3FZMB

Crystal structures of hsc70/bag1 in complex with small molecule inhibitors
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel adenosine-derived inhibitors of 70 kDa heat shock protein, discovered through structure-based design
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 46
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3fzmB00
5AQKB 5AQNB 5AQSB 3FZMB 5AQHB 1M7KA 5AQGB 4HWHA 4HWDA 1HX1B 5AQPB 3A8YC 3M3ZB 5AQVB 5AQTB 5AQJB 5AQOB 4HWIB 3FZLB 5AQLB 3LDQB 5AQIB 5AQMB 5AQUB 3FZKB 3FZFB 2D9DA 5AQRB 4HWCA 1M62A 1T7SA 1UK5A 3FZHB 4HWFA 5AQQB 1I6ZA 1UGOA 5AQFB
chains in the Genus database with same CATH superfamily
3LBXB 3VRBA 5JDMA 3RC3A 4QX8B 3FXEB 4YSYA 5JDHA 1MIVA 1ZOYA 4KHZF 1VOMA 2J47A 5EZYE 5LXTE 2WZHA 4WBOA 2M6BA 1OEDB 4BJMA 1MNEA 1ZKEA 2IUBA 4EYYR 3NWIA 4LMLA 1M7KA 1J5ET 4JEUB 1XZYA 2FJEA 3KVBA 1YQ3A 2MTQA 3ZSSA 3ZMUB 2YN6A 2E8IA 2YKSA 3LFMA 2IMLA 4MHCA 4QH5A 3PTRB 3AE1A 4ZI3C 2K5BB 5BMVE 2CHNA 2Q9QD 4BA9A 2YEVC 4O2BE 5C3JA 4QKNA 3FZFB 3UU8A 2WMOA 4U3CA 1Y64B 3CX8B 3N9PA 2QRXA 3S4UA 4P09A 4NUVA 2YDQA 2EHOD 2YINA 4HKAA 3OJAA 4ZS2A 4IE4A 4HFIA 1IZNB 1SE7A 4CXWA 2I0MA 3P4QA 2P9BA 2X9HA 3ABVA 4HFVA 3ZYKA 2UU9T 2BG9B 2N9DA 2CPTA 4U72A 3UQ4A 4JI8T 3PDYA 4MFRA 4DV0T 2CEAA 3AVSA 3KBTA 4ADZA 4BJNA 2W66A 4EIWA 4YXDA 2V7JA 3P4PA 4UXNB 2D0TA 4X64T 2BBHA 2JQKA 2DLRA 2VKDA 4CI2B 5AFUL 3PV0F 1BR2A 3B57A 3HA4A 1CHUA 3HKCE 1S94A 2AE9A 3UT5E 4G63A 2RPAA 3LK2B 3B13A 3N9NA 4EEBA 3LG7A 5HXEA 4A97A 2H7VC 3AXJB 2A3DA 1IJ5A 4PFOA 1FMWA 3CX7B 3GA8A 4HTEA 5AQLB 4JI0T 3FBLA 3ONJA 3ONLC 5L3EB 3P7IA 1XMQT 2LSKA 2QVAA 4GYRA 5J2UE 2XQ6A 2XQ4A 3AEAA 3A5XA 1MMAA 1OEDE 1J1JA 5L3GB 5LHGB 4Z91A 2C5KT 2L9QA 3PU8A 5HEGA 4JLEA 2FJAA 2X0LB 5JR9A 4JUYA 5HYAA 2M6IA 2BVLA 3H37A 3PJAA 4JI3T 3RPUA 3UUXB 4YSXA 4IL4A 4PNIA 4U2ZA 2RP4A 2WMNA 4EEDA 4UF0A 4DUYT 4IIJE 3TKLB 5ABEA 5FXWA 1E7PA 4ZI2C 2WSSV 5ADXL 3E22E 4X1YE 3C51A 2XSAA 3AECA 1HX8A 2KMFA 1E2AA 2KWIB 2ODUA 4OX9T 3EDVA 4HWDA 2KINB 1HFAA 3C4XA 4NPPA 4OHFA 4U33A 3RYIE 5L3CB 4AQYT 4O4LE 3DP7A 4ZI3D 4DNDA 3A7MA 4YLHA 3U3IA 3O9XA 2V26A 5TAOA 2G0UA 2JMKA 3CQCB 3MZKB 4OK0A 2BKNA 3QK6A 4H63V 2LSIA 4TWHA 2Q9QA 5AQUB 2E5VA 1XDOA 4LFAT 3ZCJA 2JIWA 3MK7C 4KBMB 4AQGA 2ZM6T 5AQRB 2NP9A 3PUSA 1IBLT 3NRYA 4BAYB 5KX5E 5CB4E 3I0QA 2ZMAA 2D0UA 3I1AA 5LG3A 2K24A 3UU4A 1NWMX 1N33T 4B3RT 3N2GE 3AEBA 3PUGA 3AA1B 4KMCA 1B7TA 4DIDB 4A5XA 1KF6A 3PUQA 4V1Av 3VKHA 2C0SA 3UU6A 3I9YA 3Q5DA 4K0KT 3JC6D 5ETWA 4IL9A 3C4ZA 1KEYA 2X67A 3PJAJ 2E2AA 1CUNA 2V7MA 3M65A 3P50A 4K0UA 3ZT6A 1D0YA 2XAHB 2LM9A 5L3DB 3JCFA 3CVRA 4JYAT 3RHWA 3KBUA 4ZZCA 4TV9E 4QXBB 4I55E 5FL1A 1IBMT 3ONXA 2ACXA 1WYCA 3MKDA 3NZPA 2ZM8A 3AA7B 3RKOA 5F3JA 1JNZA 4DR5T 4AKHA 3AE8A 3NBXX 3TLTA 5JDQA 2QYWA 2CLYB 2WP9A 4H9OC 5JDFA 4G2AA 2YOEA 3ZC1A 1H7CA 4CI3B 4U74A 5H6QB 4C91A 1DU2A 3PUAA 1KK7A 2UXXB 4X20E 4ISSA 4UVCB 3T1HT 3R6NA 2BS4A 1MIYA 4LF4T 2VKJA 1X79A 2KXPB 5GONE 5AQNB 1QUUA 4O8SA 2WZIA 5AQSB 4YHHT 3FZMB 5LHHB 2E5LT 2BZBA 2LOPA 2X51A 3KV9A 3RIUA 3RYHE 3WI3A 5JTGA 4LFBT 2NWBA 2PBIA 3AA0B 2J1DG 2QA7A 4TWDA 5JR9B 2J4GA 3W15B 5FY0A 4X1KE 4YSZA 3OYZA 2V5DA 2EHOA 3EUHA 2XTLA 4J2CA 4F8HA 2JRKA 3JADA 5HXSA 5AQOB 3LK42 5LBMA 5LGTB 5FL0A 5LOVE 5LA6E 5JRCB 2BVMA 2XQ5A 4FI5A 4YFSA 5AQMB 2XM2A 2D9DA 3ZMVB 1HNXT 3CQXC 1VCSA 3NRXA 2H88A 2FUPA 3C4WA 3G06A 2W67A 2Q9QC 3PURA 3AVRA 4WW0A 4YT0A 4QHOA 4TNVA 4DV3T 1JNRA 4DR2T 3GMIA 3HKDE 3R84B 3X1DA 2DWGA 2EHOC 2JQQA 3QOFA 5DQWA 3NKZA 4ILUA 1OWAA 4QXHB 5AQHB 3SS1A 4JI6T 1L0VA 2VURA 3MJXA 1S35A 2H3RA 2Y48B 3CX6B 3MACA 4I4TE 3AEFA 1WLXA 4FJOA 3HL6A 3BK9A 4DBQA 1LRZA 2LM2A 2YU2A 4Q25A 5EK4A 2MBGA 2XAJB 5FNVE 1D1BA 1W9RA 3OBVE 3ESLA 3AE5A 4AQFC 1QSDA 1UCUA 3N9QA 1HS7A 3LDQB 5JDLA 5IHYA 1KFYA 3FZKB 3KVAA 2BDEA 4DV7T 2CWOA 2EHOB 5LGNB 2VVNA 2XQYA 5FXZA 2LHRA 5HXHA 2M67A 2JJ9A 2K3WA 4DMWA 4XBFB 4U31A 1G8XA 3K3QC 4TWFA 1Z0PA 4TZ4C 1W0BA 5HAXA 2Q9QB 3RRWA 3OKQA 1WR0A 2E9XA 3N2OA 4PAGA 4LMJA 4ILBA 4ILAA 4A56A 2N2NA 2XY8B 3RH3A 2B1EA 5L47A 4O4JE 3CMLA 2KNDA 3CPZA 3JC6C 1SA0E 2XM1A 3OYXA 4N78D 4ZZBA 4O4IE 1V9DA 4O4HE 3WAJA 2L3LA 4X5TA 5L4HA 4IDOA 4OYJA 4ASKA 4YY3T 1HF8A 4WNKA 2PJQA 5FVLA 1SHZC 2I6HA 2X0YA 1KNPA 3DTOA 3IBPA 4H9PC 3JAEA 1QLBA 3RQUA 3WAKA 3K3NA 4OYKA 1Y01A 3ZN0B 4AISA 1AJ3A 1VCTA 3RF1A 3TLVA 3BQKA 2V7LA 4I0UA 5F8PA 2GK9A 4YTPA 1NENA 5KXJA 5HXCA 3V5UA 1Z8UA 2XAQB 4HWCA 4DR1T 2JQHA 4M1PA 3JAFA 4HFDA 3VHLA 3ZLIA 1XWMA 2CBJA 4DR6T 5J2TE 3ZJ1A 4EAHA 2CBIA 5J1GA 4B6XA 2LSGA 5FP3A 5LP6E 5LMNT 3I0OA 4CN1A 2A72A 2DCFA 4ZI7E 3C64A 3V5SA 2ES0A 2V6XA 2W4XA 5AQKB 4CQIA 4ZOLE 3RYFE 2X9XA 4UELA 4DBRA 4PK4A 2BS2A 1UX5A 2XJ7A 5JVDE 4HWHA 3ZYLA 2QGSA 2UXCT 3OVUA 1T98A 5FY7A 1EZ3A 4KI0F 3LSVA 4EYUA 2LSYA 2CXLA 4JI5T 3M3ZB 4EZHA 1ZP0A 2R6GF 2VL8A 4GKJT 3PE0A 2DI4A 3FHNA 5LJNA 5IWAT 4X65T 2ODVA 2VL0A 1WYBA 2KLQA 5FMNA 5HCMA 4LF6T 4WBNE 2VQFT 3ZJ2A 3F57A 3QB5K 2NW9A 3SOLA 4YJ3E 5JREA 4LFCT 1FJGT 5FXVA 4GOUA 3RGLA 2MPKA 3RIUC 2Y6XA 3B5MA 3CIRA 1N36T 2VVSA 1HNWT 5L2LA 1NAFA 5HEJA 3ANWA 4HE8A 2H7OA 2V7KA 4HFEA 5HXRA 5HEUA 3UU5A 4COFA 4U7YA 2LLYA 4Z90A 3UTKA 4DV6T 2XQ7A 1O3XA 2W63A 2WS3A 4UIGA 3CKDA 1XNRT 2UUAT 1FMVA 1BR1A 2HPJA 3QNUA 2HN2A 3AE7A 3GN5A 3O1HA 4L0RA 4WYVA 2ZM0A 3GN5B 3L3PA 4OFZA 2BG9E 1XNQT 5IYZE 3C50A 1D1CA 5AQJB 5CJ5A 3PUYF 1YKHB 3FXDB 2VKHA 3QUJA 4IGUA 2C5IT 4L9IA 5DJQC 3O1JA 4DR4T 3LBXA 3RLFF 3Q5XA 3UUBA 4HFCA 2IC6A 2XZEA 1LVFA 2D2SA 2KSRA 3PUVF 4Z8XA 5EK2A 2W61A 2AXDS 4UVAB 4EZ4A 2IHR1 4MLKA 2LEHA 1VRBA 3VR9A 2LRKA 2OLTA 3GWHA 3CK6A 5JQGE 4GKKT 3AAIA 3D0TA 2N1GA 2OV9A 5LB7B 5LJMA 4EXTA 2JPFA 1ZV4X 2V6YA 3AAEB 3H3AA 5FY1A 4JEHB 3ZYMA 2IC9A 2NW8A 2X9YA 3KV6A 4MALA 3AEEA 3KV5A 3HI2A 5CA1E 1UURA 1ZHCA 2WQYA 2VWAA 4ILCA 2XAFB 1HX1B 5C2TA 5EK3A 3K3OA 2BS3A 3AEDA 3A8YC 4QWNB 4TNWA 3RYCE 4DV4T 4AKGA 2V7IA 2LHNA 1FEWA 4NIQA 2CCQA 3P4RA 3FZLB 1FIOA 1OEDC 4PK5A 4B3TT 5AQIB 3NVOA 4IE0A 2X0HA 1HTJF 4HN9A 2VB6A 4TUYE 3QB5A 2X66A 3AB3B 4ERRA 2W2UA 2NR4A 3SFEA 1HCIA 3PUZF 4DV2T 4JBWF 2LRLA 2WWUA 1I94T 5AQFB 2PTFA 4PK6A 4TV8E 3DJBA 3PU3A 3RQWA 4AXPA 4GIWA 2A2FX 3Q2MA 5CFBA 4X1IE 4JI1T 2WU2A 4HFHA 2UXNB 4YJ2E 2FJBA 2KT9A 1MMDA 4XZCA 5JDGA 3N2KE 3ETVA 2DNXA 2OA5A 1T72A 4YTNA 4DUZT 2H89A 3CQGB 1UUSA 2NOXA 2F4VT 5FXXA 4JV5T 1E1HB 2Y8DA 3EDUA 5H6RB 2WB5A 4CN6A 3AAAB 3O4XE 3FBZA 4HWIB 3ZMZB 3Q5EA 4IDZA 1XDPA 4KX6A 4IDQA 3RIAA 4QH1A 2BG9C 3KFWX 2NW7A 2YK0A 3ZMSB 5FYMA 3UU3A 3J9X1 1HG5A 2BG9A 2NTYA 3AE6A 3EABA 3TLUA 3U78A 4ANJA 1HR0T 3MXZA 3RC8A 5KMGP 3N5LA 2KZ7B 2DHRA 5AQQB 1I6ZA 3P4SA 1IBKT 5LNKA 2UUBT 2Z6EA 4IE6A 5JRCA 2XUEA 1MMGA 5JH7E 2L8KA 1WRDA 5A1LA 4HEAA 3L09A 3ANWB 5L3FB 2E9XC 3HR0A 4P0AA 2XHEB 2MYSA 2MAWA 2BKOA 2W00A 2XSBA 3BQLA 5AQTB 1OXZA 3RKGA 4H9QC 1IJ6A 3E0ZA 4AI6A 2WDVA 2LOSA 5LHIB 4UF0B 5J0ZA 4DR3T 2W62A 5FKYA 2V6YB 3F31A 3IA3A 3UULA 3TLSA 3QC9A 3K1SA 4JI2T 2ZM2A 4LF9T 4MBQA 3AA6B 2DL1A 1M62A 4TN7B 1T7SA 2XQAA 3RI5A 3N9MA 5CA0E 1UK5A 2V5CA 3AEGA 1LKXA 3N9OA 3ZN1B 1MIWA 2C5JA 2FBWA 2X9WA 3MA9A 4I50E 2WBLA 4A98A 2CM0A 3P8CD 4CI1B 3VKGA 3ZKRA 4IDNA 3L8RA 2VASA 2WY2A 2KWHA 1N34T 3ZPOA 1MNDA 3SRZA 5IUXA 1WFDA 1KNZA 2DWKA 2IAKA 4XAXB 5LMUT 3TLWA 4PJMA 4PW8A 3NZQA 4B3ST 4X62T 3AE3A 1US7B 2CRBA 3UUMA 1OEDA 1D0XA 1D0ZA 1YW0A 4PJLA 4NXMT 2UXDT 4IT4A 3OTOT 1X9BA 2X68A 2HHHT 2HPLA 3I9WA 3FB2A 4LMKA 3EVYA 1YQ4A 3CWZB 5LBQB 3UQ7A 4IE5A 1BR0A 2MOZA 4LF8T 2WCAA 5DABA 2WWVA 2JQ9A 5HEOA 2CE7A 4GK5E 4L5GA 4UEMA 1D1AA 3C98B 4JI7T 2W0GA 4NXNT 2V1DB 2LKHA 2UUCT 4E7SA 4DV1T 4DR7T 3EI0A 2VQET 4ZXLA 2ZLYA 2LKGA 2CMRA 5HCJA 3AE2A 4HGAA 4DV5T 4AKRB 2XPKA 1U4QA 1U5PA 2E9XD 5AQGB 4X66T 3KV4A 1WCRA 4B3MT 4DVDA 2LE8A 2CXDA 4P0BA 4KUMB 3PUXF 4ISTA 4WZXA 4LF5T 4QH4A 2CHOA 5AQVB 5ABFA 4CZZB 5LGUB 3ZEFB 4JI4T 3VRAA 4C90A 4U2YA 1GQEA 2V8SV 4ZEYA 4UV8B 2HN1A 2J62A 3AXJA 2VKOA 5ABFB 3AE4A 1MMNA 2LT3A 2LJLA 2SPCA 1T8BA 3EHZA 4GK0E 5ABGA 5C8YE 2K9AA 2K48A 3SWHA 4ZI2D 4PJNA 3L39A 3ZCIA 3KDSE 2IDOB 1R8IA 4DMVA 3HKBE 4NUUA 3ETUA 5LYJE 4EB6E 1KNRA 2IIUA 5L3BB 4AIUA 5HWXA 3P4WA 4U7IA 5JR9C 2YDRA 3ZMTB 3SFDA 2PFVA 4H9NC 1BR4A 3Q5WA 3ZC0A 3ZT7A 1YKEB 2UXBT 1LVKA 2B76A 1W0AA 2XASB 4ZHQE 4DO0A 3AE9A 5AQPB 4H9SE 3F2EA 3Q9DA 4YTMA 1G73A 5LCYA 3LK3B 4AQFA 4LF7T 1NEKA 1W09A 5M4YA 2A9UA 2I59A 5DQVA 4CXYA 4AKLA 4O2AE 2BKPA 4H9RC 5BR8T 2YU1A 4IDPA 3K8PC 3UFGA 2CWYA 2CXFA 2VK9A 5F5WA 2BBJA 3E08A 1HG2A 4UVBB 5HEHA 1YXRA 1J5WA 3RIFA 4EGWA 4EV6A 4UV9B 3UUNA 2XQ3A 4QXCB 2WU5A 3UFEA 3T8OA 2JMHA 2RA1A 4IE7A 1UX4A 2WM9A 3OPCA 2IW5B 5LG4A 4E7ZA 3O1IA 3J7Yq 4CXXA 1IAPA 1XMOT 2LSJA 2CLYC 3LJCA 2XAGB 2D5UA 4IREA 2XQ8A 4UR9A 3ZT5A 2PG8A 3BQIA 4H63H 1YD8G 5ABHA 4F6RC 4I43B 2YDSA 5FVKA 2HH7A 3IHRA 5L4EA 1SUMB 4P1NA 4EOZB 4PFPA 1HNZT 4YHJA 5JDNA 4CN4A 5CGMA 5E0OA 3RRCA 3VU7H 4TX5A 4PJJA 3ZSTA 4KHPT 1ZEEA 3VR8A 3RX6A 3KINB 4AKIA 2E9XB 3PUWF 5HWYA 2ACZA 4IHJE 3T1YT 4ZS3A 1N32T 2XQ9A 3HKEE 3H3MA 2WAUA 2WDRA 3N9LA 4KP3C 2WDQA 3IF8B 3FZHB 1WR6A 2CA5A 4QX7B 3EAMA 2FJDA 4GYSA 4HWFA 1UGOA 3IEEA 2NTXA 5KDMC 4HFBA
chains in the Genus database with same CATH topology
5AQKB 5AQNB 5AQSB 3FZMB 5AQHB 1M7KA 5AQGB 4HWHA 4HWDA 1HX1B 5AQPB 3A8YC 3M3ZB 5AQVB 5AQTB 5AQJB 5AQOB 4HWIB 3FZLB 5AQLB 3LDQB 5AQIB 5AQMB 5AQUB 3FZKB 3FZFB 2D9DA 5AQRB 4HWCA 1M62A 1T7SA 1UK5A 3FZHB 4HWFA 5AQQB 1I6ZA 1UGOA 5AQFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQK B;  5AQN B;  5AQS B;  3FZM B;  5AQH B;  1M7K A;  5AQG B;  4HWH A;  4HWD A;  1HX1 B;  5AQP B;  3A8Y C;  3M3Z B;  5AQV B;  5AQT B;  5AQJ B;  5AQO B;  4HWI B;  3FZL B;  5AQL B;  3LDQ B;  5AQI B;  5AQM B;  5AQU B;  3FZK B;  3FZF B;  2D9D A;  5AQR B;  4HWC A;  1M62 A;  1T7S A;  1UK5 A;  3FZH B;  4HWF A;  5AQQ B;  1I6Z A;  1UGO A;  5AQF B; 
#chains in the Genus database with same CATH topology
 3LBX B;  3VRB A;  5JDM A;  3RC3 A;  4QX8 B;  3FXE B;  4YSY A;  5JDH A;  1MIV A;  1ZOY A;  4KHZ F;  1VOM A;  2J47 A;  5EZY E;  5LXT E;  2WZH A;  4WBO A;  2M6B A;  1OED B;  4BJM A;  1MNE A;  1ZKE A;  2IUB A;  4EYY R;  3NWI A;  4LML A;  1M7K A;  1J5E T;  4JEU B;  1XZY A;  2FJE A;  3KVB A;  1YQ3 A;  2MTQ A;  3ZSS A;  3ZMU B;  2YN6 A;  2E8I A;  2YKS A;  3LFM A;  2IML A;  4MHC A;  4QH5 A;  3PTR B;  3AE1 A;  4ZI3 C;  2K5B B;  5BMV E;  2CHN A;  2Q9Q D;  4BA9 A;  2YEV C;  4O2B E;  5C3J A;  4QKN A;  3FZF B;  3UU8 A;  2WMO A;  4U3C A;  1Y64 B;  3CX8 B;  3N9P A;  2QRX A;  3S4U A;  4P09 A;  4NUV A;  2YDQ A;  2EHO D;  2YIN A;  4HKA A;  3OJA A;  4ZS2 A;  4IE4 A;  4HFI A;  1IZN B;  1SE7 A;  4CXW A;  2I0M A;  3P4Q A;  2P9B A;  2X9H A;  3ABV A;  4HFV A;  3ZYK A;  2UU9 T;  2BG9 B;  2N9D A;  2CPT A;  4U72 A;  3UQ4 A;  4JI8 T;  3PDY A;  4MFR A;  4DV0 T;  2CEA A;  3AVS A;  3KBT A;  4ADZ A;  4BJN A;  2W66 A;  4EIW A;  4YXD A;  2V7J A;  3P4P A;  4UXN B;  2D0T A;  4X64 T;  2BBH A;  2JQK A;  2DLR A;  2VKD A;  4CI2 B;  5AFU L;  3PV0 F;  1BR2 A;  3B57 A;  3HA4 A;  1CHU A;  3HKC E;  1S94 A;  2AE9 A;  3UT5 E;  4G63 A;  2RPA A;  3LK2 B;  3B13 A;  3N9N A;  4EEB A;  3LG7 A;  5HXE A;  4A97 A;  2H7V C;  3AXJ B;  2A3D A;  1IJ5 A;  4PFO A;  1FMW A;  3CX7 B;  3GA8 A;  4HTE A;  5AQL B;  4JI0 T;  3FBL A;  3ONJ A;  3ONL C;  5L3E B;  3P7I A;  1XMQ T;  2LSK A;  2QVA A;  4GYR A;  5J2U E;  2XQ6 A;  2XQ4 A;  3AEA A;  3A5X A;  1MMA A;  1OED E;  1J1J A;  5L3G B;  5LHG B;  4Z91 A;  2C5K T;  2L9Q A;  3PU8 A;  5HEG A;  4JLE A;  2FJA A;  2X0L B;  5JR9 A;  4JUY A;  5HYA A;  2M6I A;  2BVL A;  3H37 A;  3PJA A;  4JI3 T;  3RPU A;  3UUX B;  4YSX A;  4IL4 A;  4PNI A;  4U2Z A;  2RP4 A;  2WMN A;  4EED A;  4UF0 A;  4DUY T;  4IIJ E;  3TKL B;  5ABE A;  5FXW A;  1E7P A;  4ZI2 C;  2WSS V;  5ADX L;  3E22 E;  4X1Y E;  3C51 A;  2XSA A;  3AEC A;  1HX8 A;  2KMF A;  1E2A A;  2KWI B;  2ODU A;  4OX9 T;  3EDV A;  4HWD A;  2KIN B;  1HFA A;  3C4X A;  4NPP A;  4OHF A;  4U33 A;  3RYI E;  5L3C B;  4AQY T;  4O4L E;  3DP7 A;  4ZI3 D;  4DND A;  3A7M A;  4YLH A;  3U3I A;  3O9X A;  2V26 A;  5TAO A;  2G0U A;  2JMK A;  3CQC B;  3MZK B;  4OK0 A;  2BKN A;  3QK6 A;  4H63 V;  2LSI A;  4TWH A;  2Q9Q A;  5AQU B;  2E5V A;  1XDO A;  4LFA T;  3ZCJ A;  2JIW A;  3MK7 C;  4KBM B;  4AQG A;  2ZM6 T;  5AQR B;  2NP9 A;  3PUS A;  1IBL T;  3NRY A;  4BAY B;  5KX5 E;  5CB4 E;  3I0Q A;  2ZMA A;  2D0U A;  3I1A A;  5LG3 A;  2K24 A;  3UU4 A;  1NWM X;  1N33 T;  4B3R T;  3N2G E;  3AEB A;  3PUG A;  3AA1 B;  4KMC A;  1B7T A;  4DID B;  4A5X A;  1KF6 A;  3PUQ A;  4V1A v;  3VKH A;  2C0S A;  3UU6 A;  3I9Y A;  3Q5D A;  4K0K T;  3JC6 D;  5ETW A;  4IL9 A;  3C4Z A;  1KEY A;  2X67 A;  3PJA J;  2E2A A;  1CUN A;  2V7M A;  3M65 A;  3P50 A;  4K0U A;  3ZT6 A;  1D0Y A;  2XAH B;  2LM9 A;  5L3D B;  3JCF A;  3CVR A;  4JYA T;  3RHW A;  3KBU A;  4ZZC A;  4TV9 E;  4QXB B;  4I55 E;  5FL1 A;  1IBM T;  3ONX A;  2ACX A;  1WYC A;  3MKD A;  3NZP A;  2ZM8 A;  3AA7 B;  3RKO A;  5F3J A;  1JNZ A;  4DR5 T;  4AKH A;  3AE8 A;  3NBX X;  3TLT A;  5JDQ A;  2QYW A;  2CLY B;  2WP9 A;  4H9O C;  5JDF A;  4G2A A;  2YOE A;  3ZC1 A;  1H7C A;  4CI3 B;  4U74 A;  5H6Q B;  4C91 A;  1DU2 A;  3PUA A;  1KK7 A;  2UXX B;  4X20 E;  4ISS A;  4UVC B;  3T1H T;  3R6N A;  2BS4 A;  1MIY A;  4LF4 T;  2VKJ A;  1X79 A;  2KXP B;  5GON E;  5AQN B;  1QUU A;  4O8S A;  2WZI A;  5AQS B;  4YHH T;  3FZM B;  5LHH B;  2E5L T;  2BZB A;  2LOP A;  2X51 A;  3KV9 A;  3RIU A;  3RYH E;  3WI3 A;  5JTG A;  4LFB T;  2NWB A;  2PBI A;  3AA0 B;  2J1D G;  2QA7 A;  4TWD A;  5JR9 B;  2J4G A;  3W15 B;  5FY0 A;  4X1K E;  4YSZ A;  3OYZ A;  2V5D A;  2EHO A;  3EUH A;  2XTL A;  4J2C A;  4F8H A;  2JRK A;  3JAD A;  5HXS A;  5AQO B;  3LK4 2;  5LBM A;  5LGT B;  5FL0 A;  5LOV E;  5LA6 E;  5JRC B;  2BVM A;  2XQ5 A;  4FI5 A;  4YFS A;  5AQM B;  2XM2 A;  2D9D A;  3ZMV B;  1HNX T;  3CQX C;  1VCS A;  3NRX A;  2H88 A;  2FUP A;  3C4W A;  3G06 A;  2W67 A;  2Q9Q C;  3PUR A;  3AVR A;  4WW0 A;  4YT0 A;  4QHO A;  4TNV A;  4DV3 T;  1JNR A;  4DR2 T;  3GMI A;  3HKD E;  3R84 B;  3X1D A;  2DWG A;  2EHO C;  2JQQ A;  3QOF A;  5DQW A;  3NKZ A;  4ILU A;  1OWA A;  4QXH B;  5AQH B;  3SS1 A;  4JI6 T;  1L0V A;  2VUR A;  3MJX A;  1S35 A;  2H3R A;  2Y48 B;  3CX6 B;  3MAC A;  4I4T E;  3AEF A;  1WLX A;  4FJO A;  3HL6 A;  3BK9 A;  4DBQ A;  1LRZ A;  2LM2 A;  2YU2 A;  4Q25 A;  5EK4 A;  2MBG A;  2XAJ B;  5FNV E;  1D1B A;  1W9R A;  3OBV E;  3ESL A;  3AE5 A;  4AQF C;  1QSD A;  1UCU A;  3N9Q A;  1HS7 A;  3LDQ B;  5JDL A;  5IHY A;  1KFY A;  3FZK B;  3KVA A;  2BDE A;  4DV7 T;  2CWO A;  2EHO B;  5LGN B;  2VVN A;  2XQY A;  5FXZ A;  2LHR A;  5HXH A;  2M67 A;  2JJ9 A;  2K3W A;  4DMW A;  4XBF B;  4U31 A;  1G8X A;  3K3Q C;  4TWF A;  1Z0P A;  4TZ4 C;  1W0B A;  5HAX A;  2Q9Q B;  3RRW A;  3OKQ A;  1WR0 A;  2E9X A;  3N2O A;  4PAG A;  4LMJ A;  4ILB A;  4ILA A;  4A56 A;  2N2N A;  2XY8 B;  3RH3 A;  2B1E A;  5L47 A;  4O4J E;  3CML A;  2KND A;  3CPZ A;  3JC6 C;  1SA0 E;  2XM1 A;  3OYX A;  4N78 D;  4ZZB A;  4O4I E;  1V9D A;  4O4H E;  3WAJ A;  2L3L A;  4X5T A;  5L4H A;  4IDO A;  4OYJ A;  4ASK A;  4YY3 T;  1HF8 A;  4WNK A;  2PJQ A;  5FVL A;  1SHZ C;  2I6H A;  2X0Y A;  1KNP A;  3DTO A;  3IBP A;  4H9P C;  3JAE A;  1QLB A;  3RQU A;  3WAK A;  3K3N A;  4OYK A;  1Y01 A;  3ZN0 B;  4AIS A;  1AJ3 A;  1VCT A;  3RF1 A;  3TLV A;  3BQK A;  2V7L A;  4I0U A;  5F8P A;  2GK9 A;  4YTP A;  1NEN A;  5KXJ A;  5HXC A;  3V5U A;  1Z8U A;  2XAQ B;  4HWC A;  4DR1 T;  2JQH A;  4M1P A;  3JAF A;  4HFD A;  3VHL A;  3ZLI A;  1XWM A;  2CBJ A;  4DR6 T;  5J2T E;  3ZJ1 A;  4EAH A;  2CBI A;  5J1G A;  4B6X A;  2LSG A;  5FP3 A;  5LP6 E;  5LMN T;  3I0O A;  4CN1 A;  2A72 A;  2DCF A;  4ZI7 E;  3C64 A;  3V5S A;  2ES0 A;  2V6X A;  2W4X A;  5AQK B;  4CQI A;  4ZOL E;  3RYF E;  2X9X A;  4UEL A;  4DBR A;  4PK4 A;  2BS2 A;  1UX5 A;  2XJ7 A;  5JVD E;  4HWH A;  3ZYL A;  2QGS A;  2UXC T;  3OVU A;  1T98 A;  5FY7 A;  1EZ3 A;  4KI0 F;  3LSV A;  4EYU A;  2LSY A;  2CXL A;  4JI5 T;  3M3Z B;  4EZH A;  1ZP0 A;  2R6G F;  2VL8 A;  4GKJ T;  3PE0 A;  2DI4 A;  3FHN A;  5LJN A;  5IWA T;  4X65 T;  2ODV A;  2VL0 A;  1WYB A;  2KLQ A;  5FMN A;  5HCM A;  4LF6 T;  4WBN E;  2VQF T;  3ZJ2 A;  3F57 A;  3QB5 K;  2NW9 A;  3SOL A;  4YJ3 E;  5JRE A;  4LFC T;  1FJG T;  5FXV A;  4GOU A;  3RGL A;  2MPK A;  3RIU C;  2Y6X A;  3B5M A;  3CIR A;  1N36 T;  2VVS A;  1HNW T;  5L2L A;  1NAF A;  5HEJ A;  3ANW A;  4HE8 A;  2H7O A;  2V7K A;  4HFE A;  5HXR A;  5HEU A;  3UU5 A;  4COF A;  4U7Y A;  2LLY A;  4Z90 A;  3UTK A;  4DV6 T;  2XQ7 A;  1O3X A;  2W63 A;  2WS3 A;  4UIG A;  3CKD A;  1XNR T;  2UUA T;  1FMV A;  1BR1 A;  2HPJ A;  3QNU A;  2HN2 A;  3AE7 A;  3GN5 A;  3O1H A;  4L0R A;  4WYV A;  2ZM0 A;  3GN5 B;  3L3P A;  4OFZ A;  2BG9 E;  1XNQ T;  5IYZ E;  3C50 A;  1D1C A;  5AQJ B;  5CJ5 A;  3PUY F;  1YKH B;  3FXD B;  2VKH A;  3QUJ A;  4IGU A;  2C5I T;  4L9I A;  5DJQ C;  3O1J A;  4DR4 T;  3LBX A;  3RLF F;  3Q5X A;  3UUB A;  4HFC A;  2IC6 A;  2XZE A;  1LVF A;  2D2S A;  2KSR A;  3PUV F;  4Z8X A;  5EK2 A;  2W61 A;  2AXD S;  4UVA B;  4EZ4 A;  2IHR 1;  4MLK A;  2LEH A;  1VRB A;  3VR9 A;  2LRK A;  2OLT A;  3GWH A;  3CK6 A;  5JQG E;  4GKK T;  3AAI A;  3D0T A;  2N1G A;  2OV9 A;  5LB7 B;  5LJM A;  4EXT A;  2JPF A;  1ZV4 X;  2V6Y A;  3AAE B;  3H3A A;  5FY1 A;  4JEH B;  3ZYM A;  2IC9 A;  2NW8 A;  2X9Y A;  3KV6 A;  4MAL A;  3AEE A;  3KV5 A;  3HI2 A;  5CA1 E;  1UUR A;  1ZHC A;  2WQY A;  2VWA A;  4ILC A;  2XAF B;  1HX1 B;  5C2T A;  5EK3 A;  3K3O A;  2BS3 A;  3AED A;  3A8Y C;  4QWN B;  4TNW A;  3RYC E;  4DV4 T;  4AKG A;  2V7I A;  2LHN A;  1FEW A;  4NIQ A;  2CCQ A;  3P4R A;  3FZL B;  1FIO A;  1OED C;  4PK5 A;  4B3T T;  5AQI B;  3NVO A;  4IE0 A;  2X0H A;  1HTJ F;  4HN9 A;  2VB6 A;  4TUY E;  3QB5 A;  2X66 A;  3AB3 B;  4ERR A;  2W2U A;  2NR4 A;  3SFE A;  1HCI A;  3PUZ F;  4DV2 T;  4JBW F;  2LRL A;  2WWU A;  1I94 T;  5AQF B;  2PTF A;  4PK6 A;  4TV8 E;  3DJB A;  3PU3 A;  3RQW A;  4AXP A;  4GIW A;  2A2F X;  3Q2M A;  5CFB A;  4X1I E;  4JI1 T;  2WU2 A;  4HFH A;  2UXN B;  4YJ2 E;  2FJB A;  2KT9 A;  1MMD A;  4XZC A;  5JDG A;  3N2K E;  3ETV A;  2DNX A;  2OA5 A;  1T72 A;  4YTN A;  4DUZ T;  2H89 A;  3CQG B;  1UUS A;  2NOX A;  2F4V T;  5FXX A;  4JV5 T;  1E1H B;  2Y8D A;  3EDU A;  5H6R B;  2WB5 A;  4CN6 A;  3AAA B;  3O4X E;  3FBZ A;  4HWI B;  3ZMZ B;  3Q5E A;  4IDZ A;  1XDP A;  4KX6 A;  4IDQ A;  3RIA A;  4QH1 A;  2BG9 C;  3KFW X;  2NW7 A;  2YK0 A;  3ZMS B;  5FYM A;  3UU3 A;  3J9X 1;  1HG5 A;  2BG9 A;  2NTY A;  3AE6 A;  3EAB A;  3TLU A;  3U78 A;  4ANJ A;  1HR0 T;  3MXZ A;  3RC8 A;  5KMG P;  3N5L A;  2KZ7 B;  2DHR A;  5AQQ B;  1I6Z A;  3P4S A;  1IBK T;  5LNK A;  2UUB T;  2Z6E A;  4IE6 A;  5JRC A;  2XUE A;  1MMG A;  5JH7 E;  2L8K A;  1WRD A;  5A1L A;  4HEA A;  3L09 A;  3ANW B;  5L3F B;  2E9X C;  3HR0 A;  4P0A A;  2XHE B;  2MYS A;  2MAW A;  2BKO A;  2W00 A;  2XSB A;  3BQL A;  5AQT B;  1OXZ A;  3RKG A;  4H9Q C;  1IJ6 A;  3E0Z A;  4AI6 A;  2WDV A;  2LOS A;  5LHI B;  4UF0 B;  5J0Z A;  4DR3 T;  2W62 A;  5FKY A;  2V6Y B;  3F31 A;  3IA3 A;  3UUL A;  3TLS A;  3QC9 A;  3K1S A;  4JI2 T;  2ZM2 A;  4LF9 T;  4MBQ A;  3AA6 B;  2DL1 A;  1M62 A;  4TN7 B;  1T7S A;  2XQA A;  3RI5 A;  3N9M A;  5CA0 E;  1UK5 A;  2V5C A;  3AEG A;  1LKX A;  3N9O A;  3ZN1 B;  1MIW A;  2C5J A;  2FBW A;  2X9W A;  3MA9 A;  4I50 E;  2WBL A;  4A98 A;  2CM0 A;  3P8C D;  4CI1 B;  3VKG A;  3ZKR A;  4IDN A;  3L8R A;  2VAS A;  2WY2 A;  2KWH A;  1N34 T;  3ZPO A;  1MND A;  3SRZ A;  5IUX A;  1WFD A;  1KNZ A;  2DWK A;  2IAK A;  4XAX B;  5LMU T;  3TLW A;  4PJM A;  4PW8 A;  3NZQ A;  4B3S T;  4X62 T;  3AE3 A;  1US7 B;  2CRB A;  3UUM A;  1OED A;  1D0X A;  1D0Z A;  1YW0 A;  4PJL A;  4NXM T;  2UXD T;  4IT4 A;  3OTO T;  1X9B A;  2X68 A;  2HHH T;  2HPL A;  3I9W A;  3FB2 A;  4LMK A;  3EVY A;  1YQ4 A;  3CWZ B;  5LBQ B;  3UQ7 A;  4IE5 A;  1BR0 A;  2MOZ A;  4LF8 T;  2WCA A;  5DAB A;  2WWV A;  2JQ9 A;  5HEO A;  2CE7 A;  4GK5 E;  4L5G A;  4UEM A;  1D1A A;  3C98 B;  4JI7 T;  2W0G A;  4NXN T;  2V1D B;  2LKH A;  2UUC T;  4E7S A;  4DV1 T;  4DR7 T;  3EI0 A;  2VQE T;  4ZXL A;  2ZLY A;  2LKG A;  2CMR A;  5HCJ A;  3AE2 A;  4HGA A;  4DV5 T;  4AKR B;  2XPK A;  1U4Q A;  1U5P A;  2E9X D;  5AQG B;  4X66 T;  3KV4 A;  1WCR A;  4B3M T;  4DVD A;  2LE8 A;  2CXD A;  4P0B A;  4KUM B;  3PUX F;  4IST A;  4WZX A;  4LF5 T;  4QH4 A;  2CHO A;  5AQV B;  5ABF A;  4CZZ B;  5LGU B;  3ZEF B;  4JI4 T;  3VRA A;  4C90 A;  4U2Y A;  1GQE A;  2V8S V;  4ZEY A;  4UV8 B;  2HN1 A;  2J62 A;  3AXJ A;  2VKO A;  5ABF B;  3AE4 A;  1MMN A;  2LT3 A;  2LJL A;  2SPC A;  1T8B A;  3EHZ A;  4GK0 E;  5ABG A;  5C8Y E;  2K9A A;  2K48 A;  3SWH A;  4ZI2 D;  4PJN A;  3L39 A;  3ZCI A;  3KDS E;  2IDO B;  1R8I A;  4DMV A;  3HKB E;  4NUU A;  3ETU A;  5LYJ E;  4EB6 E;  1KNR A;  2IIU A;  5L3B B;  4AIU A;  5HWX A;  3P4W A;  4U7I A;  5JR9 C;  2YDR A;  3ZMT B;  3SFD A;  2PFV A;  4H9N C;  1BR4 A;  3Q5W A;  3ZC0 A;  3ZT7 A;  1YKE B;  2UXB T;  1LVK A;  2B76 A;  1W0A A;  2XAS B;  4ZHQ E;  4DO0 A;  3AE9 A;  5AQP B;  4H9S E;  3F2E A;  3Q9D A;  4YTM A;  1G73 A;  5LCY A;  3LK3 B;  4AQF A;  4LF7 T;  1NEK A;  1W09 A;  5M4Y A;  2A9U A;  2I59 A;  5DQV A;  4CXY A;  4AKL A;  4O2A E;  2BKP A;  4H9R C;  5BR8 T;  2YU1 A;  4IDP A;  3K8P C;  3UFG A;  2CWY A;  2CXF A;  2VK9 A;  5F5W A;  2BBJ A;  3E08 A;  1HG2 A;  4UVB B;  5HEH A;  1YXR A;  1J5W A;  3RIF A;  4EGW A;  4EV6 A;  4UV9 B;  3UUN A;  2XQ3 A;  4QXC B;  2WU5 A;  3UFE A;  3T8O A;  2JMH A;  2RA1 A;  4IE7 A;  1UX4 A;  2WM9 A;  3OPC A;  2IW5 B;  5LG4 A;  4E7Z A;  3O1I A;  3J7Y q;  4CXX A;  1IAP A;  1XMO T;  2LSJ A;  2CLY C;  3LJC A;  2XAG B;  2D5U A;  4IRE A;  2XQ8 A;  4UR9 A;  3ZT5 A;  2PG8 A;  3BQI A;  4H63 H;  1YD8 G;  5ABH A;  4F6R C;  4I43 B;  2YDS A;  5FVK A;  2HH7 A;  3IHR A;  5L4E A;  1SUM B;  4P1N A;  4EOZ B;  4PFP A;  1HNZ T;  4YHJ A;  5JDN A;  4CN4 A;  5CGM A;  5E0O A;  3RRC A;  3VU7 H;  4TX5 A;  4PJJ A;  3ZST A;  4KHP T;  1ZEE A;  3VR8 A;  3RX6 A;  3KIN B;  4AKI A;  2E9X B;  3PUW F;  5HWY A;  2ACZ A;  4IHJ E;  3T1Y T;  4ZS3 A;  1N32 T;  2XQ9 A;  3HKE E;  3H3M A;  2WAU A;  2WDR A;  3N9L A;  4KP3 C;  2WDQ A;  3IF8 B;  3FZH B;  1WR6 A;  2CA5 A;  4QX7 B;  3EAM A;  2FJD A;  4GYS A;  4HWF A;  1UGO A;  3IEE A;  2NTX A;  5KDM C;  4HFB A; 
#chains in the Genus database with same CATH homology
 5AQK B;  5AQN B;  5AQS B;  3FZM B;  5AQH B;  1M7K A;  5AQG B;  4HWH A;  4HWD A;  1HX1 B;  5AQP B;  3A8Y C;  3M3Z B;  5AQV B;  5AQT B;  5AQJ B;  5AQO B;  4HWI B;  3FZL B;  5AQL B;  3LDQ B;  5AQI B;  5AQM B;  5AQU B;  3FZK B;  3FZF B;  2D9D A;  5AQR B;  4HWC A;  1M62 A;  1T7S A;  1UK5 A;  3FZH B;  4HWF A;  5AQQ B;  1I6Z A;  1UGO A;  5AQF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...