3FZUC

Igg1 fab characterized by h/d exchange
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
214
Chain Sequence
EVQLVESGGGLAKPGGSLRLSCAASGFRFTFNNYYMDWVRQAPGQGLEWVSRISSSGDPTWYADSVKGRFTISRENAKNTLFLQMNSLRAEDTAVYYCASLTTGSDSWGQGVLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunoglobulin IgG1 Fab, light chain
publication title Characterization of IgG1 conformation and conformational dynamics by hydrogen/deuterium exchange mass spectrometry.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 214
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fzuC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fzuC01
1MAML 4GRMA 5HHNA 5DO2D 4HJGA 1B0GB 1GXEA 3CLEL 4OLUL 4NNXA 1BZ9B 3WMSA 5BO1H 3HNTL 2DWEA 5FOBA 5J8OA 5HDBF 1OQOA 4OLVL 4F7PA 3ZKQD 2VOTA 3MJ7A 4ZUSB 3SKOA 4ENED 5SWZD 4Y5YC 3ARBC 4RQQA 1HCFX 1K4CA 2CUIA 3P9LA 4GAGL 1P4BL 2X4NB 3UBXB 4Z6AT 4TQEH 3KPSE 2YPKA 5EBWB 3ZYJA 4XAKE 2YUWA 1RD6A 2JKXA 3FAXA 5J3HD 4MS8D 1NBYB 3TA3C 2RGSA 1YMME 4PRAB 1VFOA 3V6BR 2OTUA 2VYRE 3L1OL 3VXUA 5DLML 4Y8AA 4O58L 1RIVL 5HYJA 2J8UE 3KPLA 4GKSA 1EH9A 3DYPA 1J8HB 4ETQA 1BOGB 2P45B 1C1EH 1Q9LA 2VZTA 43C9B 5J7CC 3MA9L 2ZUWA 1D9KA 3P40A 5E6IA 3E2HB 4PJAE 2IWGA 3OJMB 4HIXL 4ZS7L 5IW1B 3ZHDA 2CDEA 2PCPA 3U7WH 2IQ9L 4TUJA 4LL9A 3LV3B 1A7QL 1FPTL 4Z18A 2H9GA 1EMTL 3QDME 3WEXB 2PYED 1K85A 3IFPB 2EC8A 5JLZA 3ZDXE 2EC9U 3AUVA 3DBXB 3I75A 1PBYA 4YHZL 4DK6A 1IGTA 2B8OT 2WIMA 2DMBA 4QHUA 3CFJA 4ZO8A 3SDAB 2HFFA 3S3JA 3O2WL 4KK5D 4X6FA 1U91A 2WP3T 3D85A 1UH2A 4DKEH 3PHQB 1BBJB 4GOSA 2NR6D 4CMHC 4HF5H 2JB5H 2E9BA 5IEKB 1TVBA 1YEKH 3IFNH 3P77A 1PLGL 2VXVH 4IHOB 5EC2B 3RVWD 4U1MB 5GPRA 3QNXA 5JW5A 1CLCA 1T2XA 4NWTL 1QSEE 3INUL 1TENA 4YHML 1F4XL 4LVOB 1LEGA 1RZGB 1CL7H 2HFTA 5T1MA 2P47B 2CDGB 2OSLB 5SWZA 5CLWA 1RUAH 4LKXB 3WNLA 2ZUYA 4OF3A 3SDXE 4DVRL 5M94B 4PB0H 2J7LA 1CXFA 5ID1A 1YZZA 3QDHA 4LSVH 4M48L 4O9HL 1AC6A 4EZMA 2KKQA 2ZUUA 2JJUA 4RMWA 5E8DL 2J8UA 3CDFA 3X11A 5GS0D 1U93A 3FB5A 4TSAH 1MLCA 2AXHA 4HCRH 5ADPH 4JFDE 5MEOA 4KKCD 3ZE1F 1H5BB 4NFBA 4JFPA 5F3BA 4M4PA 4C56B 2A74B 3P30H 1FVEA 1DN0A 4NQUA 4CVWA 3FN3A 3V6OE 2ERJC 1A2YB 1FZKB 4TOYL 3VG9B 2N7AA 3TVMB 1I3GL 5C07B 1I7TB 1EGJA 4H0GA 2GKIA 4WV1C 4DZBB 3PUCA 3T0ED 4BELD 2PYEA 4OT1L 1F4WL 3AY4C 4Q9RL 5I8EB 4ODVL 2DF3A 4MA7H 1RK0A 2F19L 4K7PL 1IAIL 1Z9OA 5F1IB 4OM0L 4G7YL 5I0DA 5CWSB 3K2UH 3HR6A 3T1WA 1G7HB 1Q9OB 3ALWA 1OM3H 1QSEA 1CFTB 1NLBL 3SDDD 1PKQB 2DIBA 2OM5A 4Z7VE 1EEZB 3RY4A 1AFVL 3MRGA 3SDCC 4K8RL 2DMCA 4P2QD 1BD2B 4BKLB 4G3YL 5HPMB 2XKNB 5GS3A 5IF0B 1KCRL 1D5BB 5C0JA 1VDGA 4JFHD 3WO3B 3MC0A 4PJHF 5EZIH 1TQCB 4XAWH 1WISA 5FGSA 3KPTA 2CXKA 2NXZD 4PV8B 4Y2DC 5GISH 1MF2H 3D3VB 1ETZB 4XC3H 3ZDZF 3UMTA 4P3WA 3VFSA 4FZ8L 4N0CD 1OPGH 4P2YA 1CXEA 1F3DH 3PIQB 5GGTL 3QIBB 4ODTL 1FNSH 1KB5A 15C8H 2PTUA 4KJWD 5KG9A 4JPIA 1OAKL 2YOCA 1P53A 1BREA 4WEBL 5FF6B 3FO9B 3G5VB 3WIFA 3WNPA 1FAIL 1FL3B 5I17B 1P1ZA 2Y1VA 5HDQL 5JA8B 1FNGA 4S1QL 1IM3B 3VXTA 4XGZA 4JO1H 2P8LB 4XC1L 1X5LA 2EYSA 3PWPB 4LSRL 2BNQB 1EDQA 2HFEB 4F7CA 1CTOA 4GMTH 1CVSC 3T0EA 4XPBH 3GBNL 3BZFB 4R97B 5DEZA 2YBRA 1CBVH 2XZQH 3HE7C 3NCBB 2MHAB 1GCFA 3LIZH 1P9MC 4K07A 3VXOB 4HWZA 2BY3A 1A6AA 4KRPC 5EPMB 4AEIH 3NZ8A 4POZD 5MEND 3MR9A 3H9ZA 4NUJA 1QYGL 5EBLB 3KJ6L 1KJ2H 3PHOA 2FJGA 4JEGB 4FABL 1T7YA 1FFNA 1T20B 5FB8B 2ZJSL 1T2QL 3CUPB 4UTBL 4EQ2A 5L7XL 2GJ6B 5HHQB 3W9EA 1IC5H 4N5UA 4QHMB 4LHJB 4P2QA 1PDKA 5GGVH 3MV9E 3RPIA 4NO0D 3ELAT 5B38B 4Z7UF 3EBAA 3STLB 4RGOL 3N1GC 3O8XA 1G9NH 2X7LB 4OM1L 4HBQA 1U8PB 4MXVF 4K8RD 1B6UA 4HMCA 5EIVA 5JW3H 3QPXL 1SJEA 4DGVL 2Y07L 4WHTB 5KVEH 3KPOA 4GXUN 3X3FL 2C5DC 4G6JH 2CLZB 4I0CC 1FN4B 3EGSA 1RZFH 2AJXL 3NABH 1EFQA 5BS0B 3LN9A 1I3RB 5L88H 4MZ2A 1CGSL 2PTVA 3OAZH 4OLZH 2W38A 3QXTA 1XIWB 4FA8A 4J8RB 4M1GL 3GSOA 5GRVK 3VGAC 3GNMH 2IALB 2I5YH 4L8DB 3HFMH 5IB5B 4K3HA 3S36X 5DJ0A 2AQ2A 1H3WM 1KGCE 3UPRA 5CSGA 5DT1H 2FNBA 1AXSB 3KPRB 1UH3A 4P4RA 4QTHA 5I6XB 3GSUB 3G6AB 3OKDA 1L9MA 2LV4A 4OCXH 1HHGB 4X7SL 3MROB 4MCZB 1CWVA 4KQ3L 3Q0HA 3D0VB 3RWHA 2WBJB 1CU4L 2CUMA 3MV8E 3ZDYF 3L3IA 3QP3A 1FJ1A 2CR6A 4XXDB 5DC0A 5HVHC 1D5ZB 2EDLA 1ZA3A 1IEBB 4PJ8B 5MENA 2UWEB 3SDYH 3L3GB 3ZKNC 3KLHC 2F58H 4WIQA 4F57H 3MV9A 4G42A 3F65A 4FNLH 1DQQB 1ORQB 3ARFC 5FO9A 3A67H 1AGDB 2FJHA 4DTGL 2BC4B 4NO0A 4KQ4L 4JFYB 3MRRA 1F3JB 1IAII 1A7NL 2Z8RA 4N68A 2OP4L 5BXFB 5F44A 3GSNB 1V3KA 3NGBC 3X13A 1ZVSB 2E6PA 2HT2D 4JQVC 3KYOB 4XH2A 4WU5B 1UVQB 1V7ML 3PWLA 4HT1H 2F8VA 4UBDD 1QNZL 1D6VH 2G2RA 3HCVA 1JV5B 2XFXB 3PL6D 4IOIA 4AMKL 5LQBL 1INQA 1EZVX 5HD8C 1KB9K 3PGCB 3CFIC 5CHNB 4L8BA 5HGBB 5DI8A 3S96A 4WWID 1OGAE 4DAGH 1QFHA 3OHXA 3KS0H 3QR2A 4QWWD 3LN4A 5CZVL 1D5XB 3B5GA 1FE8H 1WQVT 2NW2B 3IJYA 5SV4A 3QHZL 5D7JB 4KKAC 5ESQB 3LSOB 2R1WA 1IZJA 2VUOA 1IJ9A 1HE7A 3C60B 1BVKA 4ZFGH 3NACH 5IMOB 2NY6C 3OKOA 1G7MB 3QEUA 4N9GA 3MV8A 2Q8BH 3DSFH 1J1PH 1I3VA 2I9LB 3FMGH 3MQIA 2ADJB 4EOWH 4BM7A 4RFNB 3GI8L 3VWKD 5EUOF 1F4AA 1H8SA 2AK4B 1I8LC 1ZKAA 1QFOA 5KANI 5HDBE 4RWHA 4M62H 4OBRA 3WIHL 3ZHKA 2VZUA 4PJ9B 3BPCA 1FO0A 3QRGH 3MRKB 4H0IA 3NIFF 4X6DF 2XXCB 4QY8B 2C1PA 1J9CT 4L5FL 4LOUC 4PJ7F 5D1ZB 5EOQL 5LGJB 3TBVA 5IOPA 4LLUA 2XKUA 5JORA 4F9PA 3GRWH 1MI5D 3CSYA 2BXYA 4NQDA 4Y4FC 4M7LT 3ALPA 5J11C 2VLRB 1IL1A 1EJOL 2BNRB 5T5NF 3SCMD 3P4NA 1AO7E 2A73A 1NL0H 4XCFL 1U8NB 1T1WA 3M45A 1C7SA 1TVDA 5DRNB 2NY0B 5DURD 1G6RA 4Z77A 1A9EB 4Y19E 1IM9A 1JP5A 4JFXA 5E99L 2Q7YA 5LKNA 3TBWB 4OD3L 3IJHA 4U6TA 1AD0A 4M1CC 2P48B 1I9EA 1PG7X 3PL6A 2VN4A 4S10A 2CLRB 4YBHA 2OMNA 2VLKD 1UXSB 1B4JL 5CSZB 2IG2L 3RDTD 5DQ9A 4L9LA 3WE6A 2JJSA 2R0LL 4KH2A 4NKDB 1B3JA 2K9UA 3UTTB 2BDNL 4LCIH 4KUZL 1BVLB 1MEXH 4ZAKB 2BERA 5J1SC 3EO1A 2GW5A 4DGYH 3CVHH 1CF8H 3DX7A 5DJ6B 3C09B 3W9DB 3GSVB 4WW2C 1XCTA 5TDNB 1TCMA 1YYLH 2D31A 4X5XA 4TVSa 4YFLF 2Q86B 3EFDL 3MBEB 4N90D 3MRPA 3TNMB 5T1LA 2R1XA 3ROLB 3RWFA 3S4SA 4XNZB 5T3ZH 4ONFH 3QIWB 5IG7A 4ZNCD 2KQMA 3SOBL 5D96C 4GRLD 3NTCH 5E08H 3QEGH 4NSKA 3VMNA 4AT6B 4F7TA 3U2SA 4I2XE 3VXSD 4JPVL 3GSRB 1RZKH 3LKSB 1JNHA 4Y4KD 1G84A 3FT4B 2XA3A 3MLVL 3F7QA 4PJCB 4P2OC 5IVZB 3TN0C 3NH7L 4DEPC 3WFDH 1MI5A 2KQNA 3N06B 5JDSB 3AB0C 1P5UA 3S37X 1OY3B 4H25A 5BZWA 3TJHC 3QFJB 4POUB 3U48A 4HBCL 5C3LD 5FUCE 4P9MH 5D5MF 1Q72H 2FHBA 3QEHA 4HXAL 1YDPA 3I6LE 3WXVH 5E2WL 4P49A 2YXFA 5DDHA 1FGNH 4BZ1L 3W39B 3ZE1E 2NTFA 4HUWB 5JQHC 4UTAL 1KNOA 5J12C 1C5CH 3CZFA 4HKJB 1L7TH 3DVIA 4BFGA 3EJZD 2RB8A 5AUMB 1QSFE 4PJEA 3T3MF 1CVRA 3HUJF 2YKLL 5B39A 3CSBA 2IMMA 2VXUH 3RDTA 2ZCKH 1X5XA 1FIGH 3MOBL 5DEFB 2YA1A 5DJZA 4GSDL 1IVLA 3QZWB 4HKXA 3CFBA 4ZUTA 1H0DB 4JCMA 1Q1JH 2HLAB 2XTJE 3IDMA 4RCAA 3JWOL 5ERWA 5ID0B 3BP4B 4S1RL 4PLKD 2FBOJ 3UROR 4ZFFB 4OZ4A 1ED3B 3EJJX 4GRLA 1CFVL 1J1XH 2H26A 3AMLA 2VRAA 3JTTB 3R06B 4P5KB 3P9MA 3NCEB 4XBGA 3VG0H 4JKLA 4NO5B 4PRHD 5DJAA 3VXSA 1RK1B 2RFXB 3OWEA 4F2MA 5I18L 5KANG 4Y4KA 1I1AB 3BEWA 1Y0LA 4YGVB 1MIEH 3ZDZE 3BDYH 2GYSA 3LKPB 4NKQB 4RZCA 4WFGD 4LHQB 5EZJB 4ESKA 5I8KL 3WIHA 1GGYA 5GJSL 3QCVL 1ITBB 2RBLA 2QKIB 1ES0A 3QUZA 4Y5VB 1BF8A 4MA8H 2Q8AH 1EXUB 5JOFA 5ICYB 5J9PB 1T21B 1RSFA 5L2JA 1I9JH 4PBXA 2F8OA 4MNGA 3TBTB 1I9IH 4JG1H 4MQXC 3T3PF 1G7IB 4U3XA 2CMRH 4KV5F 5E9DB 1UACL 2VDKL 2OR7A 5D6CA 3IAPA 2RJMA 4ZXBB 3VFPA 1I8MA 1IAKA 4CW1A 3LN5A 3WJJA 4OB5H 4PJXF 4NKIH 1AXTL 1C5BH 1FZOA 1HN1A 3O4OC 2MTPA 4KHTL 5F7EL 1XF3B 4IMLB 3CXHJ 3MRCB 3OG4B 4KKLD 3MTRA 5GGUA 2VJXA 3QUYC 1GHFH 2AV7A 4OLYH 2DJ4A 3QHFH 3KLDA 4QRQB 1I9RH 4L29A 1MH5A 3C6LC 4P59H 3ARDC 3FQWA 3IDXH 2J6EH 1DE4A 4FQHB 2HTKC 4QXGH 3RGVC 2GTZA 1UQSA 4PJAB 2Q76B 1QR1B 4S0TD 4DN3H 3A6BL 1EBPA 1U8IA 4YX2H 2VKXA 1IGML 2WSKA 4IS6A 3VW3H 5GSVA 4PJHA 1IEAB 3PABA 3G5ZA 3QDMB 4L4TE 3DMMC 3PP3H 3GMRA 4BSWB 4X4XB 1R3HA 3O9WD 4Z7UE 3OKLA 1VFAA 5KBNC 4QT5B 5D7KD 1T1XA 4D9RD 1YPZF 4PRHA 2B1HL 4RMSA 4MXVE 3X3GL 1PAMA 1FNFA 3S4SG 5KVFH 2FATH 1LGVA 5DRWA 5C08D 2BNUB 3KDMB 4D9QE 3QUXB 1ITCA 2R69H 1QFWM 4P9HC 3O3BB 5C8JA 3HZVB 3ZKMC 3FT2A 2YPVL 3O11B 1MFAL 2V6HA 5HYFA 3MLTA 1DQJB 4LMQE 5ESAB 5CEYA 1JMXA 2GIYA 3BPNB 3MLWH 4P2CG 1CTNA 3IU4H 4LRIA 4G80A 4UINL 1G9MC 1NAMH 2XWTB 4FG6D 4HPYH 3HPLA 2EH8H 5I8CA 4KKNA 4WI6A 2VN7A 2ZZUT 3L7EB 2ED7A 2P24B 4H8WH 3U1SH 2R1YA 3I02A 1Q9WB 1Y18A 1EFXA 3SDXB 2QQKH 5I71B 5E00A 3HZKA 3LRSB 1CR9L 2GAZA 1HYSC 1S5HB 3MLUH 3ARGA 3RKDD 3E6HA 2R0KH 3P4MB 1AE6H 3MFFB 3VFNB 1FQ9C 3BW9A 5DD1H 2VSDA 2FGWH 1T7ZA 2I27N 5E94A 1DN2A 3ZDYE 2BRRL 1SM3H 1LE5B 1QLRB 1JHTB 3BRGC 1RIHL 4IRSC 4OGYL 2ARJQ 4FQQA 5B39G 3GBML 5ANMA 2Z92A 1P84J 1RUMH 2MFNA 2VERN 3RI5K 2ZCHH 3DXAD 5F3HA 3ARYA 4ZUVA 1JPSL 2P43B 3P0VL 4HG4J 3FO2B 5I73B 5L0QC 1PD6A 3GB7A 4F37F 4M6AA 3TO2A 1FV1A 4IIQA 5BV7H 3BEVB 1T3FB 4G5ZH 3O9WA 4NWUH 3IKCB 3DPBA 3SE8H 1NSNL 1T2JA 3VFMB 3BPOC 5E4EB 3RFZC 4X7DC 1UWEL 4QCIB 1P5VA 5BVJB 1PW3A 3KR3H 4N0FA 4S11A 2E7LC 5TDPB 1S9KC 4WUUB 3GSWB 5C08A 3T65B 4NFCA 3WSQL 1X5AA 4N8CL 4LVEA 1XEDA 4S2SB 4Z7VB 5GS2D 1X6LA 4HS8H 3L7FA 3LHPL 3LPFA 2HRPL 5TJWK 1ERNA 5FKAA 5C92A 1HHIB 4Z0XB 2ATKA 4FQ2L 2MPAL 1M7DB 4RISH 5MI0C 3OGCA 3MOAL 3SHSA 1YJDC 2VL5B 1V7NH 1U58B 2O5YH 2D9CA 1L7IL 3TV3H 1TQBB 3WUWB 4XVSL 1VSCA 3GSQB 4FQJL 3QAZB 4L8SC 1CGWA 3OKKB 3ARBD 4JGMA 4L3ED 2R4RL 1FG2B 1VEOA 1MJJB 4OF5A 1JWUA 1MWAL 5DK0A 1KLUA 5EUOE 4BJLA 3RBGA 3RWCB 4LLYA 3EFFA 1GRWA 2WINA 3MRIA 4FQIH 3TA3D 2H2SC 2PNDA 2VAJA 3DV4B 3W5NA 3NIFE 4X6DE 2YRPA 4IOFC 3IAGC 5C0CB 3LEYH 4OJFH 1M6OB 3GHEL 3HTLX 1CK0L 2GITB 4PJ7E 3QJHA 2D2OA 3DXAA 5F6IC 4YDKH 4ZFOB 1ZGLM 2BSED 1KV3A 3PDGA 5DRXB 1WFNA 2M2DA 4CN6A 2NY1C 3JUZA 3KVQA 3DURA 4NO2B 3T0WA 2C1OB 1Q9KA 4ZO6A 4XCEA 1N3NA 2DLGA 1FORL 4V1DE 4UUJA 4KJQC 3K8LA 1INDH 3VJ6B 3QEQD 4GLRI 1BAFL 1OP9A 3U6RA 1VGEL 4JKMA 5FHAH 1U2HA 5EU3B 3FFCE 4D0DA 1LK3L 3BRFA 4HLZG 32C2A 4YHKH 3RZCA 1IGYA 4YDVB 4G6KH 2VXQH 5CP3A 1QKZL 3LKNB 1AR1C 1WT5A 5FYJH 4G8EB 3BGAA 3QXWA 2VLJD 1YNLH 2A6KA 4XWGH 3S5LB 1HILA 8FABA 5D6DC 2VLMD 4EN3C 5ACZA 3WYRA 1SMAA 4G6ML 4YHYC 3B2UC 3BPLB 5I66B 4JZNA 5J13B 2FLBT 2VZVA 3LPGA 1QRKA 2LU4A 2A9ML 4Y5YA 1U3YA 3IRZA 4L3EA 1T03L 4MA1C 3HC0B 4P5TB 4K3DL 2DQGH 2XZCH 2AP2A 4JQIH 4OSUH 5GQBA 3DVNB 4XNUL 1WZ1H 1AQDB 1NKOA 4X6DA 2L7UA 1KJVA 4LGRB 5LCVH 4UDTB 3DNKA 3GJFA 4PJ7A 3MGTA 3TA3A 3GIVA 3OXRB 2YRLA 4M6OH 2YD4A 3B5HA 3GJEB 4F7MB 2FZ3A 5IHUL 3UJJH 1E4WL 1OTUC 4FRWA 4P48A 1A6WL 1XR8B 4YXKH 1BVZA 1FLRH 5TQ2H 4ZPTA 4R96B 5KJRH 1II4E 2FWOB 4G9DB 2NY2B 5L2KE 4LVNC 2A83B 2QSTA 5CP7B 5IVOA 3WN5C 3BP5B 3C5JB 1BJ1J 3QJFA 3U0PB 1NCBH 4GAFB 1W72B 5D8JH 3SGDH 5D5ME 5GSRB 3NCFB 3EDJA 1X7QA 1EGJH 5MERB 1LK2A 3C8KB 2QSCL 2YN3A 5IUSA 2A6IB 1R3LA 2ESVD 2VWEE 5SV3A 1JWSA 2R4SL 3PP4L 1E6OL 2IQAB 4MNQE 2HKHL 4HZLB 2YUZA 5DC4B 4MGXA 3T3ME 3HUJE 5E8NB 4OD1H 5DD0H 4QHKI 3WLWC 4HC1A 2UY6A 2QQLH 3CFEA 1N6QL 4XBPA 1JK8A 3RL2B 3OJ2C 3SDCD 4PGBB 3TH2T 3VGGA 4MJ2A 3G04B 4LU5H 3BX7C 4NO3B 1BGXL 2D7MA 3QA3A 2DD8H 3Q6FA 4JFOB 3B3IB 3QFDA 3I2CH 3QNZB 3BDBA 4GW1A 4Y2DD 1XGYH 1MAMH 5ACMA 5KSAB 1JGDA 1P2CB 5IIEB 4C58B 1HSBB 4ORGA 5CBAA 3VMPA 1MY7A 3CLEH 2AJUH 1DUYB 2FYYB 1H8OA 4KTEH 1XF4B 1C08A 1G0DA 2APTA 4MD0A 4CJ1A 4X83A 4PRID 1KB5H 1OGAB 1PJ9A 2B5IC 3S35X 4OLVH 5B8CA 3TPUA 5J6HB 2Y5TA 5BZDA 4NRZA 4UAOC 3V2AR 5F1KC 3X12B 4F15C 5GS0H 1FVDA 1G9NC 1MWAA 4GAGH 4PYGA 1P4BH 4KI1A 3TP4A 4DKDC 4XNQA 1G7LA 1AGEA 4C83A 1S7VA 4U1HA 2DQTH 3DO3A 2IPKB 3L1OH 5J06A 1QRND 2CKBB 1W0VB 3GZKA 5DLMH 5JW4N 3TZVB 1HEZB 4O58H 4WV1A 3U0WL 3U4EB 1JCKA 2JCCA 5IMLB 2NTSP 4UDUB 5FV1L 3TT3H 4MNQA 3T3PE 1RZ7H 3HE7D 2ESVA 3AY4A 4KV5E 1F5WA 1NCWH 2ENYA 3QDJE 5F88A 4KRPD 4GW4B 3MO1A 4B41A 4BQ8A 4PJXE 4PRPB 5FA3B 1CD1B 1UYWL 2NY4B 4L4VD 1WBXA 5IW6B 1EMTH 1T0MB 1AO7B 3GMPA 2F9BT 1NC4A 3EKCA 1GIGL 4HFWA 4MJIE 1BLNB 3WNOA 3CDYA 3D18A 3T4YA 2FSEA 3OL2A 3MV01 5H94A 2PXYB 4YHZH 5IROC 1JGVH 4PBVC 3O2WH 2DQIH 4JY5L 4HIIB 2WIIB 4PTUB 5DD3L 1MRCL 1JPFA 1T1YB 1CDJA 2VC2L 4Y2DA 4QRTB 3TEUA 1A1OA 4YZFF 3H9SE 4QKXB 3CNKA 4ZUUA 2NNAA 5EA0H 1WBYB 2V2XB 3MRLA 3RWEB 2DQFB 2GCYB 5C0DA 2DTML 4KRMB 2C3HA 3INUH 4LSQL 1T22B 1F4XH 2BFVL 1G7QB 5CEZL 4PRIA 4W4OA 2GSIA 4KGLA 1U42A 5DSCB 5GZOC 3QDGB 5ILTL 4KHXL 1UEYA 5JHDD 2FO1A 1YPZE 3RVUD 2DBLL 4DW2H 4I5BB 4LVOC 4EVNB 1FFOA 1A6UH 1VPOH 4JAMA 4DVRH 5JR1L 4YR6B 5TGBA 4Y1AE 4LBEB 4O9HH 3WUZA 1V5JA 4R7DA 5C86A 1HNFA 4XHJC 5CCKH 3PWVA 1QRNA 3OR7B 1OAQL 1DUZA 3ECBA 1P4LB 1MCKA 1LO5B 2CRYA 3C5ZA 4R4NC 3WLBB 1UA6L 4OZIF 4D9LL 1SJHB 4PJXA 1CXHA 4EQ3A 3PF2A 2PO6C 3HE7A 4PGEA 1T5XB 4R2GC 1P9MA 3VA2C 3NBNA 4PR5B 1FDLL 4AEEA 1HOCB 4RMTA 4M1DL 3KWWB 4MJIA 3V8CA 3LD8B 4LIQE 1KYOK 1HSAB 4TOYH 3P4LA 4L4VA 3CCHB 3ZKND 4X4YA 3KLHD 2Z4QA 4RAHA 3CGTA 3AS2A 1WV7T 2DLFL 2BSRA 4MDJA 3ARFD 2EIBA 5ITFB 1PEZA 3VD7A 3Q1SH 4FQ1H 3OTTA 2NMSA 3VFOA 1INEL 4X7TB 2EYRB 3KLAB 2DQUL 4ODVH 2VDNL 1DLHA 4MB5A 4UT9L 1BQLL 4K7PH 1IAIH 4OM0H 3HMWL 4G7YH 4NZDA 2BY2A 2X41A 4NN5B 4FS0A 5DWUL 1YYML 4ZTPH 5C0AD 4NRYB 5INDB 2PYFA 3B9AA 3WHXA 1AGFA 1IKFL 3BQUB 4NT6A 3BMVA 4TVPE 3H8NA 1NLBH 5EFIA 3DX6A 5T33L 4G6FB 2NY7H 1AFVH 4FFYL 4JFED 4DKFL 4K8RH 4PRBA 1RQ5A 1MFBL 3HC4H 4U1GC 3PQYB 4G3YH 5C6TL 1IQDB 4P46B 2NW3B 4GKNA 1DCLA 3B9KB 3GUTA 5KAQF 1OAZL 2YMXL 5JHDA 3RIFF 2AQ3A 2NY3B 5HJ3A 1OARL 5E6YA 3MNVA 9CGTA 4R7NA 2F54E 5HHOB 1J0JA 3MUGA 1DANT 1TQCC 1UXWB 3NAAH 5DRZB 4FZ8H 3U30C 5C0BE 2C3VA 3FJTA 2DYPD 3IAQA 4MAUL 3UTSE 4ODTH 5E5UB 5CEZD 3MRHB 4LAJH 4I3RH 4KKAD 1T4KA 4AG4L 3MNZA 4P5MB 4L3AA 5TE4H 3G6DL 1AKJD 4PJIA 2NY6D 1FNEB 3UCRA 5EO9A 1HKLH 3F7RA 4WEMB 3CU7A 3CIQA 3GMLA 4LNRB 3VXNB 2C7UA 5DR5H 3HMXA 5FOJA 5IM7B 4WO4C 2ZCLH 1FAIH 4BZ2L 4TN9A 2WP3O 1QLFA 2VKWA 4J3UA 4PGDB 4PTTA 5JXAL 5HPOA 1B0RB 5TPWL 4XC1H 4OFYD 1FO0H 1MCEA 1OB1B 4OGZA 4QXUL 4A6YL 4LSRH 4LOUD 3D25B 5DTFA 1AIFA 5AWNH 3O3AA 4KWUA 4MXWH 2EYTB 4QLRA 3BHBA 5HGDA 4BH7A 1RJLB 4E5XB 4Y4FD 3GBNH 3GSXB 4U1SA 5IESL 3EDFA 4HH9A 3V0WL 3E6FA 4WWKB 3EYOA 3BAEL 1KPVB 3ISWA 3MXWL 1QYGH 5IFJB 2H41A 2W0FA 4NKOB 4P57B 3SGJC 1BFVL 5C0AA 3MUJA 5IJVB 1A3RL 1RZKC 3DV6B 5L7XH 1G6RH 2VXSL 3ZTNL 2X9YA 2YSSB 4JQVA 4NC1C 4KK9D 4WHDA 1LO0L 3H42H 1ZA6B 3W0WD 1C16A 5DD6A 3VFVA 3QWOB 2ATPB 2P5EE 2G75A 2OBGA 3QBTB 3C87A 3IDJB 1FC1A 4RGOH 3TBYB 2R0ZL 4OM1H 4J4PC 5C0BA 2KDGA 5IEHA 4U31A 3UTSA 2GTWA 1BZ7B 4RGNC 4M7KL 1YY8B 4WNQB 2LAGB 2GJJA 3GO1L 3OF6A 1JTPA 1GGBH 3OXSA 2VDOH 5ETUB 4N1HB 2BX5A 4YUEL 4UQ2B 4PP2B 1UEMA 2AJSL 2AJXH 5T1DL 4LKCA 4JDZA 5KSBA 1CGSH 1AY1H 4LARH 5K9QG 5I1KH 4R90L 1A6VH 5H37G 4L4TB 4UT7H 3C9NB 5C0FB 4JB9H 1OAXL 5T3XL 4HGWB 2D0GA 3VFGL 3ZTJH 3Q3GB 2XN9D 1E4KC 2BVYA 1CG9A 1B90A 1U8HA 5GIRA 2VQ1A 5IQ9A 4CU8A 4OFYA 3WS3A 5CGTA 4ZO7A 1FFRA 3MOQA 5JO5B 4NZJA 3OMZA 5FCSH 3QULA 4XNYL 4P2OD 3TO4B 3TN0D 4F58L 3DGGA 3EYUL 4NQCE 3T8XA 3QXDA 12E8L 4U0RB 3F58L 1T1ZA 5I1LA 1ZGLB 3TJHD 1GH7A 3DIFA 3WL9B 4WDIA 4Q9QH 3BUYA 3VXRD 2VISB 1RUKH 3V7AG 2ITCB 5AYUL 5DJCB 1F3DJ 1VADB 5F9AC 4JKKA 4YGAB 5D7LE 5D2NB 3FQRB 1S7TB 4WHYG 2QJDA 1LO4L 2MCG1 2Y6SC 4HUKB 3W0WA 1ACZA 3MRDA 4DTGH 1KACB 3QIUB 3D2UB 3IDGB 1PY4A 4OGAC 2CLVB 1ZT4A 4Y16C 4XVJL 3MYZA 2YWYA 1KIQB 5LAXA 4OI9A 2D7NA 1I8IA 2CGRL 1Z9LA 3A0OA 1DL7L 4W6XB 3DVGB 3AREB 1A9BA 3FB6A 3OZ9H 4JY4A 2FRGP 4O4YL 4XCNA 2DAVA 4X98B 4O00A 1N5AA 1QSVA 1KTLB 4U3HA 1ZAGA 5DHXB 2P8PB 4HS3B 1QBML 4KUCF 3SY0A 4Q0XH 5LQBH 3KPNA 4CVXB 4WW2A 3ILPB 2C9AA 4GAJH 1I4FA 5DMKB 3DRQA 3G5YB 1A7BA 1WWWX 3M17A 2GFBA 5ESVA 3ETBF 1ADQL 1HHKA 4RIRA 2YK1H 4L3CB 5A43C 3P11L 4FP8L 4OGXL 2LQRA 4P9HL 2RCSL 1EEQA 3QHZH 3IFOB 4N8VB 4GG6A 4IOSD 3RTQA 1QO3A 3FB7A 2ICES 2BXZA 2XPGB 3N9GL 5D7JC 5T3XD 1MELA 2EE9A 3VCLB 4OZFA 3HS0A 4P2OA 3TN0A 1G9ML 1TPXC 4X7FC 2AXGB 1RZ8A 4U4BA 4V2BA 3CFCL 1UKTA 4WI4A 2AEQL 3DUHA 5DVMA 4WI8A 1LNUA 3WIHH 5FDWA 4A6YA 5D7LA 1W0WB 5GRUL 3VXRA 1A6PA 4L5FH 4D94A 1WGOA 1QA9B 4PJ9C 3TJEL 1LD9A 4PJ5B 4MQXD 3P4OB 1JNLL 3I6GA 3C08L 5ISZE 3U36B 5CBEB 2DM7A 2J88H 1BF2A 1IGCH 4ZMAT 1EJOH 3D0LA 3MODH 5TFSH 5K9OA 3FL7A 3QO0B 4JLRB 2E7HA 5IMKA 4I18B 4X5WB 1XR9B 2ZOKB 4OCYL 3WKML 4XCFH 3ESUF 1C5DB 3VD9A 2H8PB 3MREB 43CAB 4XP9L 5I1AB 3ZO0A 4ELMB 3ES6B 2HP4A 3LKOA 2ZNXA 4PREA 5DJDB 3QUYD 5E99H 3MLYH 3DO7A 3VWJC 2Q6WA 3LOWA 3CD4A 3JSSA 4OD3H 4QRRE 2NY0C 1DR9A 4TQEL 3MRMA 3LEXB 3DX8B 3REWB 3ARDD 1PKOA 2ICWB 3OQ3B 1S7SB 2P7TA 3P2TA 3TBSB 2UZYB 2OYPA 2HTKD 3RGVD 2BVQB 3BD4A 1MHHA 1FYTB 1FVCA 1T0PB 1O0VA 4V1DB 2W65A 5E4IA 5KZCD 1ORSB 3QCUH 2FX7L 1X5JA 2BDNH 4KUZH 4UNUA 5C09E 3OR6B 3DMMD 2XNAA 5GGRB 2DQJH 4DOHE 1XGTB 1C1EL 3VDAA 4PV9B 3OJDB 1KUMA 1A0QH 4R0LA 4JFFB 4ZG1A 5B4MC 2ZKHH 2GY7B 3K46A 2JK5B 4HLZH 4Q2ZB 2R2HA 1JFQH 5MEPA 3RL1B 5IBTH 3U7WL 4YBQC 4BUGA 5DFWH 5MP6H 4YZFE 3N50A 4HIJB 4HHAB 2H3NA 5IBUB 1YJDL 2X1WL 1P7QD 3ZKMD 1P7KA 4NNXB 3L3OB 2EDRA 4Y8DC 3SOBH 5BV7C 3MBEC 1MRDH 3V5DA 1K5NB 3KXFD 1GZQA 4F7PB 5C9KA 3D87B 3MJ7B 1KEGL 1U8KA 3O6FC 1RFDH 4HF5L 1U8OB 1X3DA 3NH7H 3T0VA 1AGCB 1RZJH 2DM4A 3RU8L 4M7ZB 1ZHBB 3AXLA 3ULUF 1HDMB 1YEKL 2VXVL 1P7HL 4O02H 5CIPA 5DK2B 1HYSD 4HXBH 3M1BA 4PJDA 4HXAH 5E2WH 2VDLH 1CL7L 4U0QB 4X6BA 5HYJB 2EC9T 3G6JA 4GKSB 3QUYA 1RUAL 3K8MA 4ETQB 1S7UB 5CMAA 1DSFH 2MQCA 3BWAA 4U6HA 4PB0L 5E6IB 4MWFB 3ARDA 4IRSD 3T2OA 4LSVL 5L2KB 4BFIB 2PCPB 2VDPH 4TUJB 2VB5A 3T2NL 2IADA 2YKLH 3CDGB 1RI8A 2X4QA 2OQJA 1F4HA 3MOBH 4UI2A 5D5MB 3FO1B 4NRXA 4O2FA 5JLZB 2YD8A 3I75B 3MRJA 2EDFA 3HR5B 1PQZA 1HYRC 4HEPG 3P30L 3ZT6A 1KLGB 4NQVA 4YDLB 1U91B 3D85B 1XF5A 4K7PX 5EN2B 4WFGE 4ISVA 1ADQA 1NBQA 4P99A 5CLTA 5DC9B 1IGJB 1OGTA 1OL0A 2R2BA 1P7QA 1MJ8L 3H0TA 3WDIA 2Z93A 1KXTB 2BVPB 1CFVH 1D9KC 3B8YA 4S1SH 1LEGB 4MA7L 4CDGC 1UM6H 1X5HA 3KXFA 3NZHH 4L9DA 4OZFG 3U0TA 5I18H 3LQAH 3EYSH 4KI5F 4KMLB 3QDAA 3H9YA 4LHUB 4U1JB 3K2UL 2D4DA 3ROOB 3UYOD 3P0YL 3NOIA 1A6TB 5F89A 5GJSH 4OZIA 5DMIH 4HUVA 3DRTA 4X99B 4E41D 4K71B 3IU3A 3PDDA 4HWEL 4Y5VC 1MLCB 3VXPB 1F2XK 4XAWL 3UDWC 4QHNA 5TQ0H 4JFPB 5GISL 2VDKH 1MF2L 2FEEL 3PE9A 3P73A 2R39A 4ODUB 4OFDA 2H2SD 4OZGA 3BD5A 1OPGL 2EE2A 5FYKE 4IOFD 1GSMA 1AXTH 4IRSA 2PW1B 3RA7H 4QOKE 3HG1D 2PYEB 2A6JA 2NY1D 4Y2OA 3EO0B 3KYKH 3DROA 4QRPD 3S34H 2OXGA 1HINH 2A2QT 1KPUB 4ZSOE 2MSPA 4F37K 4KJQD 1ZHKA 4LPTA 1BX2B 1PZ5B 4JO1L 4MS8C 1TLKA 3QDJB 1JF5A 5IW3A 5DVLA 1G7JB 2E7LA 4Y5XA 4RNRB 1MPAL 3BKMH 3FQTA 5F71A 3V4PH 4U1IB 4RMVA 1KCSL 5TF0A 4PP1D 5FIEA 4IRJA 5HHMD 1CBVL 1MNUH 7FABH 5K9KA 4JRYD 2PTTA 3O3EB 4TSCL 1HZHL 1G0XA 3PWNB 1M71B 2P1YA 1QOKA 2M1KA 1AR1D 5CP3H 4AEIL 2B1HH 2ARJA 3HZYA 2IAND 3X3GH 1KJ2L 2F53E 3CX5J 4YHIA 1PVHA 3MV7D 4LCCB 4EN3D 3AM8A 2PR4H 3L5HA 3QH3A 4PFEA 3ARWA 4KRLB 4RBPH 4C54A 4FXKB 2RR3A 2W0PA 4L8SA 4E41A 4WY7H 4XPTH 2V2WA 3C6SB 1CQKA 4KK5C 1BMGA 3BPNC 4UMGA 4UINH 1G9NL 2G5BB 5LGKA 4AZ8A 4Z7NF 2WZPD 2V2TA 1WZMA 1YPZB 1BQHA 4ZOCA 1KEML 2A9NH 1WICA 5JW3L 4LEOA 1UADC 3GJFH 4FTVD 1MVUB 4G6JL 4LCYB 3CC5A 1OTUD 1CDYA 1RZFL 1U95A 3UJIL 2HTLC 3WS6C 4Y1AB 3NABL 3LQZA 1I1YA 3F62A 2N7BA 4YO0A 3LKRB 3OAUH 5L88L 4F7CB 4ZD3H 1AI1H 1KXQE 3HG1A 4ZSOA 4OLZL 2FIKA 3DI3B 3T0EB 1CL7I 3HI5H 3FFDA 3GNML 4ZPVA 1YEJL 2I5YL 4XPGH 2G9HA 2X42A 4UIMB 2YD3A 5F9WB 4MD5B 4QRPA 4L1HA 4Q58C 3KYMA 4HIHA 4UOJA 3W2DH 3I9GL 3JV4A 4OGYH 3QUMA 3CLFL 3GBMH 5DT1L 1FZJA 2LFGA 4MQ7B 1SYVA 1FFNB 1OP3K 3AVEA 5GS0C 1N26A 3LRGA 5C70A 3SDDB 3QB7C 3PGDB 1BFTA 2JIXA 5ALBL 4KKCC 1HK6A 4NUGH 3H7LA 4XCYA 3HRZB 3MMEA 3QQ3A 5L9DH 1EBAA 1NSNH 3SN6N 3WLWD 3HA0A 2AJ3A 1T5WA 2FGZA 2IANA 3O4LD 4HC1H 2IAMC 5F9OH 2EIEA 2F58L 3O3DA 3VXQA 1KCKA 4DKAA 3MV7A 1ZS8B 4F57L 5D6DA 4EN3A 3WSQH 4FNLL 4KRNA 1U8LA 3A67L 3EGSB 1OCWL 3HZMA 2R2CA 1KFAL 2W0KA 3KPPA 3LHPH 1NCAL 4ORZC 2OJEB 3V0VA 4CMMB 4M43H 4J6RL 5FEBA 5K33A 2E7CA 4I77H 3S7GA 4JE4B 3MLXH 4CU6A 3MRFA 3MOAH 4Z7WF 2HVKB 3WFBL 3VH8A 2IGFH 3BXNA 2XZAH 4XVSH 2G60H 4NQEE 2F54B 4EI5A 4FTVA 4D8PB 4FQJH 1G0YR 1VESA 1TQBC 4P4RB 1Z5LA 3MA7A 2R4RH 3WFZA 2NQCA 3O8XC 4X6EA 3QAZC 4AIZA 5DGQA 3LDBB 1TZIA 3WN5A 1K8IB 4NN6C 2BJMH 5EBMB 4WI5A 2AVGA 4YEFA 2FEEI 2AI0L 3BT2H 4J3OC 4N0CC 4APQB 3OBAA 2W91A 1CK0H 4ZFGL 3E1F1 1W8OA 4G42B 2Q8BL 2YD1A 5GXBB 1YEFL 1DQMH 1R24A 4KVNL 3BGFB 4M62L 2YC1A 2VLJE 1J8HE 4K23H 3QRGL 2YUXA 3IDNA 2AK1H 4PD4J 5HHVH 4MQTB 1A4JB 3V5KA 5I1IH 1QUNA 1NFDB 1ODAA 4M6ML 1VGEH 5INCB 3FTGA 3OB0K 4MD4A 1LO2L 3GRWL 4FQPA 1KCVH 5FGRA 4HGKC 4LF3A 2NXYB 1MOEA 4O5LL 1GC1H 1JNNL 5MHSE 1EPFA 3RGHA 2HVJA 5EC1B 4O2CA 5AZEL 1KSRA 1QHPA 1OT2A 2P5EB 4H5SA 1NGQH 4WTXA 1RZIA 3CMOL 3U46B 4ZS6C 3OHXB 4H26B 3LN4B 1WZLA 4G6MH 4MXQD 1B0GA 3PDOB 3N1FC 2FX8H 5GZOD 1HQ4A 1BZ9A 1ZHLB 2BY0A 2NZ9C 4P3CH 4D0CA 1T03H 3CAFA 3LAFA 4ZTOL 3K8KA 5C2UB 5J13C 3QEUB 4N9GB 1L0YA 4HKZA 4ZUSA 5H37H 1BQHG 4G8GD 3UBXA 1KOAA 5EBWA 1NGWB 2DLEA 2HT3C 4Z76A 4LCIL 1FL5B 1S7XB 2Z9TA 4XHJD 1S3KH 4DGYL 3CVHL 3UBXI 5IHUH 1CF8L 1CXIA 5CJOH 2UUDH 1E4WH 4PJCF 4R4ND 5IHZB 2C1PB 2VR5A 3NCMA 3T04D 1OAUH 2UVFA 5IOPB 4LCWD 2PO6D 4JJHA 2W07A 5D2LB 2XA8H 4LSSL 1BOGA 1R3IH 1LILA 1SMOA 3D39D 4C56D 2BSSA 4N0UE 5T3ZL 4ONFL 4NQCB 5FGBC 5DA4A 1EZVY 5IW1A 3NTCL 5E08L 3IJSA 3KYAA 2LABA 4UIKH 1RZKL 3LV3A 4J3VA 4K2UH 3IJHB 3MZGB 3WFDL 4WHYH 3IFPA 1R3JB 1A02N 3PP4H 1E6OH 3RUGF 1SHMA 5C07E 4JANA 2HKHH 3PL6B 1FSKC 2B7DT 1MCPH 4P9ML 3ME0A 1Q72L 3PHQA 1BBJA 5CSBA 4LASH 4C4KT 5DQ9B 3CPLB 4L9LB 3DTXB 2B1AL 5IEKA 1NAKH 2BCKB 1HH6A 4F9PC 1FGNL 4QGYA 4U6YB 3RRQA 5EC2A 4U1MA 3V7MA 1C5CL 1YN6A 4AY0A 1L7TL 1UKSA 1XCTB 4NDMA 4LLVB 2Q87A 1RZGA 3VXMD 5HGHB 1RMFL 4CAGA 4X5XB 3GEWB 1BD2E 4M61B 1PZUB 1RPQA 2CDGA 4JZJB 2VXUL 4XP5H 4G8GA 2W60A 4LKXA 3TWCL 3VWKB 2VZSA 3MRPB 5I30H 2OCFD 5F96L 4UQ3B 3GIZH 1NMCB 2GK2A 5BRZE 3L5XH 4CVZB 1KPRB 3FQXA 3D3VE 1CIDA 4KI5E 5B22A 2R23A 3WFEL 4WO4D 1A3LL 3MX0A 3HMXH 1F00I 4LIQH 3DETC 1QG3A 4HWNA 2AGJH 3SCMB 3D39A 4C56A 2F5BL 2QHRH 2A74A 5CD3B 2BRQA 1KJMB 1T80A 1WFOA 3K1DA 3O6MH 5GGSY 3U0WH 3QEHB 3VG0L 1A2YA 3PWPD 2AJVL 1DEEA 5DURB 2BNQD 3WFHB 2LU3A 5C07A 1CGVA 1I7TA 2NTFB 3TZVC 4DZBA 4MX7B 4DK3A 3BDYL 4ONHB 5CAYB 3CZFB 5T3ZD 5HYIA 1FNAA 1JGEA 1RULL 5ISZB 5I8EA 2ICEB 1UYWH 4NOFA 3GDBA 2J4WH 3H3KA 4JDTL 5JPNB 4HWBA 4YAQB 4MA8L 1WAAA 2VLKB 2Q8AL 3B9EA 1GIGH 4MA3B 5I1DA 4Q74A 5CWSA 3RDTB 1Q94A 3TT1L 1G7HA 5JOPD 2VABB 1Q9OA 1XGUB 1T04B 5FKPA 4HH8A 1CFTA 2C3XA 1I9IL 3GSNL 1PKQA 4JG1L 4WU7A 3VRIB 2WQ8A 4W6WB 5B3JF 3QQ4B 3EOYG 4R4BB 3H7BB 4XX1G 5CZKA 3FQNB 4J4PD 4QRRB 4BKLA 2XKNA 5HPMA 5IF0A 4NKIL 3EYQC 4RGND 5IT2L 3VXMA 1D5BA 4HSQA 4BH8B 2CD0A 1UG9A 1DBAH 1AD9B 5FYLE 3RIFK 4PV8A 5C0GA 3L3HA 2KH2B 3MJ6A 2DI9A 4LSQH 2IBZX 2QEJA 4IJ3B 4OLYL 3T1FB 3QHFL 1I9RL 3PIQA 2EXYC 4GRLB 3QIBA 5C09B 4EIGB 4XMKL 3P9MB 2ZUQB 3KG5A 3TCLA 3O0RL 5BS0D 2W9EH 3IDXL 4DOHB 1OQXA 4WTZA 5CINH 4Y4KB 5K9JH 5JR1H 3UBXG 5IFAH 1RJCA 5FF6A 3FO9A 3G5VA 4YX2L 4J12A 1MAKA 1EJ6A 4HPOH 2P5WE 5I17A 5HYEA 4PY7B 1ES0B 1MAJA 4I9WD 2LVEA 4LLWB 1IM3A 1OAQH 3DARA 4QYOA 1UA6H 2P8LA 4POYA 1LDPL 4R4FL 3PWPA 4Z7NE 2FIRT 3RY5A 3O41A 5CILL 2BNQA 5ABDE 3NPSB 2HFEA 4X80H 3KPRE 1S7RB 5D6CB 3OAYK 1FDLH 1EEYA 2LTQB 1IAKB 4CW1B 3LN5B 4M1DH 4JPKL 4L1DA 1A6ZB 4PRDB 5GRVL 2BOBA 3SGJA 3VXOA 1S78C 5DQDH 3MLWL 4XHQA 4PGJA 4PJ8D 2B2XL 2W0LA 5EBLA 1U92B 3VFRB 1U3HB 5DJYA 1YEEH 2Y6SD 4O51B 1T20A 5FB8A 1K2DB 1NAML 4HPYL 2FJFA 5IMMB 2GJ6A 5HHQA 2D7QA 4UT9H 3QWQB 1A64A 1BQLH 4OGAD 4Y16D 1TNNA 4P2RE 3VI3F 3RNKB 4H8WL 3U1SL 4YWGH 3QUZC 1YMHB 3K1KC 4J4PA 2QQKL 1EHXA 2XQYK 4WCYH 5T33H 2X4TA 4JGJA 3T08A 5EU7E 1U8IB 4JREC 3D1MC 4PJBF 3MLUL 4MSWB 1U8PA 2R0KL 1EIBA 4IS6B 5GSVB 1AE6L 5D93C 4WENB 2FGWL 1CE1L 1SYSB 1X5IA 1K4DA 4YHNB 4WHTA 3B4NA 3BIAX 1REIA 1VFAB 1FN4A 5D1XB 2YMXH 4GJTB 3C2AL 3MZTA 1OARH 4CNIB 3EJZC 4P46C 5BS0A 4TUOA 1KELH 1HHHA 1I3RA 5EOCL 1RUML 1CFBA 2ZCHL 5ENWA 3ZKXC 3CFDA 5JNYA 3DUSB 5I1JH 5DRWB 4J8RA 3VD5A 1E4KA 4Z7VF 2IALA 1NUFA 5IB5A 2XY1A 3FT2B 5HYSB 3O2DA 4AG4H 5DHVB 5BV7L 3G6DH 2YPLD 2XTJC 4QRUB 5D7JD 3QCTH 2HYMA 4NWUL 4G80B 3G5XB 4HD9A 4YPJA 4Z7WE 3PJSB 3G6AA 4OZFH 3HPLB 3KR3L 2X4OB 1HHGA 4EUPA 3MROA 4MCZA 5GRZA 1CT8B 5TPWH 2AK4D 3D0VA 2WBJA 3O81A 4MZ3A 3PWJB 4X4MA 4YXLH 4PJ9D 3CFKB 4XXDA 3V79C 5H8DA 4HK3J 1OTTC 1B6DA 4HS8L 4CUCA 5F70A 1IEBA 4PJ8A 2UWEA 3IS0X 3AAZB 5DVNA 3KLSA 3L3GA 4RISL 1RJYA 3S88L 3BW9B 1VB9A 2SEBB 3OGOE 5BMFL 5E8PB 4G9FE 1MCLA 3BAEH 2EDOA 1DQQA 2O5YL 1ORQA 2Z35B 4PJGF 4I0PB 4Y16A 2VLRD 1AGDA 2QTEA 3MXWH 2BNRD 3TV3L 3TYGL 1CCZA 2BC4A 5GGVY 4JFYA 1VEMA 4OZHE 1F02I 1F3JA 1H3VA 3CH1A 3VWJD 3NVQA 2VITA 2NY0D 1LO0H 5BXFA 4X4ZA 5JQ6H 3GSNA 1S5IH 3QXAA 1RZJC 4IIQB 4QOKB 3KYOA 3STZB 3KAAA 4D3CL 5CS7A 5KVGL 4KY1H 3DVFA 1JV5A 2XFXA 4KROC 3MUHL 5D72L 1JUFA 4M7KH 4YK4C 2XN9E 1QFUL 4OJFL 3DUUB 3GO1H 5DJ8B 2ADIB 1JL8A 3EDEA 5HGBA 2X05A 3ARGC 1JPST 1OAYH 4YDKL 4KKLC 4HMEA 4BYHA 2JE8A 1I1FA 5LXGH 2AJSH 4ZAKD 3VD3A 1SJVA 4OFVA 5B4MD 5C0EB 2UY7A 2YPLA 4H1LB 5D7JA 5ESQA 3KGRA 5FKAB 3UTTE 3LSOA 2FHFA 4RMQA 3C60A 1INDL 5T3XH 2YZ1A 5IMOA 3OGCB 5E2UL 1ZHNB 2EH7H 1G7MA 1MREL 2I9LA 2ADJA 3MBED 3VFUB 5HI4C 4J3SA 4XVTH 2AK4A 4IDJH 5HI3C 4Z78B 3I50H 3QIWD 4MVBC 5T1KB 4OIAA 3BJ91 2EEBA 2VUYA 3DI2B 4GT7A 4PJ9A 3O9WC 4MJ4A 3O6FD 4G6KL 2VXQL 4F58H 2D03L 2K1MA 5I0ZA 4WFHD 4QY8A 1JWUB 5FYJL 1L6XA 3EYUH 5JDJA 3R8BB 3EYVA 5LGJA 3LH2H 2HFGH 2ORBL 2XOTA 1F97A 4XWGL 3NFNA 5LBSL 5JUEH 4LSTL 2VLRA 5K59F 2BNRA 3H9HB 1WK0A 4PJCE 1WBZB 5CIPH 1CGXA 3QFJD 5ITBH 2V9TA 3QJHB 3LQAC 2V7NA 4XP1L 1LO4H 2DQGL 2XZCL 3LS4H 4JQIL 4OSUL 2Z91B 3F8UB 1NDGA 1Q9KB 4Z7QF 2L0DA 4XCEB 4XVJH 1N3NB 2CGRH 3IVKB 4M6OL 4LVHC 1XGRB 3RWIB 4NC2B 3UJJL 4TYUA 2CLRA 3IF1B 3BSZH 1UXSA 3HE6C 5CSZA 2GJZB 3SE3C 5FYJU 2DI8A 1LP9B 2DLTA 2HG5B 4D0DB 3KPMA 4NKDA 3RUGE 3UTTA 3UTZA 2V9QA 1BVLA 4ZAKA 4WW1B 2ADFL 1NCBL 4RWYL 1XGQA 1AHWB 5IV2A 2BVTA 3UTPE 5HGGS 3Q6GH 5DJ6A 3VXUD 5E1AB 2FB4H 1NBZB 2DWDB 4LPXA 3W9DA 3GSVA 2EEAA 4WEUD 1ADQH 5TDNA 1IKNA 1BJMA 3RBSA 3VGFA 4OGXH 1LO3L 1NKRA 1NC2D 5CJ8A 2Q86A 4YHPB 3MBEA 5SX5H 3TNMA 2ITDA 3ROLA 1MCIA 4R26H 3QIWA 3CK0L 3N9GH 4GRWH 5C2BH 2ZOLA 3QSKB 4Y5YB 3ARBB 4L3EB 4AT6A 3RWDB 1WWCA 4OD1L 3GSRA 4EUPG 1I1RA 4PJCA 2AEQH 3SGKC 1ZOXA 1Y6NR 3TA3B 4BQBA 4M8QB 2WNGA 3K4ZA 3U7AA 3RZCC 3IKKA 1QVOB 2K7PA 1A4KB 3TJEH 1B88A 2OL3H 3VMOA 3QFJA 3I2CL 4NQEB 1MCSA 1XGYL 1WT5C 3C08H 1MJUL 1C8PA 4P23B 1Q38A 3MYJB 1WUNT 4K94C 3W39A 2AJUL 2QSVA 4KTEL 1MFNA 1J0IA 4ODSH 4Z8FL 2QHLA 2QL1A 4WFEE 4OCYH 3WKMH 1KB5L 4HKJA 1VFMA 5E7BA 5HY9B 3KPSD 1JGLL 1D5MB 4OUUB 4XAKD 4XP9H 5E9DE 2QV2A 5GS0L 3QEQB 3RHWF 1LWRA 1ZV5A 1BM3H 1S7WA 3L9RB 5AUMA 5DFVC 1YMMD 3QO1B 5BJTB 3ARTA 1IAOB 4NHUB 1JWSB 3QZWA 4MCYB 4MNHB 2DQTL 1AQKL 5FO8B 4CMHB 1NLDL 3CZJA 1H0DA 3IB4A 4GBXB 3ULSB 4IM8A 3PV6A 4ZYKB 2FX7H 2VLJB 1GPOH 3SJVE 2WUCH 3TT3L 2CIIB 1NC2A 1RZ7L 5ID0A 3VRJA 1U36A 3BP4A 3DWTA 4KJYB 5B3JE 1NCWL 2P46B 4DUXA 4NYLB 2EDBA 3QA3B 5CGYC 2UZIL 3QDMD 4ZFFA 3VE0B 1ED3A 3QFDB 2E7MA 4GW1B 2YZ8A 5CJBA 4XVUC 4GMSL 1Y6MR 2JJVA 2XWJB 3R06A 4P5KA 4M7JH 1TITA 5KW9H 4ORGB 4LSUL 1RK1A 2R15A 2RFXA 1YJDH 4HAFA 4EJ1C 1A1NB 4OCMC 1QSZA 2VDQL 1JYWA 4NZTL 4YGVA 3HN3A 3CXHK 1C08B 4Y4HB 5EZJA 1QLEL 5E5MB 2NPLX 3EZ8A 4FMKA 3H3BC 1JGVL 2Y5TB 4TRPL 2DM3A 2QKIA 1J05B 2DQIL 1KEGH 4Y5VA 5EZOL 1MWAB 5IFHH 1EXUA 5IB4B 3UDWA 3RU8H 1E6JL 1QSED 4MQSB 5FYKH 3TBTA 5EA0L 1AGEB 2BVUA 2XICA 4M7ZC 1G7IA 1S7VB 4GS7B 3K4DA 2HTLD 1CGUA 3KPSA 2LU7A 4WV1B 4DW2L 4JHAH 4Y0GA 2JCCB 1A6UL 1VPOL 3MRBB 4IMLA 2ESVB 2EKSB 1YMMA 3MRCA 3DHJA 4U6XB 5F88B 3B5TA 4QRQA 4JFDD 3QUMH 3T2NH 1WBXB 5B8CC 5E6ZA 5CCKL 4N0YH 1FL6B 1VACA 3W5MA 4ZUWB 4OLXH 5D7IB 4YXHL 3ULVF 4N0UB 3JVGC 4PJAA 3D18B 4YC2C 3SDCB 1MCJA 2DOCA 4AEHH 1EA9C 3FQUB 3O2VL 3VI3E 1DBJL 1IEAA 1YN7B 3QDMA 5I1HH 1BWMA 4KZDH 1KC5L 2IAMD 4QT5A 3SGDI 2VWEC 3WD5L 1MY5A 2L4OA 4ZUUB 4PJBE 1MFCH 4M93C 3MRLB 3R1GL 2AXFB 1MJ8H 2XQBH 4FFZH 2Z8WC 3Q1SL 4FQ1L 5BW7C 4LNVA 3IGAA 2KUTA 1BOYA 3KDMA 1RHHB 3QUXA 3HZVA 4NM4H 4FHBD 2X4SB 3O11A 5E1HB 1CE6B 4XTRC 4WUUE 4ZTPL 3RNQA 4JAMB 4U2YA 3P0YH 1S9WB 2YD5A 1P84K 2NY7L 1JF1B 2PKDA 4HG4K 1ZLUH 4F3FB 3HC4L 1WEJL 3I85A 2DM2A 3WS6A 1GC1C 2P24A 1QRNB 1OSZB 2MNUA 3O8XD 1Q9WA 3U7YH 4HWEH 4RFOH 3SDXA 1GYAA 1EHAA 3LRSA 1NGYB 1S5HA 4R6UA 5BRZB 1TCRB 2XXMB 1EO8H 4RMRA 2FBJH 1T7XA 3NAAL 4MDIB 3P4MA 1HI6A 5IQ7H 3MFFA 3VFNA 4JN1L 4KRPB 4WRLA 3R4DA 3BO8A 4I3RL 2DIJA 3KHOA 2OK0L 2VIRA 2OLDA 5GGSA 5TE4L 4NNPH 3TIEA 3LEVH 4W4OC 4JFDA 2CKNA 1LE5A 3AC0A 1QQDA 2Q1EA 4K9EH 1FFPB 1ZTXH 3AS1A 3SKMB 1F8TH 1HKLL 2BSRB 3L3DB 2A77H 4NGHH 5DR5L 1TXKA 3RVTC 2ZCLL 4HV8A 1U8JB 3V6OA 3QZWG 5C0CE 4PJGE 4AH2B 2EO1A 3BEVA 1T3FA 2AQ1A 5GRXG 1KIUA 2NLJB 4P3DB 2DMKA 1FO0L 5DVOA 4F9LC 4JFQB 4NT6B 5FUZH 1MPAH 1RURL 1DLFL 2IAMA 3BH8B 3C5ZC 3VFMA 5AWNL 5HHXL 4MXWL 5KS9B 1KCSH 4QCIA 5BVJA 3MGOB 1QZ1A 4JKWA 4B7IA 5TDPA 3GSWA 4TSCH 3HC3H 1HZHH 1FLTX 1Z0MA 4GW5B 4JR9L 2B0SL 4GKNB 4XMPL 5DEGA 1NANH 4KJPC 4S2SA 5EU5B 5TDOB 5JHDB 4RDQF 4Z7VA 1J87A 5HJ3B 3S8WA 3MNVB 4R7NB 4ZS6D 1TTFA 5F1OB 5EU6E 4Z0XA 3MV9D 4JRXE 4E0RA 1G6RL 3MUY1 2C3VB 3VGEA 4LPWA 3H42L 3SO5A 2VL5A 1U58A 3SKUD 2NZ9D 5HYQB 3MNZB 4ONGL 3WUWA 1FBIL 2BY1A 4PJIB 1NCTA 1UWXK 2O5ZL 1FC2D 4NKMA 3BIKB 3MBXH 2R2EB 1GGCH 1AGBB 4YNYA 2EDHA 1FG2A 3GMOA 5E5RB 5SWQA 5JOEA 4XNMA 1JJUA 1KEMH 2HT3D 2HJFB 4UU9A 1T6VN 1GGBL 1WIPA 2I60H 2VDOL 4PTTB 5HVHB 3SE9H 1MQKH 2C4FU 3UJIH 3CDCA 4U05A 1BPVA 2KZWA 2P5WB 1LVEA 1AY1L 2G5RA 4LARL 5C0CA 4BH7B 1IC4H 3RVUC 1M6OA 2CKBL 5FA4A 1A6VL 4M3JA 5I74B 5I1KL 1ZWIB 4UT7L 2GITA 1KGCD 3ARFB 1YEJH 4HH9B 4JB9L 5CD5C 3TESA 5JW4Q 2V7HB 2YEZB 4RRPA 4YHLH 3QI9C 5IGXL 4U1NA 5DRXA 3I9GH 3DECA 5K59E 4NO2A 2OTWA 2C1OA 3CLFH 2EDKA 3T2QA 2W0FB 4I8DA 4HKBB 1A7OH 1CFQB 3B8SA 3MV8D 4YIQB 1KT2A 4WJ5A 3VJ6A 3MJ9L 1MCHA 5ALBH 2WW8A 3NIDF 4JFEB 1KTRL 4IBLT 2IJ0C 4JM2F 2XACC 4Z7QE 2HRLA 3W81A 2CIKB 5JZ7C 5GGRY 5IHBA 3F7YB 4Q9QL 3RP1A 1RUKL 5IEHB 1MQ8A 4YDVA 3LKNA 4P2RB 2X4RB 2JB6A 3NN8B 3OXSB 4NQDD 1B9ZA 2DYPB 4J3WA 1OCWH 5EORH 2A38A 3N0PB 3PWUB 1KFAH 3QUKB 3S5LA 4L8CB 1NCAH 3WCYA 4J6RH 3BFOA 4JDZB 1AKJB 5I66A 4RMUA 4PYHA 2NX5E 3L5WB 3SEPA 3GKWH 1IM9D 3OZ9L 4V2CB 3HC0A 3RY6C 25C8L 3WFBH 2RQ8A 2IFGA 3DVNA 1NJ9B 2FO4A 1ND0B 5IB2B 1AQDA 2I9TB 4MYWB 1G6VK 1GOGA 1OGAD 5IVXF 3ULUH 3OXRA 1Z9SA 4Q0XL 4F7MA 3GJEA 4JHWL 4GAJL 5JXEC 1GGIH 3BESR 2Q3AA 4Z5RA 1XGPB 3DGGB 1I7ZB 1XR8A 4Y4FB 3DETD 1CDBA 4R96A 2QQNL 2FWOA 1E28A 1QPXA 2YK1L 2AI0H 5DUPL 5I1LB 4Z7WB 2A83A 5CP7A 2DTSA 3DIFB 1NH6A 5FGBA 3BP5A 4WDIB 3U0PA 4U6VL 4AM0B 1W72A 2LAAA 5ICZA 3T0DA 4FMFA 4APQC 5GSRA 3TZVD 1Z6JT 2ED8A 4N8PA 1BIHA 1JZ5A 3C8KA 3HKFA 1YEFH 3W0WB 5T1LD 2A6IA 2DQDL 4YPGB 3HB3C 1E27B 4KVNH 2ZSWB 4R3SB 4X8XA 1YQ2A 4KTDL 4ELMF 3N1MC 2W9DL 3NA9L 1NBVH 2IQAA 4G9FB 3TCXA 3QPQC 4HWBH 4HZLA 4JY4B 3BP6B 4M6MH 3REVB 3JTSB 4DZ8A 1AO7D 1RUPH 1LO2H 4QXWA 2CO6B 4MJ6A 4PRPE 3RL2A 4OZHB 1CLZH 1JVKA 1YEIH 2J88L 1IGCL 4O5LH 5IK3B 3MODL 5TFSL 3G04A 1CICC 1JNNH 5F6HJ 4R9HA 3FN0L 4NO3A 3B2VL 4PG9A 3SY0B 1TMCB 1SEBB 3EYQD 4WW2B 4Y19D 2NXYC 5AZEH 1ZLWK 8CGTA 1GZPA 2HLFC 4JFOA 1QFWL 3B3IA 3QNZA 3CMOH 2CK2A 4KK8C 5ESVB 5ECJE 5KSAA 1HHKB 4OV5B 4RIRB 1P2CA 5IIEA 1HSBA 4D0BB 4LGPB 3MLYL 3L3KA 2XN9B 4KK9C 1DUYA 5D96B 3UYPA 2EXYD 3WUWG 1QO3B 2E9WA 2I07B 1OGAA 1WLHA 4ZTOH 1KIPB 3MNWB 4DJMA 4LQ1A 5J6HA 1KBGH 2CXGA 1H8NA 3X12A 4DEPB 3GK8L 4QHKJ 1R5IA 1MCQA 3MGAA 3QDGE 3QCUL 3AB0B 4NP4H 2IPUK 1NCCH 1A7RH 4RFEB 4A6YB 3SE4C 2DQJL 1TZHB 4PGCB 1A0QL 2IPKA 1NDMB 2ZKHL 2CKBA 4XCCH 3IDYC 3GMNB 1JFQL 4UNTA 5IBTL 3TZVA 1HEZA 5MP6L 3U4EA 4M9OA 1X5GA 4LSSH 4HUUA 5J12B 5IMLA 3D0LB 1H9VA 3ZE2F 3RVXC 1TTUA 3JXAA 3UZEA 4DVBB 2HN7B 3BKCL 1S78D 4GW4A 1JGUH 3MLRH 1MRDL 3RTQC 4UOW1 4PRPA 4X8JB 5F72S 5FA3A 1CD1A 3LKQB 3LKOB 4PREB 3MJ9A 4FQLH 5IW6A 1AO7A 1RFDL 5HGAB 2Q6WB 5E8OB 3MCLL 1RZJL 1BLNA 2YA0A 4OAWA 3ILQC 3U82B 4AENB 1DBKL 1F4YH 3MJ8B 4NQXB 2DQEL 5C6PB 5C3TA 3I6LD 5C0RL 3QUZD 1S7QB 1MRFL 2R56L 4Y19A 4O02L 5FO7B 4DQOH 2V17H 4HXBL 4BFBD 3ULVE 4HIIA 2WIIA 4PTUA 3OKNA 2VDLL 2AS5M 2B1AH 3K74B 1T1YA 4QRTA 3ARUA 5B3NA 1SEQH 1NMBH 4YHOH 5JIKA 1N8ZB 2J8OA 3S5LG 4XP4L 1ZVHA 1WBYA 1VKXB 3CMGA 5SWSE 1QSFD 2DQFA 3RWEA 1DSFL 2GCYA 5KSVB 1GVIA 1CLOH 4OIBA 2KL6A 4WFFE 1XF2B 1G7QA 1JPTH 2IBBA 4KU1A 4JG0H 4P46D 5MEPB 2DL2A 2R29H 3HLAB 1RMFH 3RUGB 2VDPL 1CD0A 1YECL 3HI6H 3PQYE 4I5BA 1CDCA 3TWCH 2HJKB 4EVNA 3I84A 1YNKH 3MCG1 2VDMH 3UC0H 3WBDA 1P7KB 2VXTH 3LMJL 5F96H 4UZGA 4YR6A 2XTJD 3PV7A 1H15B 4HLJA 4JZJC 1CN4A 3O2DH 5AD0B 5HHOE 3F7PC 1F42A 5AZ2H 3Q5TA 1UZ6F 1ZT7B 1HQRB 3WFEH 5E2TL 1A3LH 4OI8A 3OR7A 1U8KB 1P4LA 4HK0A 1LO5A 1X5FA 3GMMA 1NCNA 1MFEH 3AXLB 1SJHA 4EUPH 4HDIA 3WHE1 4I2XA 2F5BH 1CDIA 4NC1E 3O4OB 2VTFA 1OTTD 4PJDB 4S1SL 1HOCA 1UM6L 4R0LC 2AJVH 4TUKH 35C8L 3NZHL 5HVFB 1YNTA 5EUKA 3LQAL 3EYSL 3SBWC 3QUYB 4KTYA 1CXLA 5CMAB 5ITFA 2GT9B 3C6LB 4NJAL 3V6ZB 3WXWL 1RULH 4X7TA 3ARDB 3KLAA 5DMIL 1J86A 4WWKD 4JDTH 2XZZA 3RGVB 1JHLH 1HXYB 4JRWA 1TETH 2APXA 3HAEB 4YBLB 3ZYOA 3TT1H 4NRYA 5INDA 1O7SA 4YLQT 2K3TA 2B4CH 5KZCB 5HI5C 3GSNH 3LS5H 3FCTA 4JO4H 3W11C 4FOMA 5TQ0L 2VLLB 3DMMB 5GJTH 4OD2A 4B5EA 1QSFA 3TGXA 3QXVA 1QEWA 4NQVB 1F11A 1EFXD 4KROD 2EDDA 1XF5B 1IQDA 5IT2H 4P46A 1BFSA 2NW3A 3RA7L 1KN2H 4YDIH 3B9KA 1F6LL 2OZ4L 4PLJC 3KPQA 2OI9C 1QFWI 3ARGD 4K3JL 1FNHA 4UILH 2KBGA 5EO1B 3ZKSD 4JFZL 1UXWA 3KYKL 2Z93B 1MVFA 1MIMH 3S34L 1YC7A 4MAYC 1HINL 3BIBX 3MRHA 4XMKH 5I2IB 2VZ1A 3EDKA 4CRPA 3FB8B 3SJVB 3KXFB 4R8WH 2AJZB 3O0RH 3U0TB 3BWUC 1ZSDA 4IDLA 1FNEA 1K6QH 1UFUA 4NN7B 4L4TD 3RIAF 1UWXH 4LNRA 3VXNA 3BKJL 1N59B 3BKML 1IFHL 1VFBA 3V4PL 5F89B 5HI4D 4F80A 1PY9A 5HI3D 1KTDB 4E42A 3BN9C 5EO0A 4MVBD 1O5DT 3U4AA 1MNUL 4PGDA 3E3QE 4C4KO 7FABL 2EO9A 3S9DB 1B0RA 1LDPH 5F7KC 1UM4L 1OB1A 4R4FH 4D9QD 4OUOA 4CVUA 1KTKE 5CILH 3D25A 3SO3C 2EYTA 3ZTJG 4EXPX 4Q9BA 4RAUA 3CSGA 1T0NA 3VDCA 5IKCB 1RJLA 4XRCB 4E5XA 3GSXA 3ARQA 4K94L 4I48A 4M00A 1BECA 1ZT1A 2PR4L 4JPKH 4OZGB 3TYFB 1KLFA 4IRSB 4WWKA 2GK0B 5JIHA 4BFEA 4X0KB 4ZFZA 5I9QC 2B2XH 4WY7L 4XPTL 5J1AB 5IFJA 3MCKB 4NKOA 4Z95H 1UB5B 3QHTC 2VE6B 4PGZA 1CFNB 1U8QA 3L3JB 1U3HC 2YSSA 3PNWB 1ZA6A 4XNXH 1N4XH 2A9NL 4EDXB 3V5HB 1ZHKB 1FAKT 3OG6B 2JF1A 1HXMB 5E8EB 4JO2L 2ATPA 5D2NE 1KIRB 2YR3A 4OFPA 1I85C 2DB8A 2RIKA 3IDJA 5KSUA 3TBYA 5FK9B 3GI9H 2ZSVB 4ODXB 3HE6D 3OAUL 5EZLB 5A2FA 5I1EH 4ZD3L 1AI1L 1YY8A 3NIDE 4WNQA 3HI5L 1IBGL 1CE1H 5J6GB 2A6DB 4XPGL 5ETUA 5TF1H 1N7ML 3DLQR 5GS1B 3BISA 4UQ2A 1DEDA 3W2DL 3C2AH 2ARJB 3HZYB 5EOCH 5C71A 1R5VB 1TIUA 1BJ1H 4L4TA 3C9NA 2J5LC 4NHCH 4Z7UA 1E4XL 1G9EA 3Q3GA 4BUHA 4NUGL 4NNYA 4PJBB 4L8SB 2JELH 4E41B 5L9DL 2ZPKH 3T0AA 2W92A 2WM0A 3Q2CA 2QR0A 2V2TB 4Y5XC 4HC1L 1JRHL 5F9OL 3JZ7A 1BFOB 4FXLA 4U1KB 5D1QB 5E03A 4G6AC 3BVNB 4LMQI 4IRJC 3RZCD 5FFLA 1ZGLA 5IVXE 2EXWD 1U95B 4YE4L 2Q7NA 3P9WB 5KOMC 1CFSB 1HH9B 4M43L 2VISA 2JJWA 4I77L 2ITCA 3IDUA 5F6IB 5DJCA 3S88H 3MLXL 1ZLSL 5BMFH 3FQRA 1S7TA 3AM8C 1AC0A 2IGFL 3KYMB 1NCDH 2XZAL 3TYGH 2HJLB 2G60L 4PJ5E 3QIUA 3IDGA 2CLVA 4I0PC 1FZJB 4E9LA 1KIQA 1SYVB 2MQ3A 5DFVD 2APWA 3DVGA 4Z0BH 3AREA 3HE6A 1XF1A 2ZUVA 4LQFH 3SE3A 4FQXC 3N1QC 4X98A 3M8OH 1EV2E 2VH5L 2FX9H 1KTLA 3EYFB 5HHMB 2BJML 1DFBH 4D3CH 2P8PA 4JRYB 3QQ3B 4HS3A 5KVGH 1BBDH 4ELME 5EOTB 1TTGA 3BT2L 5D72H 1NFDF 4OCWH 2OZ4A 4MLIA 1U6AH 1QFUH 4PJGB 2DKUA 1T5WB 5E56A 3G5YA 5FAAA 2WQRA 4V1DD 3S36H 1ZXQA 4NOBA 4PUBH 2ADGB 4YHYB 5CGYD 5F7WC 4FQCL 4L3CA 3HZMB 5FCUH 1DQML 1FYTE 2AKRA 3V0VB 3EOAB 4XVUD 5CJXC 3IFOA 2HH0L 4N8VA 1UENA 4MA1B 1JZ2A 3DSNA 4O2EB 2Z31B 5I19L 4K23L 5TH2A 2XPGA 5E2UH 2DN7A 3FFCD 2AK1L 1MREH 1IC7L 2CDFB 5CJQH 3RJQB 5HHVL 3VCLA 5C1MB 5I1IL 5F7HA 4JFFE 3SGKA 2FCBA 1KCVL 5EU6B 4PP1C 2X89D 4JRXB 4FTVB 3NCCB 2AW2A 5FDYA 1GC1L 1QACA 1S9VB 2PUQT 5F7DB 3MA7B 4GUPB 4Z9KB 1W0WA 2D03H 4NBXB 5DJXB 4N0RA 3HNSH 4YFEA 1Z3GH 4AIZB 1NGQL 2ORBH 4LVNB 4MHHG 4U1LB 3P4OA 1CLYH 3CXDL 5LBSH 4OBSA 3U36A 4LSTH 1XH3A 4LLDB 4OKVA 3IDIA 5FGCB 2DKMA 2FX8L 3OX8B 5DMJB 5I75B 4KVCH 5EUOA 3ZT7A 1XR9A 5D2LF 4P3CL 2F5AH 4XP1H 1C5DA 1BQSA 3RWGB 2H2PC 2H8PA 3MREA 4U7KA 5I1AA 4ELMA 5FXCH 4P4KB 7CGTA 3F7VA 3RHWK 3ZE2E 5DJDA 3EJYC 3BUTA 3ZSTA 5DJ2B 3SPVB 2GUOB 2IFFL 3LEXA 4G8IB 3REWA 2H32A 4EI5C 5HYJE 1S3KL 2ICWA 5CJOL 3TBSA 1S7SA 3FONA 5L2KD 3SGEH 5D7SH 2BVQA 3TNNB 2ZP0T 3O4LB 1OAUL 1UM5H 3V5KB 2ICWI 4W4NA 1R0AL 3IFLL 4CN4A 3WO4B 1FYTA 3FTGB 3MJGX 4V1DA 3BE1L 4G43A 5F7FA 2VAAA 5F6HI 4ELKA 1ORSA 2XA8L 4M4RA 1MHCB 2XYCA 2ADFH 1IGFL 3OR6A 4RWYH 1R3IL 5GGRA 1XGTA 5DZOA 1M05B 2ARWA 3OJDA 1HIMH 1KJ2B 4JFFA 4Q2ZA 4K9EC 4XP6H 5I16B 3RL1A 2DIAA 3FFCA 1BIIB 4UIKL 3NMEA 1LO3H 4HIJA 4MNQD 4HHAA 4K2UL 1NGXA 4M02A 4HMDA 1SBSL 1IGIL 5FYJE 1E4XI 2B5IB 4XT1C 1HQ4B 2X89A 3L3OA 1A5FL 2Q3ZA 4UAOB 3CK0H 4XTRD 1V3JA 4F15B 3GHBH 4D0CB 3T77A 3ZE0F 1K5NA 1U2CA 1OVZA 1MCPL 1NC4D 4GFTB 4HKZB 5TE6H 4LASL 4LHUD 1DVFB 4YDJA 3PHSA 1PSKH 3JWNC 1U8OA 4KZEL 1U8MB 4FFVC 1AGCA 1JRHI 1NAKL 1ZHBA 2NX5B 1LE9B 1HDMA 4Z76B 1KG0B 3ZL4H 3NFPA 5SWZE 4OIIH 2VR4A 5C0IB 1QBLL 4K3GA 1WITA 3KNBB 1N0XL 1UZ6E 3DYOA 5LJYH 5DK2A 1MJUH 5DHYB 1JN6A 4YFDB 4YFLI 1JZ8A 2BK8A 3NA4A 1KENL 1NFIA 4XP5L 3UO1L 5I30L 4Q6IB 4P23C 4Z8FH 1S7UA 3VDBA 2VSCA 1PG7H 2BSSB 1WCQA 2F74B 5EDXA 1A14L 3GIZL 4MWFA 1JGLH 1XCQB 3IJSB 3L5XL 5L2KA 4BFIA 3R0MA 4NJ9H 1UCBH 1KN4L 2BHYA 3JVGA 1IC1A 3CDGA 3RVTD 3IXTB 3HMXL 1JHKL 4QEGA 5D5MA 3FO1A 3HNVH 2EIDA 4LIQL 1HNGA 3FKUS 1RJZB 4PJEF 4JANB 1NGZA 3CSPA 1NEZB 4TPRH 3HR5A 4WI2A 2AGJL 1AQKH 2QHRL 1MCOH 1NLDH 2PYEE 4OQTL 1KLGA 5F7NC 3C5ZD 4HK3N 3O6ML 5EN2A 3QDJD 1CQYA 4UNVA 5H35B 1EHLH 4GBXC 5DQJB 2V5TA 1HH6B 1NUGA 3FN9A 5BW7A 1UC6A 1JYVA 4FN0A 1IGJA 3E0GA 5DGRA 2HT4C 3SQBA 2UZIH 3HUJA 1WC7B 4N8VG 1YN6B 4RX4D 1NUNB 3VFWA 4KJPD 4MJID 2BVPA 1PG7W 2FLRT 3F5WA 5BOPA 4GMSH 4TVPL 4NDMB 3E2HC 2J4WL 3I6KB 1BEYL 2E6QA 4LSUH 2VDQH 4M9PA 4NZTH 4G8GB 2W60B 4LHUA 4U1JA 3QQ9C 3ROOA 4GH7B 3S37H 1QLEH 1WTGT 4KDTA 3TF7C 1A6TA 4TRPH 3H9SD 1SJXA 2HMIC 4LGSB 4Y4HC 1D6EB 4X99A 2XRAH 3FQXB 1W2KT 5EZOH 3SDAC 4HX1B 2R23B 4K7FB 1E6JH 2BVOA 3ARPA 4JM4H 4LCWB 1DBAL 2PO6B 4LLQB 5EG6C 3VXPA 1JPGB 5J0BA 4R2GB 3JUYA 5HDLA 3D39B 5DUML 1N5YH 4ODUA 4MXQC 1VFUA 3MLSH 5C7XH 4UV7L 5L6YH 4GS7C 4KC3B 5FV2A 3JV0A 4Y1AD 2PW1A 1DEEB 4N9OB 3BP7B 1EO7A 2W9EL 3QYCA 5CD5D 1I7UB 1X4ZA 5CINL 1F13A 5K9JL 2WWMC 4DCQB 3MXVL 4DWHA 3QI9D 4QTIL 5IFAL 5K9QI 3CX5K 3EO0A 4LK4A 1JGEB 4C55A 4HPOL 4OKDA 5I1GL 2X1PA 1KPUA 3GKZA 3T0EE 1A1MA 4F9LA 1H3PL 3ULUC 1BX2A 4YXHH 5T5NG 1PZ5A 5DYOB 5I1DB 3QDJA 3LCYA 5DS8B 1Q94B 1G7JA 5FKPB 4RNRA 2VO5A 4WU7B 4U1GB 1YEDB 4U1IA 4X80L 3O2VH 2NCMA 1DBJH 5JZ7D 1H5BC 4RX4A 2EZ0C 4XZUB 2NYYC 1KC5H 3O3EA 1MCCA 2Y7QB 3PWNA 1M71A 2W9LA 3VXMB 5DQDL 3K2MC 3WD5H 4M5ZL 2PW2B 5FM5M 4P2QE 3U30B 3VRLF 3R1GH 3LPWA 5IBUG 3VG9C 5C0GB 1YEEL 3L3HB 1YUHA 3TVMC 1JZ3A 5BCAA 1S9YA 1T89A 4B50A 4LCCA 4JFHE 4JPWL 1S9XB 1YEGH 1I8KB 4MJ5B 4TVPD 4NCC2 5GGQH 3H9SA 4FXKA 1AJ7H 2WV3A 1VCAA 1X4XA 3T4AB 3TCLB 4YWGL 2VQUA 5SWSB 3C6SA 3DX9B 4WO4B 1I3UA 4WCYL 3CU1A 3NFSL 4NPYB 2G5BA 4XPFH 3U4BH 4B0MM 3QG6A 1X9QA 4J1UB 5C9JB 1YPZA 3CVHB 1WEJH 3RWJB 4DFHA 2F54D 3VFTB 1WWBX 1T7WA 2R8SH 3MLZL 2UZXB 1MVUA 4QYOB 4LCYA 5JXED 5C0BD 4NBYB 4ZOAA 4Y1AA 3UTSD 3O41B 3LKRA 3OF6D 1KELL 3V0AC 2P8MA 4JN1H 5I1JL 5IJKA 3QI9A 1EEYB 4JHBA 2DLIA 2XKSA 4NBZB 2OXHA 4UIMA 4MD5A 1K8DB 4KI5C 2OK0H 1UJ3B 2BOBB 1VERA 2WBKA 4NFDA 5A16B 1W72H 1VENA 4APQD 3QIBC 2FECL 3AROA 1JTTA 3QCTL 1VGKB 3PXJA 5LWYL 4HIEB 4EEEA 4MQ7A 5DJYB 4G8FB 4UT6H 5EIIB 1IQWL 3B9DA 4OLEA 3L5JA 3S3SA 2FJFB 3HB3D 3SDDA 5MENE 4LSPH 2IBZY 3PGDA 3QQNA 4IEFB 4IRZL 4WGWB 4OQTA 3CX2A 6FABL 3HRZA 3QPQD 2X44D 2QQQA 3IETB 1F58L 1RURH 4YXLL 1DLFH 4ODHL 4RGNB 3FRUB 4HQQL 5HHXH 4P0DA 3BYYA 2X4TB 4LLMA 4PRNB 3AS3A 2V9RA 5F7YC 4X6CB 4JZOB 3PP3K 1CICD 1ZS8A 4HW6A 1K4DB 4JR9H 2B0SH 4PS4H 4KPHL 4XMPH 2NXYD 4R97C 3RX8A 2HA1A 1NFDE 2HLFD 4KK8D 4OCSL 3TH3T 2OJEA 4CMMA 2IH3B 4TUOB 1HHHB 4XMLH 2O61A 3OKEA 4LHUG 2P5ED 3RY6A 2IEPA 5ENWB 5I15H 3CFDB 3C8DA 5JNYB 4LSDA 5JQ6L 5LVEA 5ALCL 1S5IL 2HVKA 2J8HA 4WUKH 1CXKA 4ONGH 3S97C 2CO7B 2GHWB 2N1KA 1MCFA 1FBIH 2DQHH 2F54A 1B2WL 1DDHA 2O5ZH 4KY1L 5JXEA 4D8PA 5CEXB 2BMKB 3LB6C 3EOBB 4PD4K 3BGMA 1IRAY 4EUPB 4S0SD 4DGIL 3O45B 1OAYL 2CRZA 2CK0H 1K8IA 1FRGL 5EBMA 1N64H 5LXGL 4JCLA 1MHEA 4JDVB 2Q20A 4APQA 4QF1B 3GGWB 2CKBH 3TC9A 1WF5A 1DZBA 5EBGA 2P4AB 1RJYB 3RVXD 4H20L 2EH7L 1R3KB 5I74C 1XIWC 5IGXH 4JQXC 5GRWA 4Y16B 2BOCB 2D0FA 3RTQD 4XVTL 2FL5B 4G7VH 4JO3L 3RVVC 4N5EC 4IDJL 1PYWA 3I50L 4NQCD 5D2LE 4NQDE 5D9SB 3X14B 3AS0A 5J89A 3CH1B 2H1PL 3MJ9H 2VITB 5I6XC 1M7IB 2GSGA 3ILQD 3QXAB 3U9UB 4PJFB 1A4JA 1C12A 2X10A 1NFDA 3LH2L 4HS6A 2HFGL 3V95A 5INCA 1CICA 2H6PA 5KN5B 5JTWA 2R9HC 5D7LD 5JUEL 3BOVA 5ADOH 3S98A 2WBJC 5GZNC 4XPAL 5BQ7B 1JUFB 5ITBL 5EC1A 2IC2A 1LP9F 4IMKC 4PJ8C 1S8DB 4Q7DA 2P5EA 5A2IH 5ACLA 3U46A 1FCCA 3LS4L 3RKPA 3I3EA 1I1FB 4H26A 2MKLC 5GGTA 3O3UN 2AV1A 4Y88A 1A47A 4J2XA 3QT2A 2YPLB 3PDOA 3CJJA 4QNPF 5DA0B 4JM2B 1ZHLA 5EU7C 2RHEA 4PY8I 1RU9H 5AEAA 1P4IH 1TPXB 4CADB 5I76B 25C8H 5H2BB 3DOSA 1SBBA 1EAPA 2B4CC 1IAIM 3BSZL 1OSPH 1XT5A 3SE4A 3FOMA 2EE6A 5AAWA 2M26A 1QPPA 3WFCL 1NGWA 4BA8A 2ENSA 1FL5A 1S7XA 3ZMRA 1V3LA 3BRDA 3ZE0E 3V4UL 4JHWH 1ZMYA 5IHZA 3MACH 4QXTB 3Q6GL 2FB4L 3L6FB 3IXAA 3SKNB 3EYVB 1RAMA 2AABL 2QQNH 3N1PC 2OJZH 3MRQB 2VDRH 4MB3A 5DUPH 3O6KH 3NFNB 1LEKA 1VEPA 5D2LA 1T7VA 4ZODA 5F7LB 3EHBC 3G9AB 5KVDH 4U6VH 4QRSA 6CGTA 2MMXA 3UTQB 4R26L 1MI5E