B;  4G63 A;  2JMK A;  2H7V C;  3FXD B;  2JRK A;  3G06 A;  4ILU A;  4O4J E;  5KXJ A;  3D0T A;  2BKO A;  3C51 A;  4QH5 A;  2LSG A;  1WR6 A;  3SOL A;  2V7M A;  5AQF B;  3CX7 B;  1UX5 A;  3LBX A;  2CBJ A;  4X1Y E;  1ZEE A;  4FI5 A;  4TNV A;  4EXT A;  3N9O A;  5F3J A;  3AE4 A;  1ZHC A;  4U31 A;  2L8K A;  2X9X A;  4B3M T;  4GK5 E;  3UU5 A;  2CWY A;  3ZC0 A;  3VR9 A;  4KMC A;  4QXH B;  3ZMZ B;  5M4Y A;  1V9D A;  4HN9 A;  1U5P A;  4K0U A;  1HCI A;  3HKC E;  2LOP A;  5L2L A;  4EB6 E;  5JR9 A;  5AQP B;  1CUN A;  5KX5 E;  2MPK A;  5DQW A;  4UV8 B;  2UUC T;  3K3N A;  1D0X A;  3T8O A;  4WBO A;  3BQL A;  2BG9 A;  2MTQ A;  3IEE A;  4X20 E;  5LG3 A;  3E08 A;  4IDZ A;  3AVS A;  4H9O C;  2XY8 B;  2WAU A;  1N33 T;  5JDH A;  4HWD A;  4TWF A;  3SFE A;  2HH7 A;  3PUA A;  4LF4 T;  4EOZ B;  5LGU B;  4IE6 A;  5FVL A;  4O8S A;  2F4V T;  2V8S V;  1KFY A;  2WU5 A;  2C5I T;  4O4H E;  3UQ7 A;  5HEU A;  1J5E T;  4L0R A;  4TNW A;  5A1L A;  2D0U A;  2M6B A;  4YJ3 E;  4AKR B;  1MIV A;  2R6G F;  1T8B A;  2XHE B;  4LF7 T;  4X62 T;  1YQ4 A;  3GWH A;  4CI3 B;  3RQW A;  2VWA A;  2CHO A;  2Q9Q C;  5CA0 E;  4BJM A;  5JDL A;  1D1C A;  4DR6 T;  5L3F B;  4TWH A;  4H63 H;  4YSX A;  3AE8 A;  1IJ5 A;  4U7I A;  3C64 A;  2WMN A;  4DUZ T;  2AE9 A;  3MXZ A;  1R8I A;  3C4X A;  3KV6 A;  3VRA A;  5LHG B;  4HFE A;  4YHJ A;  3JC6 C;  2W4X A;  3AEA A;  1FJG T;  1J5W A;  2FJA A;  2WDR A;  3UU3 A;  2VKH A;  3L09 A;  5LGN B;  3RH3 A;  4EAH A;  2CPT A;  3RYF E;  2X67 A;  2WQY A;  1XZY A;  4ZXL A;  1OED B;  3TKL B;  5J2T E;  3ZST A;  4IL4 A;  4UVB B;  5FXV A;  4ZZC A;  2UXC T;  1IZN B;  3P4R A;  3X1D A;  3ZN0 B;  5FL0 A;  5JDG A;  4AKG A;  2A9U A;  3K3Q C;  4HFV A;  3UUX B;  2V26 A;  2WWU A;  5AFU L;  4P0A A;  2CE7 A;  2IHR 1;  3PUW F;  2V6X A;  4TWD A;  4X65 T;  2RPA A;  5J2U E;  3T1H T;  5EK2 A;  4JI8 T;  5FMN A;  3RF1 A;  4B6X A;  2LHR A;  3AA1 B;  2ACZ A;  4UR9 A;  4X66 T;  3U3I A;  4QHO A;  3QK6 A;  4IDQ A;  3EDV A;  3RPU A;  1YXR A;  4HTE A;  3GA8 A;  3PUQ A;  2VKJ A;  4AIU A;  5BMV E;  3CX8 B;  3Q2M A;  2JQK A;  2JPF A;  3AAE B;  4WBN E;  4ZOL E;  5AQN B;  2NR4 A;  2CA5 A;  4CXY A;  4UF0 A;  3LJC A;  3ABV A;  2XAF B;  3M65 A;  1SE7 A;  4E7Z A;  4IHJ E;  3BK9 A;  4NUU A;  3RGL A;  1JNR A;  5ABF A;  4LF8 T;  2BDE A;  5HEG A;  1Y01 A;  4OYJ A;  4GYS A;  2LE8 A;  3R84 B;  1MIY A;  4A56 A;  3FZK B;  4DVD A;  5KMG P;  1Z8U A;  2XQ9 A;  3QNU A;  3K3O A;  2YN6 A;  3SFD A;  4DUY T;  4EED A;  3OYZ A;  3HI2 A;  2X9Y A;  4X64 T;  4U72 A;  1YKE B;  4O4I E;  3CPZ A;  3N9M A;  2CXL A;  3ZT6 A;  2MBG A;  4AKH A;  4DBQ A;  3O4X E;  3A7M A;  5AQV B;  5IUX A;  1E7P A;  2XQ6 A;  3UTK A;  2ODU A;  2V6Y B;  2K24 A;  2E9X B;  3FZH B;  1OED C;  1XMO T;  1QSD A;  3UT5 E;  4JUY A;  2WWV A;  4OHF A;  4UIG A;  4DV0 T;  4L5G A;  2D0T A;  3PUR A;  3PUY F;  2CM0 A;  4UEM A;  3UU6 A;  3HKE E;  2UXX B;  4UV9 B;  3Q9D A;  5AQJ B;  2XQA A;  1MMA A;  4U2Z A;  2X9H A;  4NUV A;  3RYC E;  3P4S A;  2PJQ A;  3R6N A;  4CXX A;  3H3A A;  1HS7 A;  4PJJ A;  2WZI A;  3PJA J;  5FKY A;  2Q9Q D;  3O1H A;  3ZT7 A;  3TLT A;  3RHW A;  4A5X A;  1I6Z A;  1UUR A;  1Y64 B;  5LOV E;  2IC9 A;  2DWK A;  2CXD A;  3J9X 1;  2JQH A;  4PK6 A;  5IWA T;  3NRY A;  2XSA A;  4ANJ A;  3RIF A;  5JDQ A;  4X1K E;  2RP4 A;  5FYM A;  4PFO A;  4Z91 A; 
#chains in the Genus database with same CATH homology
 4HWC A;  5AQN B;  1M7K A;  3A8Y C;  5AQH B;  1M62 A;  3FZL B;  3FZK B;  3LDQ B;  5AQM B;  5AQJ B;  4HWI B;  5AQU B;  4HWD A;  5AQK B;  1HX1 B;  5AQG B;  5AQS B;  3FZF B;  4HWH A;  4HWF A;  3M3Z B;  5AQR B;  1UGO A;  5AQQ B;  5AQI B;  5AQL B;  5AQO B;  1UK5 A;  5AQV B;  5AQT B;  2D9D A;  3FZM B;  5AQF B;  1I6Z A;  1T7S A;  5AQP B;  3FZH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...