3G04A

Crystal structure of the tsh receptor in complex with a thyroid-stimulating autoantibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
212
Chain Sequence
LTVLTQPPSVSGAPRQRVTISCSGNSSNIGNNAVNWYQQLPGKAPKLLIYYDDQLPSGVSDRFSGSRSGTSASLAIRGLQSEDEADYYCTSWDDSLDSQLFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HUMAN THYROID STIMULATING AUTOANTIBODY M22 LIGHT CHAIN
total genus 43
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2009-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04A01
2BOCB 5DMGC 5TPWL 1OSPL 1U95B 2K7PA 3O8XA 1VPOH 3ARGC 5T1KD 1INEH 1D5IH 4Y4HA 5HDBE 2FEEI 3PGFH 2G5BB 5E95B 3KPSE 4PJBA 2C3GA 2MFNA 3DSFL 3FB6A 1E6JH 3RI5K 1MFDH 4G7YL 3O6LL 3C2AH 1GZQB 3RKPA 5IEKB 4OUUA 3C09C 3MNZB 1WGOA 5EG6C 1G6RL 2DWEB 3ABZA 5GZND 3MRLB 1H3UA 2JB5H 1IAIM 4ODUB 5DHVA 3RNQB 3RL2A 2Q86A 4OV5A 2HRLA 2DJ4A 5SX4H 2I07B 2CIKA 4LGPB 5K9JH 2HFEB 4HUMB 3K1DA 3LH2H 1UH3A 3BPLB 2QADC 3W0WE 3AM8A 4E41B 1JUFA 1QKZL 4P5TA 2VOTA 4V1DA 1C08A 4P2OA 2NYYC 2I27N 5INDA 4K7PY 3QXTA 4XP6H 1YMMB 4KC3B 4IS6B 1U0QA 1U9KA 3QDGD 4KDWA 5E6YA 1P9MA 4JZOA 1C7SA 3RWCA 3GHEH 3QHFL 2VR5A 3SDCB 3U2SB 1TENA 2A9NL 4LQFL 4LSTL 1IQWL 4QRQA 4RNRA 2UVEA 3TA3B 1UACL 3EHBD 2VITB 4GAYA 5EN2B 5H37H 2O5ZL 4LCCB 1RIVL 2EDYA 4KK5C 1QR1B 4GRMA 5MERB 1FLRL 3VWKD 3BDXA 5IQ9A 4Y1AA 4IIQA 4M7LH 2Q8BH 1F4YL 4PJXA 2APVA 1MREL 5FHBH 2MQCA 2YD4A 5CUSL 3V7AE 5MP6L 5E2UH 4TOYL 5CJXC 1KNOB 3DX7A 3TVMD 3OXRB 4RFOH 2KDGA 2IPUK 2X4UA 3DSFH 3PWJB 4G80A 2BNRA 2HT2D 4YWGH 1TVHB 4UUJA 1A4KA 1A1NB 5I1DA 3U7YL 4QCIA 2VZUA 5T5NG 1J86A 3L7EB 1HNFA 5GGVY 3A6BH 4P57A 2O5XH 4HCRL 3OHXB 5JIHA 1RFDH 2P5WE 5TQ2H 3VFRB 1T5XA 1HWHB 4H0IA 4X5LA 3VXSB 1ROWA 4Y2OA 4FXGB 5LQBL 1INQB 3NFPA 5ISZB 3FT4A 4XXCC 1LEKA 4DOHE 1DE4A 1BFOB 5KVEL 4L29A 1RJZB 5H37G 2YA2A 3CVHL 1R5VA 2XA8H 4LU5L 2VJXA 4N0CD 2AV7B 1IFHH 3QEQE 1IEBB 3HAEA 4LLVA 4DAGH 1VESA 2HWZH 3EYOB 3QISA 4UOW1 2F5BH 5DJ6B 5K59F 2OJEB 3MJ7A 5FUCE 3T4YA 2DQDL 1MCRA 4GW4B 5DRNA 4GRLA 4NBYB 3MGAA 4H8WC 3K0WA 2Z8VC 3RWEA 4PJCA 3C60D 4XWOC 2H26A 3QFJA 2F53A 2GITA 3BIKB 1ZSDB 2IPKB 2XFXB 4R9HA 1K5NA 3OAZH 5HDQH 1S9KC 3T65A 1U36A 1ADQL 4Q7DA 5D5MF 1U3HC 1ZOXA 1A22B 1QNZL 4V2BA 4ENEC 2X9WA 1YYLH 4K7PH 1ZWIB 3GUTB 3HE6C 4NQDA 2NY1C 2AJZB 2ZSVB 2YA0A 4O2FA 4TQEH 2WBJB 5I74C 1A7QH 4MD4A 5LXGL 4MB3A 1RPQA 4XC1L 4UNVA 1WAAE 4PYGA 3LEVL 4YHOL 4OGYH 3BZEB 4C58B 4ZXBC 1XF2A 1BEYH 1FZJA 2O5XL 4HCRH 4ODXA 4CL7A 5IB4B 2X4UB 1NMCB 3OKYA 2ZOLB 3I02A 5I0ZA 2ZUVA 4NFDA 2XTJD 3T0VA 3AY4C 4HH9A 1X44A 1U8LB 3RZCA 1UADC 3TBYA 3QDGE 1IT9L 4O02H 3JV6A 1KJ2A 3T0ED 1SY6L 4KV5E 4GKOA 5I1GH 3MROB 3K4AA 4HLZG 1I9RH 4HXAH 5DEFA 2LABA 5TDPB 4NZRL 4HUVB 3C6SA 5F6HJ 3QIWA 5IMMB 5CBEB 4RWHA 2QHLA 4HJGA 4NQSB 4XBPA 2XWJA 4YDIH 1Y6NR 1A6AA 4XI5C 4Z77B 2GT9A 3WIHA 5IFJA 4HC1L 4UOJA 2OSLA 4GW5A 5ESQB 3B5TA 3VFRA 1SYSB 1QSEE 1OGAB 1VFOA 3QO1B 1I9EA 3W9DB 1AC6A 3W9EB 3QXVA 1C08B 4JQXA 4FXKB 1R0AL 32C2A 1WK0A 1R5WB 5GJSH 4APQB 2NY5C 1WZ1L 3NABL 2NR6D 2BHUA 1N6UA 3GMMB 3C5ZB 5IVNA 5HDLA 3CX5K 1FIEA 3WS6C 2P48B 2A0LC 4MMZC 4MB4A 1K6QH 3AAZB 1JP5A 5KW9L 4UT7H 1WBZA 4KJYB 1T89C 2NY5H 4UIKL 3LMJH 2XWJB 5L2KD 2PXYB 5KBNC 5C0CA 3IETB 1PZ5B 3EYSL 4EDWH 4X99B 3ZHKA 2G5BA 4G6AD 5KVDL 1MOEA 3KJ6H 3ARGD 1V3KA 4LIQE 1S5HA 2JF1A 2UWEE 3H3PH 3QEGH 3WEXB 43C9B 4S0SD 2QHRL 1KGCD 4Q0XL 3CFBB 3VDAA 5DEGB 3GMNA 1L7TL 3ALXA 5INDB 4KUCF 4KUZH 4UU9B 1F8TH 4RBPH 2MWCA 4OLYL 3O3AA 1MFEL 2BY3A 3T1WA 2UUDH 3CDFA 4S1RL 1WBZB 2IAMC 3CFKB 1V7NL 3QUZA 2WUCH 3LKQB 4KRPD 5LWYL 3IGAA 3W39B 1RUML 5T1MB 4PV8A 5I75B 1F8TL 1C8PA 3GK8H 2X2YA 1NGYA 3QUKA 4GMSL 2Q20A 3MRLA 4OLUL 2GUOB 1UB5B 2APFA 3MLYL 5BMFL 3O2DL 1ZEAH 3EDKA 3VXUA 4RAUA 5KVMC 1NH6A 4QRUB 3KLDA 2O61A 3ME0A 5EDXA 1NMCC 4JJHA 3SKNA 1KN2L 3BE1L 4LIQL 2AXJA 4XH2B 3ZKXB 4NCDA 3I6LD 2GFBA 2J8UF 4NNXA 3MRDA 1MQKH 5LJYH 5DRNB 5C7XL 2DMCA 3PF2A 1YEFH 1A9BB 3WS3A 1G9NC 3AGVA 2EXYD 5J57B 2FR4A 3ZT6A 5JW4Q 5EZJB 5DXWA 5J3HC 3OKOB 3AB0C 1OCWH 3TN0D 7FABH 3L5XH 4KROB 4AMKL 1TZHA 4U6HA 1XGTB 4FFYH 1FV1A 1CFTA 3BP5B 2ENYA 1NQBA 5DMIL 4HLZH 4Z7WB 4WI8A 4XVSH 3QBTB 3QO0B 4JZNA 4AEIH 3BIAX 4G9FB 1Q9LB 4KI5C 4FQLL 4NQED 5ID0B 4F2MB 3OKKA 5IB3A 1S7XB 1ULVA 2X4OA 5GJTL 1P5VA 4S1SH 2CR3A 1WZKA 4FXKA 4LQ1A 3VXPB 3BH8B 4D0CA 1HOCA 4ZXBB 4HJ0C 5EUOF 4M5YH 3NPZB 1T21A 4KY1L 3C5ZC 2VXVH 3ARBC 1B4RA 3RWFB 5IJKA 4JFXB 4NGHH 3BISA 2AQ1A 5GZOC 1BVLA 2DL9A 3P9LB 3UTPD 1B2WH 3T3MF 1MI5A 2BVPA 5D8JH 3SE8H 4ZTPL 2ARWA 5E8OA 3T65B 1K5NB 4KKBC 3KPLA 2VISA 4K3GA 3RU8L 2MCG1 3TC9A 3HUJA 2NY7L 3DSNA 2H8PA 4XI5D 4DVBB 4KK9C 2HMIC 5EB9A 5DD6A 3MRRB 3FHAA 2YD2A 4UB0H 1PDKA 5EO0B 1W0WB 2NY3B 2WMPA 3O41A 5DD5L 2V7NB 3H8NA 3HB3D 5FCUL 3U0WH 4GAGH 3W82A 4G9FD 4UT9H 1CD0A 4QYOA 1RUAL 3BPOC 1CXHA 3C60C 4Y16A 4PJ8B 3NCJH 3MRHA 4ZUWA 4AIXA 4HZLB 4LBEB 1FZJB 4F7MB 2YKLH 1R3IL 1NGXA 3SGDH 3MCKB 2DQFA 4L3EA 1MRCL 5K9QG 4OAWA 1U8NA 4DN4H 3TFKD 3A6CH 3GDBA 1JGVH 3ULVC 1OAQL 4I0CC 5BW7C 2Z31C 3TO4A 1QEWA 4PRIB 4M4RA 5GGVH 5DRWB 4NQCD 4PJ9A 5MEOB 3BH9B 1JWMA 2NY0B 1RIUH 2HRPH 4RRPG 3VXTB 1K2DA 3I85A 4FQJL 2NXZB 3CJJA 1V3JA 2Z35A 2X05A 3T2OA 3D18A 5CP3A 1J8HB 2FLBT 3ZYOA 1RY7B 3BZ4A 4F57H 3L3IB 4PJCB 4JFYB 4X7DC 4HFWB 1KNOA 1C5DA 1CD1A 3L95A 4QY8B 3SPVA 1FL5B 4FHBD 4X9FA 4Z0BH 3T4YB 3P4OA 4IRSD 1RUKL 1T1XA 2G60H 1DUYB 3SDDB 1BWWA 3GNMH 3RVXD 4C59B 3GMPB 3TIDB 4MNGE 1N2RB 5EU7E 5DI8A 4RMTA 3GM0A 4Z7OF 5F3BA 1U2CA 3BN9C 3LHPH 4L29B 5T5FH 4IRJC 3QUXD 3SCMC 2MKWA 3WUWA 4MX7A 3JVGC 1SM3H 5ERWA 1MI5E 3B4NA 4TOYH 1R3HB 3VFUA 3KYOB 4JRYD 3G6DL 2YBRB 3EJYD 1MIEL 2DWDA 3VFNA 1YNTA 3DLQR 4F7CA 3GSNL 3V7AG 4YHML 4F7PB 4LRIA 2UY7A 1P4LB 3S5LB 1N26A 3G5XB 1IAOB 5I8CA 3WCYA 3WNPA 4TUJA 3CLEL 3D69B 2EDOA 1WFTA 1BZ9B 3Q2CA 3PWUA 2YUZA 5C92A 3EGSA 4K71B 2D4FA 1YEDB 2WM0A 2YKLL 3PHSA 4JY4B 2FHFA 3IFNH 3KXFA 1WIUA 4EN3D 4GH7B 4KHXL 2F53E 2Z4QA 3ESUF 4WTZG 5T3ZL 3S36H 3UTQB 2ATKB 3BRFA 1P7KB 5ICYA 1CFVH 2FJGA 4OZIF 3FQWA 3GKWL 4Y2DA 3DUHA 5FA3B 2AGJH 5D1XA 4X5WA 5EC2B 2NY3C 2PF6A 2OZ4L 2G9HB 4C4KO 4R2GD 4XNUL 4Y4KB 5K9KA 1N5YL 4Z7UA 1XGRA 1N0XL 3C60B 2W92A 3QDAA 4RFNB 1YYMH 2I9LB 4J3XA 3CLFH 3T0WA 1H3WM 5KSBB 3DV6A 4M1CC 3DX8B 2A2QT 1I7UA 4QLRA 1E6JL 2N4IA 1JHTB 3GSUB 4OLEA 4PJHB 3KYAA 3LKNB 6CGTA 1YY9D 4H1LH 4OCLC 1MEXH 2Q7NA 2F19L 2UYLA 5GS2D 4P5KB 3FAWA 2HKFL 4N90D 1FDLH 4W4OA 4RIRA 4WFGD 1FO0B 4NO5A 3CFIC 2HTKC 4YBLC 1M05B 3NH7H 5IK3A 1AQKL 2R1YB 5EBLA 4TNWF 3JUYA 4RIRB 4PP1C 4Q0XH 5HSFA 4UILL 2DKSA 5HXMA 1FYTD 1KEGH 4E0RA 4XNXL 3C6LA 4M3JA 4N0UB 4Q9RL 1YMHA 1KSRA 4MQ7A 4XB8A 2Q8AH 1P4IH 4PRPD 3LKNA 3IDMA 2WUCL 3DUSA 3LS5L 5F88A 3ZDYE 2IQ9H 3O2DA 3JV4B 1OPGL 4GMTH 1N0LA 1HHIA 1TDQA 4JPKL 1IZJA 4NM8L 5HDQL 5IVOA 2R69L 1Q0XL 1I7TA 1JN6A 3A0OA 1BMGA 1D9KA 4NBZB 1ZEAL 3QI9B 3RWGB 2WQ8A 3RP1A 3PP3K 5IESH 1C1EL 4P4KC 2VLLB 3CPLB 3MRQA 4R7NB 5ALBL 4HUWA 2J8UE 1AHWA 3F7VA 4ELME 3UTTD 4M8QB 1GHFL 5DJ8A 4KAQH 3VJ6A 2B8OT 3BSZH 4HXBH 3C5ZD 1H15B 1MCOH 1NFDE 4O00A 1NGWB 2UV3A 1NC2A 4PUBL 2AJYL 4JFED 1WCQA 4XMPH 3KWWA 3VG9C 3D3VB 1DTUA 1K6QL 3EGSB 5EU4B 5F96H 4ZPVA 1XGYH 4LDLB 2ZUUA 5FO7A 1QSFE 2BY2A 2EH7H 2FX8H 2PO6B 4ZUUB 4JCMA 4U7KA 1JMXA 5DJDA 1EUUA 5I1KH 3DV6B 5KSVA 4JB9L 4OFDA 4R0LC 5AD0A 4FQ1H 4YJZL 1IARB 2VL5A 12E8L 2VLJB 3T8XA 5F7LB 4ELMF 1S7QB 1UVQA 1MWAH 2AEPL 2OK0H 2EDQA 5I1KL 1UB6B 3P0VH 4QWWC 3V5HB 2OMBA 5DQJB 4M5ZL 5AZ2L 2ITDB 3U30C 2IWGA 5ITFB 1OAUH 4X6BA 4X5XB 4JM4H 4OLVL 4OFVA 5EU6A 3ILQC 2ATKA 4DZBB 3WNNA 1EPFA 1H3TA 3WO3B 4D9LH 4ODVH 4TSCH 3PV6A 4R8WL 3K2MC 4FZ8H 1VGEL 1WISA 3BGFB 2NW3B 3VMPA 1HQ4A 2WUBL 1GIGL 5T3XD 2MQ3A 3TZVA 3GMQB 4HIJA 1N6QL 4KQ3H 4JJ5A 1EFQA 1CGTA 1DJSA 4P5MA 4Y4HD 1RIHH 3DROB 1CIDA 1NMBL 3CFJB 2F74A 5L9DL 4FZ8L 1IAOA 1T7WA 2E8YA 2W1NA 3QDMA 4ORGA 6FABH 1FL3A 4WHDA 4HWEH 5EA0H 2DD8L 3VFWA 2BVUA 3HAEG 2BK8A 5L8KB 5HHXH 4IMKC 4Z7VF 3NA9L 5E5MA 5IUSA 4IOIB 1NEZG 3QQ4A 1NCCH 2DWDB 3VI4E 2YBRA 5F7DA 3HPJB 2GW5A 4CVWA 2XTLA 3OG4B 2A1WL 4M1GH 4TYUA 5D5MA 1LEGA 4ZUTA 3GIVB 2R0ZH 3SQOL 3RDTA 3DV4A 4G6ML 4KZEH 5I1AB 1RUPL 4U1SB 3MBED 3KLSA 43CAB 3BO8B 3SDAA 3MA9L 2RCSL 2WZPD 3OQ3B 4ONGH 4JM2D 4WW2C 5DJAB 5J12B 1F3DJ 5JOFB 4QRPB 1LHZA 5I8KL 1IC5L 1W0VA 3VRJA 3NABH 2OS7A 4XAWL 2HTKD 5HGBA 4MD0B 2H32A 4NC1E 3OXSB 1S7SA 3MLPA 1D6VL 5FF6A 1F45A 4QY8A 3WD5H 4DVBA 1G84A 3Q3GB 2PTVA 4NO0D 1CFBA 1Z5LB 3WDHA 4XPHH 4U1HA 1QFUH 3RA7L 3QEUA 3EJJX 4FTVE 4CVUA 5CINL 4NO2B 3IF1B 3DARA 3QPXL 1EUTA 1VFAA 4RFEB 1JNNH 3BQUB 4N90E 4TVSa 3W11C 2VXUL 3DOSA 5DVMA 4CADB 3P9MA 3SOBH 3WKNA 5F70A 3F7RA 3AUVA 1HKLL 3CMOL 1O0VA 4Z76A 5D7IE 4WVRA 4U31A 4Y1AE 1BGXL 4CVXA 3EAKA 1V3LA 3V79C 4BK4A 4EKXA 4P4RA 1U6AL 2WLZA 2JCCF 5IFHH 2AEQH 3ZDYF 2ORBH 1PQZB 2NY3D 3BKMH 1MRDH 5T3ZD 3TLRA 4PGDB 1A7OH 1E27B 1ZHNA 1ES0A 3CZFB 1KG0A 2J12B 4JO2L 3MYJB 4PJ8D 3BP7B 3B43A 3MLUL 2IAND 2JB6A 3C08H 4UZGA 4S1DC 4K3JH 3RBGA 3WFCH 1XGYL 2XTJE 3WFBL 1P69B 4J23A 2Q87A 1HINL 2B5IB 3OB8A 1YC7A 1QKZH 4LCUA 5EZJA 2H8PB 3S4SG 2PR4L 4L9LC 4F9PC 5SWQA 3N85H 2X4NB 5DJ2A 4GRWH 4PR5A 4FABH 4ZUSB 3HE7D 3MNVB 5I76B 1PEWA 2D7QA 3MJGX 3MLTA 2AXFA 1JF1B 2EEBA 3FT3B 3RBSA 1KPUB 3ARWA 1AD9B 3N50A 3O0RL 2BVQA 1QLEH 5E99L 1HQRB 4QRUA 4MNQA 4UOW0 5DJ8B 3DXAD 4ZOCA 1Q0YH 5HDBF 1MAMH 2PO6C 4KH2A 2F8VA 1OWRM 4RFNC 4JFHE 3JWOH 2V7HB 2BFVL 1HHHB 3VU2A 5DRZA 3EO9H 3FJTA 1UWEH 1EO7A 2XY1A 1CFSB 1MIEH 1RZJL 1KBGH 5EC1B 1JHLH 4Q9CA 5LQBH 1GIGH 2E6JA 2C5DC 5F9OL 1S9XA 2E27H 4LEXL 5BS0D 2EO9A 2C3XA 2RR3A 4TULH 4AZ8A 1QSFD 2FBJH 5HHNA 4PP2B 4LCYB 2VDQL 3MLZH 1J1XL 5KN5A 4U1JA 4NN6B 4X7SH 1ZK9A 4XX1G 3JWOC 3IKCA 2DBLH 1SQ2N 5F9OH 3SOBL 1JPGA 2GTWB 2O5YH 4YH6A 1KJVB 2ICES 5TE6L 3T0AA 3TV3H 4LLYA 1IBGL 3VFOB 3ZL4L 4J3VA 3VGGA 4WENB 4B0MM 4N9OB 3B9EA 3JTSB 5C08A 1RUKH 3P11L 5DMIH 1FE8L 4K2UL 1HH9A 1XF3A 5GS0C 4OKDA 4J8RA 4PRHB 3CUPA 5FYKE 2HT2C 5CZKA 5FDWB 1T83C 2W9EL 3NPSB 5SV4A 4OCNC 2GY7B 5DD1H 4HV8A 2LAGB 2C4FU 1HHKA 3LV3A 4A2MA 4QTIH 3V5KA 3WIFB 3MRKB 3C2AL 1FLRH 5D2LB 2WBJC 5I74B 3LN9A 1NPUA 4JDZB 2VDOH 4X8JB 4AG4H 1GPOH 4X6DF 3EO1B 1JHTA 2W60B 4NN5B 4IEFB 1CU4H 1RZFH 2AAVA 4LK4A 4WIQA 4R2GB 4Y4KD 3K4ZA 3VDBA 4UB0L 4JDZA 4MXVF 1MHCA 1I85C 1A6AB 4MX7B 5I17A 3IJSB 5DHYB 4X5WB 1LO3L 2BNQE 5J1SC 5EPMA 2XQYG 4LSVH 1ZVSB 5DD5H 4HV8B 3U0WL 3EUUA 4JFZL 4G6KH 4WJ5B 1CLCA 1CLYL 2B5IC 2DQGL 2YPLA 1TZGH 3IJHA 4KK6D 3V95A 1EBAA 1F58H 2A77H 4QTHB 3D0VB 1RZ7H 3ARSA 5B8CB 2IALB 3V6OC 4NNPL 2I9TA 1YEDA 3DRTA 3EYUL 1A5FL 1BZ9A 5F7YC 3T04D 4DK6A 1FZOA 2FNBA 1KELH 1SY6H 4MQXC 3VI3E 2N7BA 2H2SD 4BKLA 1J8HA 5D2LF 1W72L 1QBMH 3WXWH 1NC4D 2KBGA 3S5LA 1Y6KR 4O9HH 5D1ZB 3AREA 1KEMH 5INCA 2CDEA 3N1QC 1JWMB 1DN0A 1OSPH 2WNGA 4DGVH 3FONB 3LHPL 1UFUA 3MV8D 1T04B 4IIQC 4EI5D 4ZDHB 4HKXB 1JRHL 1NDMB 5D5ME 1JWUA 3OR7A 4LMQI 4ZG1A 4NYLA 1LO4L 4G7VH 3X14A 4HGKC 1FFQA 4EIGB 4Q2ZA 2XPGA 4O5LL 3UTZB 2N7AA 5C0EA 1WBXA 4M6NH 4M1DH 3L9RB 1TVBA 1OARH 3QRFM 3JV5A 1JPTL 3R06A 4LPWA 4MXQD 4QXGL 1P9MC 2IANE 4TUKH 3QIUC 5CSGA 1SEQH 1UKTA 1A7NL 1UEMA 4IRZH 1NFIA 1MCKA 3HCVA 3EYVB 2R56H 4E41D 3QHZL 1MRFH 4P2OC 3ALWA 3UP1A 1OTSC 3HC3H 3REWB 2CMRH 4PGZA 3OR6B 1Q9WB 3LD8C 5D6DC 1MPAL 1WBYB 3RFZC 5C6PB 2V5MA 1K2DB 1J0ZA 5HI4C 5T3ZH 1T7XA 3TN0C 4O2FB 4M7JH 3DIFB 4LVNC 3GK8L 3JWDL 3UBXG 4YAQB 1SJEB 1H9VA 4FFVD 3C9NA 3N9GH 4EDXA 3PWLA 3I75A 5FYLL 4F7EA 4JM4L 5D7SL 2IQ9L 4OZ4A 2BDNL 2AK1H 3WFHB 3O6ML 2ESVB 1NLDH 1FNEB 3DHJA 1PKQE 3ULVH 1I1AC 3DMMD 1MAKA 3MRHB 4ZUWB 3NAAH 2VLJD 4NQVA 3PXJA 1IC7L 1S7RB 3RVVC 1W8NA 4GW1B 1MNUH 2YD3A 3O41B 3MFGB 3ZTNL 3SY0B 1X5LA 1HZHL 1QRKA 1CL7L 3T2QA 1RURL 1AGDA 3BZFA 2K3TA 4OLUH 3L6FA 4HIEB 3FQRB 1LE5A 1CYGA 2EDDA 5D7JD 5JZ7D 3QEQA 2ARJQ 5HVHC 3MRMB 1DUZA 1S78C 5BQ7B 2ZPKL 1RZKL 4DGYL 5TE4H 3NFSL 5I73B 3ARDB 5CFHA 1J1PL 1T21B 4XPTL 1U58B 2HFTA 3SE4A 4Y19A 1QSZA 1XR8A 4GRWE 1IC1A 4NZTH 5DT1L 4KK8C 5EA0L 3SE4C 4X4YA 5JXED 4Z6AT 3MXWH 3JWNC 3QCTL 4HC1H 3HC4L 1CF8H 3HG1B 4OV6F 5B21A 3G08A 4XTRD 2GI7A 2J8UA 3AB0B 3AMLA 4OF8A 5IM7A 3R1GH 3OKMA 2ID5A 2GKIA 1B0GB 4N8CH 3VRIA 1U3ZA 4Z5RB 5AZEL 1LEGB 2DQUL 2H3NA 1D6VH 1EBPA 2BSTA 4OM0H 5BRZD 4PJAA 2WQRA 1LQSR 5C2UB 5FKAA 1T4KB 1G7HB 4OUUB 2WIIA 1CICC 1R3LA 4HMEA 2ZUYA 2XYCA 1OLZA 3U48A 3WNOA 1UM6L 3RUGF 2DQHL 1NCCL 2HJKA 1MCQA 3A67H 1HILA 5JMOC 3TPUB 1UGNA 3IJSA 3DPBA 3KYKL 3MRDB 4A6YB 1RZIA 3GSWB 4RZCA 3QNXB 3I9GH 2P24B 3ZKND 2YZ1A 4Z0XB 1DSFH 3CZJA 4XC1H 4LNVA 1X5ZA 1IGTA 5GS2H 4DK3A 2VAJA 5IKCB 3VXUB 3OKLA 1L7IH 5AUMA 5FKAB 2IADA 3KPRA 2VDMH 3MA9H 5C0GA 3QUKB 4U33A 3AAZA 3PGCB 2FATL 4CRPA 1Q94B 4HXBL 1MLCA 4AL8H 3H9ZA 1GC1L 2Q6WA 1GHFH 1R5IA 5GGSA 4HKBB 4KU1A 4XMPL 3UBXI 1VEOA 4PLOB 2ZJSH 3ARZA 2CJUL 2FSEA 4PJEF 4M6OH 1Z2KA 4PUBH 4POZC 2J3SA 4HT1L 4XP9H 3S7GA 3FB5B 1MRFL 2X6MA 5KSVB 4WI5A 3P0VL 5IB1A 5SWZB 3QO1A 1GRWA 4K3DL 3VXRA 1SYSA 1EFXA 4PRHA 4Z0XA 3FRUA 5GHWL 5FIEA 4XVJL 1PSKL 4RGNC 1F4WL 1JMZA 4ZPVB 1TFHA 3V9FA 3QA3B 5FO8A 2ICWA 3WV0A 1ZT4A 4XBPB 3IYLW 1WT5C 1XGPA 5D72L 1Q72L 1OGAD 5D1QA 1DBMH 5KVFH 4IRJA 5FECB 1U8OA 4PGEB 5DFVC 4FTVA 1S7VB 2W0FB 4UTBH 3ZLQC 2OX5A 4IBLT 3O3EB 5CEZH 2D0HA 4OIIL 3BVNB 2UWEF 1BJ1J 5BV7H 1EIBA 2W65A 3FQNB 4C57C 4BZ2L 2H3NB 5GS1B 1C5CH 1RZ8A 4KPHL 1EHAA 1MIML 1TMCB 2L4OA 4R4ND 3U9UA 3O4LA 4JPVH 3CDGB 4I3RL 3SGKA 1V05A 4RX4D 3QIUA 4L8SC 5TQ2L 4HMDA 1J0KA 3KYMB 5DC4B 3ARGA 5TQ0L 4IOFD 2PKDA 3A67L 3KPQA 1QYGH 5EO1B 4PJ7A 1WTGT 3V0AC 1MLBA 4OZHF 1E4XI 3DVNB 3RWJB 1HH6A 5FB8A 4NO3A 1CS6A 4M43L 4XP5L 1TJIL 2ITCB 2CXGA 3UTTE 1I3GL 4HH8A 2X4SA 1YMHB 2BNRD 5EOTA 3QXAA 5DF0A 2NZ9D 5IMLA 3REWA 3AROA 1ZSDA 5H8DA 2XG5A 5E94B 2X4NA 5DJ2B 4NN7B 5C09B 1ZHKA 3B9AA 4AIZB 2A38A 4PJ9D 5I1HH 1CXFA 1JYNA 2EDBA 3WLBA 3IB4A 4MB5A 1MFBL 1T1YB 5FYKH 4YBQC 3K1KC 3S96A 5F7WC 1UJTA 3U83A 4TNVF 2FEDC 5JW3H 1IEBA 4LCCC 2VR9A 4I9WD 2FO4B 4OFYD 1T80A 3UYOD 3BUYB 4DW2H 5C0FA 5GRVK 5GS3A 1RZFL 1AE6L 2CDGA 1UENA 2P8PA 4FQJH 3SDYL 1T66C 2FCBA 5KSBA 4G5ZL 4LGSB 1ZLWK 2QSTA 4OZFG 2BXYA 5FGBC 2BNUA 4NRZB 3T0BA 2YC1B 4FMKA 1BBDH 4K7PX 5HHOB 3TM6A 3EOYG 3QNZA 2G2RA 3WN5B 1FL6A 1FSKC 3QFJD 2ZCLL 4JHAH 4LF3B 1N5AA 1A1NA 4WUKH 1ZLSL 4FRWA 3QEUB 2IPKA 1A02N 1UCBL 2ERJB 5DYOA 4U6XA 2A6JB 5ICYB 4G9DA 4OZGB 1VDGA 4YHMH 2AQ3A 4PY7A 3I6KB 4M61A 3EYUH 2H32B 5C0BE 2Y7QB 5IQ7L 3C5SA 4P2QB 1FVDA 4K3HA 4N0UE 4O2EB 3IXTA 3GI8L 3L3HA 5JHDB 3ARQA 3SKJH 3UPCA 3NZ8B 3P11H 5IJVB 3TJEL 3QIWC 5BVPL 5DC9B 4L3AA 5DJ0B 1IQDB 2AV7A 2FD6L 2X70B 5F6IB 4L4JA 4MNQD 1MFBH 4M7JL 5DD3H 1LK2B 2FHCA 3L7FA 4PB9L 5D6CA 5EPMB 1P7HL 4WNQB 4XP6L 4N68A 2HFGL 3FCTB 2Z31A 3NN8A 1PAMA 4JDVA 4AEHH 1KTDA 2R29L 4TSAL 2VDKH 3UBXB 2R2CA 1WZLA 3FONA 4S11A 3O45A 2VE6A 3KPPB 3MV8A 2DOCA 4G42B 2BJML 1YNKL 3BUTA 4O58L 1NC4B 4P4KD 2BY1A 1DVFD 1T20B 5CJ8A 3VH8A 1XCQB 1CBVH 3MFFA 1WIOA 3QUYA 4NKMA 4ZQKB 4YFEA 3MRNA 3T2PA 1OSZA 2AJUH 4KHXH 1IQDA 3T0EC 3TESA 4P9HH 4P2QD 1X5KA 2IGFL 1DQLH 1BBDL 2EDJA 2JJSC 1YPZF 4YNYB 3HRZB 1U3HA 1UM4H 4DW2L 3VGHA 2WP3O 2VXQL 4XP4L 2KQMA 1WCBA 1LO5A 1P6AB 2QR0B 4FQCL 1ORQA 1YEIL 1IC4L 1EGJL 4AH2B 4JRXE 1OTTD 3B3IA 2DBLL 5JA9A 3RY5A 2MHAB 4NHUB 3BEWB 5TJWK 4I18B 1HI6A 4EIZC 3MBEC 1JPFA 3NIFE 3RL1B 4BYHA 1JE6A 3BPCA 2RQ8A 5DRWA 3WIIL 4YK4B 5J11C 4FZEL 3IKCB 3P2TA 4I9WE 1QRNB 1H0DB 3IU3A 3OB0K 1FYTA 2I25N 3CVIH 2J8OA 1IFHL 3KPRE 5LGKA 4ZFFA 5DA4A 1AIFA 4N8PA 1QSVA 5K9OB 3F65A 5BMFH 1AP2B 5GSRA 2I07A 3S34L 1E6OH 3WNKA 3CXHJ 2G60L 1XFPA 3DI2B 4WHTA 4XWGL 3TBSA 1MCEA 5IW1A 3LN4B 3MODL 3SDXB 5T1DH 4P2QA 1D5MB 1UWXK 1JV5A 3FT2A 1JZ7A 3W11D 4JM2F 2XN9A 5EH1A 1OAYL 4JFQA 5E2TH 5FXCH 5C2BL 4M6OL 5L88H 2HJFB 2FEDD 4AG4L 5F7HA 4YWGL 2OCFD 3QG7L 3MV7A 4UDTA 3STLB 1S9VB 1RV6X 1UA6L 1F6FB 4ZUSA 4PR5B 4U6VH 4HUXA 4QHUB 3K8MA 3RWFA 1Q1JH 3PIQB 4QWWD 1QRND 1S7WA 3LKSA 5FO9B 2C4XA 1MLBB 4YHKH 4HZAA 3NIGE 3SN6N 1MCIA 4Q9BA 4P9HL 1KELL 2P44B 2P8PB 1B6DA 4NM4L 4AJ0A 1TNNA 4XXDA 5JA8B 4JFZH 2YSSA 1CK0L 5DJXA 1BD2A 1NLBL 1NCAH 1QA9A 1F11B 2XY2A 4JZNB 4HIHB 1ORSB 2V7HA 2NY6D 5I1CH 3HC0A 1RULH 1FNSH 5FEBA 5EFIB 2BC4A 2VQ1A 3ZE2F 2D4DA 3ORJA 2X4PA 4DGIH 4ODWB 5MEQA 4OBSA 3EOTL 5TDNA 1KPRB 4FTVB 3ARBD 5L0QB 1LDPH 1BM3L 5KSBF 4TNVK 1I9IH 1JGEB 3NTCH 1AO7E 2VWEE 4FQQA 1BQHA 3HE7A 4F58L 3HTLX 3HFML 2EE6A 2EDHA 5I76A 4LPYA 5T33L 4B41A 4ISVA 1ND0B 3U0TB 5K9QI 1ZLUH 4NKDA 4W6XB 3RRQA 4Z7QE 5DMYA 4XNQA 1ONQB 4YO0B 1ZHLA 2O61B 3SDCD 1FC2D 1Z9LA 3BP6A 3D39B 2YWZA 4LARH 5H94A 3TA3D 2OZ4A 3HB3C 4HF5L 3WYRA 5C9KA 5HYFA 1VFBA 2A9MH 4M5ZH 3TZVD 1NJ9B 1MFCH 2PNDA 4I0PB 5JOFA 3BKYH 2OI9C 1YEFL 3GZKA 1CTNA 3BXNB 3BQUC 5GSRB 4EOWL 3UJIL 4KKBD 2FL5A 1YY8B 1IGCL 4JANB 3CFKA 1KN2H 3BE1H 5E0QA 4HQQL 4G8GD 4J4PC 3UTQA 2YPKA 4RA3A 2E6PA 3GHBH 1BJ8A 3KPRD 4FABL 5DEGA 5FGCB 1F6AB 2DLEA 4UIMB 1T22A 4TN9A 3PL6C 4MVBC 5MEPB 3GSWA 5AZEH 25C8L 3LQZB 4I2XB 3LS4H 4TSBH 4ZFZA 2BZDA 3DJ9A 2B1AH 4WUUD 5I1HL 3X11B 1MSPA 4ORGB 1L7TH 3UO1L 1YEGH 5A16B 4HJJH 4MGXA 1F3JA 4G8IB 4AH2A 1SYVA 4X9BA 2AJSH 5TF1L 3U0PB 3SBWA 4M7KL 5IMOB 1B88A 4F7PA 2PXYA 3QXUA 4YXKH 1BIHA 1J0YA 5E9DE 1FNGB 5C08E 4WWKD 3KYOA 1CTOA 2QEJA 1YJDL 1J05A 2VSDA 3UTTA 3O8XD 3AFLA 1U8IA 1U92B 4RX4A 4NKMB 4ZQKA 3SDAB 2IFFL 3GJEA 1CXKA 2BCKA 2DKMA 2ICEB 2DQJL 3DURA 3S97C 3LZFH 1HZHH 3OBAA 3OL2A 3EHBC 1T0MB 2F5AH 5E2WH 3BKYL 2HH0H 2L0DA 4P2RE 2DLFH 5L2KB 3NCMA 4S1QH 5IFJB 5AD0B 4RZCB 2HP4A 4OZFA 3D5OF 3VWKC 4OGAC 3S4SA 4H1LA 1D7FA 3EBAA 1ZGLB 4HFWA 4WTWA 1T7YA 5C9JA 4ZAKC 2FX8L 5DSCB 4P5TC 4WUUA 2A73A 3CNKA 3CFCL 4JJ5B 3QCUH 3FQTB 2QQKH 1UXSB 4PBWD 4Z7OE 5CZVL 1F4WH 4LGRB 2RHEA 2HT3C 1FBIH 4WO4A 4PJDF 5D2LE 1IVLA 3TJHD 1G0XA 2C1OA 3NGBC 4K7FA 3W2DH 2ICCA 3I02B 4GG6E 1JK8A 3QJHB 4OM0L 3RGVB 3TN0B 3ARDC 2H2SC 3RAJH 4NCC1 3MV9B 1V7MH 4PJ8A 1OP5H 2G2RB 3QUMH 4O4YH 1A9EB 4PTTA 4JGUA 2WBJA 4P59L 4M00A 5D7LD 1U41A 4HJJL 1UJ3C 4OIAA 4QOKB 3IAPA 4PJAF 2VLKE 3MA7A 2EKSB 4ETQB 5BQ7A 3B5GA 3O3DA 1MHEB 1ONQA 1VADA 3GSOA 3DUSB 3OJMB 1K8IB 2FX9L 1K8DA 4ESKA 5KJRH 5HHQA 4G8GE 1RFDL 3CSPA 4ODVL 4R3SB 5E8OB 3VXOA 2HH0L 3QXDB 3QUZD 4X4XA 5DUML 5J0BA 3D3VA 4GRLB 3Q0HA 3MBXL 5FYLD 4KGLA 4MJ6B 4EDWL 3EW3B 4MAYD 1WC7A 3IXAB 5B4MD 2R1YA 2YRZA 1VEMA 5EBLB 2X4PB 1SMAA 2GJZB 2WK2A 3MBEB 4O2CA 3CLEH 4JPIB 1YY9C 3A6OA 2XZAH 2EDKA 3O6FD 4UT7L 5GRUH 4ETYA 4YDLB 2ESVA 1AO7D 3X14B 4FQ2L 4FQXC 4MA7H 4X6EA 4QRPD 3S3PA 1I4FA 4JHWL 3UDWC 4EBQL 3JTTB 3S5LG 3OR7B 4G43B 3KNBA 3MLXH 1EEYA 2DDQL 3L3OB 1JN6B 2OI9B 4APQC 4M7LL 1F90H 1AKJA 1K9TA 4PJFE 2R4RL 3L3KA 3QHFH 1TCRB 3O3BA 3PHQA 1XIWB 3TT1H 4CVZA 5J89A 1IL1B 4KK6C 3FTGA 5KG9B 3GHEL 3CK0L 2HN7B 2J4WH 1RIVH 2ED8A 3C60A 4Y16C 5B39B 5HYJE 2QQLL 4MCZA 4JKWA 2NX5A 3O4LB 4WRLA 3MLZL 4HMCA 4M03A 1AR1D 3WJLC 4OB5H 2HKHL 2IH3A 4C56B 3SJVE 2Q7YB 3EOAA 1NBYB 1MH5A 4HXAL 1ZT7A 1M4KA 4OKVA 3LEXA 1PKQA 4Y8AA 4EUPB 5K9JL 3P0YL 3D0VA 4F9PA 1QR1A 2KZ1B 1U8QA 3TA3C 3U7YH 4P3DA 1N5YH 1RD6A 1VACA 2DQTH 3P73A 3TBSB 4MA8L 1JPTH 3TIEB 1D5XA 4NWTH 4GAJH 3RWDA 1JGVL 3V2AR 2C7UA 1DBJH 1MCJA 5K9OA 1T04A 4YBLB 3LEYH 5GGVL 3STZA 4DEPC 5A40E 2P5ED 4WWID 5JDSB 1J1OH 2M26A 2OLDA 2BXZA 3IDJA 4NNYA 4M7ZB 1C5BL 2CRYA 4HHAA 5D96B 1MHHB 2R0LL 4P2OB 2D2OA 1UZ8A 3LQAC 1RAMA 3VFNB 1OB1B 3CCHB 4XHJC 2YPVH 4Y5VB 4X9IA 1UQSA 3PWPB 2IGFH 1CG9B 3ZE2E 4LVEA 4N8VB 1S5HB 4RRPA 5DZNA 2PCPA 1HYSC 1VGKB 3G9VA 1MLCB 1NFDF 1NFDA 3O2VL 5D1XB 4I48A 5FA3A 1EMTL 4NC2B 5L0QC 4DCQA 1JIBA 1BX2B 3KYNB 2VLKD 5T1LB 4WI4A 4OZHB 4KDVA 2R69H 3F6LA 1N2RA 1R3JA 1TVDA 2Z93B 4TRPL 4X98B 3STBA 4JY5L 3WXVH 2IC2A 3QI9C 5J1TC 2BFVH 3MACH 3TJHC 1I8KA 1BFVH 4MZ3A 4DKDC 3QUML 4O4YL 4Z0BL 4ZPTB 2EEDA 5HYSB 1P53A 2HJKB 4I77L 5C0AA 3RX8A 1KFAL 1QLEL 4KY1H 2VXVL 4ZOBA 2VZ1A 1S7TB 4XBEL 3VH8B 2V2TB 5EZOH 4PJFA 4HWZB 4HKJB 1GZPA 1GOHA 2P1YA 4LCYA 1RJCA 4PP2A 3NMEA 2AJXL 4FQXB 4QXUL 4XPGL 3ZHDA 4MD5A 3W5NA 3UPRB 2Z8SA 2AK4A 1YMMD 5EIIB 3UYRH 2AXGA 4TVPL 3VH8G 3OKMB 3OTTA 4ZYKB 3BT2H 3SKJL 3T77B 2DKUA 5CLWA 3MYZA 5HPOA 4LHUD 4U0RB 5F3BB 4P3DB 3PDDA 4PIRF 4BELD 2BNRE 1ZV5A 4R7DA 2Z9TA 3MMEB 3CC5B 5E5RB 5FDWA 4QTIL 3NZ8A 5F72S 3L3HB 1PG7W 5JHDA 4Z7VB 1HIML 1W72H 5C7XH 1A6TB 2NY4B 3C6LD 5IVZA 3A6CL 2YWYA 4JRYA 4X6DA 4XAKE 1RU9L 5IV2A 1QSEB 4KTDL 4NRYA 4GLRH 4IMLB 3S6CA 4R4NC 2EXWD 1LE5B 3KLHD 1N0XH 2H2PC 3D2UA 1OAZL 2Z8WC 4TPRL 3WS6A 5B3JF 8FABA 1TQBC 1D5BA 5JOEA 5FUZL 3KAAA 1KTRL 1NEZA 4X83A 1I8LC 1XF1A 1IGJA 1S7UB 4OFIA 3HI6H 3VXSD 2JJTA 4P46C 4NP4L 3VXPA 1P1ZA 3KDMB 3VFSB 3ES6B 4QRSB 2Y5TA 3CIQA 4P3CH 3KXFE 4Y16B 1JGDB 4KUZL 1YN7B 3IJYB 5J3HD 4BQ9A 3O9WA 1YEKH 1DBBH 4JO4H 2E9JA 2XQBL 2VZSA 1ZS8A 3EYSH 1AD9A 3GMLA 1FFNA 1NEZB 2ZCHH 5E8DH 4H25A 5CIPB 1TZHB 4F7TB 2MOVA 4PJIE 5KZCB 4B50A 8FABB 3HAEB 3L1OH 4JPWL 3QXDA 5JOPD 4RMSA 2MTPA 2VIRB 4GG8A 2A73B 4UTAH 4RMQA 3P77A 2CLVB 1BLNA 2FYYB 5E8DL 5DSCA 1DE4B 3BDYL 4Y88A 2R0ZL 4KRPC 3SQOH 1I7ZA 2OQJB 4IOFC 2EKSA 1KB5H 2J2ZA 3OXSA 4FXGA 3SJVD 5MENB 4MD0A 4ZNCD 1WZ1H 2R15A 3NZHL 5D70H 1J5OH 4J3OC 3DVNA 3RWJA 1AH1A 5JW4N 4G6JL 4HD9A 1PZUB 2DJUA 3CDYA 2NY2D 1CLZH 5DJAA 3RI5F 4D9QE 3GBML 5DK2B 2PO6D 3ARRA 2X4OB 4PJGE 4JGJA 3WDJA 4H88L 4GMSH 3SO5A 1T7VA 3V5DB 5SWSD 5EU6D 5C07B 2AK4E 4LSRH 5GIRA 5DMKB 4XMLL 4U1KA 3ZE1E 2R1XB 2GCYB 5GRXG 3MOAH 2JCCB 5GS0L 4JKPL 1X5XA 4Z76B 3UTTB 5JUEH 1KOAA 4W68A 2ORBL 2P5EE 2QSCH 3EJZD 3FQNA 1KGCE 2DQEL 4NQTA 4DZ8B 1UT9A 4NQUA 3GSNA 4UBDD 3SDAD 3HNSH 7CGTA 4EBQH 4GRLC 5E6IA 4LSQH 4LLMB 4XC3L 5TQ0H 4CU8A 2FR4B 1FPTH 1IT9H 4O02L 4WW1B 4P9HC 1AD0B 3F6IA 5IHUL 5CZVH 1AGEB 3GSVB 3C5JA 2YMXH 1MELA 4ZPTA 4ZFZB 1JTTA 5JW5A 2Y25A 5A2IH 4OF3A 1A6VH 4Z7WE 5MEPA 3VD3A 5ISZD 4OSUL 4KGJA 1KCVL 4DKFH 2Z93A 5D2NB 5JPNB 3VGEA 1DBKL 1SBSH 1LP9F 3IDGA 4MHHI 4PG9B 1S5IH 5EU6B 1KC5L 4N0RA 1T7ZA 1MHPH 4LAJH 4YDJB 5E8NA 3MLUH 4KKLD 3RHWK 4OZIB 1XT5A 5KSAA 5I8KH 1WF5A 2IBGA 4HKBA 4X9HA 3ZTJG 2PCPB 1KCVH 3EYQD 1HINH 3NIGF 2AXGB 3JWDH 4OV5B 1WTLA 3P4NA 3WN5C 5DHVB 1FSKB 1MHPL 5TFSH 2DQTL 5F7DB 1VGEH 1QFHA 4TUOA 2QL1A 1GZPB 5GGQL 5IFAH 1JYXA 4JN2B 5H94B 5F1IA 3BP6B 3RVXC 3SE3C 3DVGB 3QDMB 3VRLE 1NMBH 3IFPA 4X8JA 3H7BA 3NFSH 5LBSL 3QWOB 3K8LA 4JPKH 2SEBB 1QHPA 2YUVA 2R4SH 1OHQA 4WW2A 2HMID 5EUOE 4U49A 1WEJL 4M93B 1PZ5A 1TJIH 3NCYP 4CUCA 1XCTA 1KPRA 4LSQL 4NZTL 5E8PB 2CK2A 3GMRA 4U1LB 1F97A 2BSSB 5FOBB 5CGYD 4ODTH 4OKVB 4OCWH 5GGUA 3REVA 1IGMH 4X6DE 1FO0H 2MJWA 2XXCB 2FJFB 5DRXA 3HC0B 5BRZA 1AO7A 1RZKH 1Z0NA 2VLLA 1CE1L 2R8SL 2FL5B 5E1AB 4GO6B 2JE8A 3WMSA 4OQTA 3V0WL 2J8HA 1KCRL 1EAPB 4XXDB 3SCMA 2AJYH 1CIUA 3BPOB 4FS0A 4GKSA 4D9QD 3FTGB 4E9LA 5KG9A 3QDMD 1PW3A 1J8HE 4PJDA 3W9DA 1RZKC 3MO1B 1UM6H 2Y07H 3L3KB 4X6FA 5ESQA 3B9KC 4PJEE 3L3JA 3DHMA 1KB5L 2D7TL 3MBXH 2R1WA 3WFDH 1GAFH 2YUWA 4NQCA 4XPFH 1XMWA 4X6EB 4LSUH 2NLJB 5CGMA 3CLFL 2FDBP 4KMTH 2DQCH 1I3UA 3LOWA 1KC5H 2Q8BL 4G6FD 4ZUVB 3NACL 4U2YA 4HIEA 3L6FB 2DLTA 2Z92B 4WTXA 4L5FL 1UJ3A 5EBGA 5CWSB 1CE6B 5E8EA 3RWHA 4EUPA 4KQ3L 4CDGC 5GRWA 1TCMA 3OJ2C 2BC4B 3ZZ1A 4EUPG 3GRWL 4L9DA 4LU5H 2XNAA 5L9DH 1EK3A 1CLOL 3MSPA 3N0PB 5ACZA 3PWVA 5F9AC 1VEPA 4BSVB 3RY6A 2ZOLA 2C1PB 4HWBA 3LDBB 1D9KB 3AC0A 5A43C 3VCLB 3HHRB 1FNEA 2DBJA 3HZKB 5E70A 1RJZA 5F1KC 5HVWA 5CEZE 5CILH 5B39G 3I75B 5TDOA 3ZDXE 1XGQB 3TT3H 3MR9B 1R24A 3ARFB 4KRNA 2BSRA 1JNHA 1TTGA 4MA7L 4P2CG 3SDAC 5F88B 2V9RA 3B2VL 1KB9K 4KVNH 4LKCA 4YX2H 2MSPA 4WFEE 4G8FA 4I18A 5E2JA 4G6FB 3V8OA 3SDXE 4YHPB 4QT5A 2XRAH 5TGBB 4UUJB 3B9VA 1U2HA 1HIMH 5F7EL 4YK4C 2GITB 1UYWL 2OTWB 2F53B 1REIA 1CICB 4LLUA 4QXTA 2A6IB 4BA8A 4LNRA 2XN9B 1DANT 1E4JA 2B4CC 1DL7L 4YHOH 2QTEA 3MV9D 3SDCC 5KJRL 3NCJL 3UZVB 3UTSE 5KVFL 1D9KD 3SDYH 4XNUH 4XBGA 5JNYB 4FQIL 3WLWC 3B2UC 5FCUH 1X7QB 1A6WL 3QUYB 5I8CB 1KIUA 3MFFB 4X6CF 1U93B 2FWOB 1PYWB 4XCEA 3O6FA 1XF4B 1ZGLA 1J0JA 1A1MB 3FFDB 5FHBL 1S7SB 4JLRA 2MMXA 1PGRB 4JKKA 4G42A 5EU3B 4ZNEA 3KPPA 4P4KA 1KFAH 1YMMA 4DFIA 1JHLL 3IDYB 5HYJA 3OG6B 3WHE1 2E8ZA 5I1LA 3AREB 1U8MA 2NY6C 1CLYH 1MCCA 2XKNA 4PRPE 1CICD 3PE9A 5D71L 3V52H 3F8UB 2ZUWA 1CFQB 3X3FL 3LS5H 1RZ7L 1AJ7L 3RDTB 3WSQL 4BK5A 3QUMA 3QXWA 4ZNEE 3QG6B 4P23B 4XNXH 1KLGB 1NEUA 2MNUA 3KR3L 3TVMC 4Y19D 3DO3A 4N9GA 4BH7B 1QQDB 4Y4FD 1L9NA 3GKZA 2DM7A 4MHHG 4M9PA 5D9SB 4WHYH 4LLAA 1VPOL 3KYKH 1H3GA 3VXME 4GLRI 1S78D 3NCCB 5B22A 1CXIA 4TNWK 3WIHL 3EIFA 2R23A 2HT4C 4P48A 1HHGA 1KCSH 4RAVA 3RWIA 1CGYA 4I0PC 1EAJA 3QUXB 3BRDA 4U6YA 4CW1A 4PRAA 3GNML 4NFBA 3AY4A 2P7TB 4YDLC 1V3MA 2XWBB 1ERNA 4H5SB 1KTDB 4NWTL 5FAAA 3S34H 1WWBX 4JKPH 1E6OL 3TO4D 2J6EH 3MNWA 5IR1B 4OAWB 2APXA 2FZ3A 2KQNA 4JANA 4PLJD 3V5HA 5E4EB 4U6YB 4CW1B 3WJJA 4RGND 3QDGB 5IVXB 2B20A 3UC0H 4RAVB 4Z78B 2JLLA 4BUGA 4MDJB 1NAML 3SDDA 1OLLA 3VG0L 3ZYJA 4L9LB 2YD6A 5E7FA 2EE9A 2Y7QA 1CFVL 5EO0A 3UO1H 3DMMA 1ZLWH 4N1CA 1JI2A 3U7AA 5J9PB 1NFKA 2ZKHL 5FYLE 4CNIB 1ZANL 1ZHKB 4YO0A 2NNAA 2IBZY 1JF5A 5E6IC 5FO7B 1BD2D 4OF0A 4PJBB 4PGJA 2VNCA 1Y0LB 4OGZA 5E9DB 2A74B 2FX7H 4LOUD 3TNNA 4PLNC 3D85B 4NQCB 2JJSA 4ZODA 5DZOA 4MNHA 3AM8C 3ZSTA 4LKCB 1KXVC 3BGFC 3BJ91 4OLWH 2CDFA 3OGOE 2ICWI 1TTUA 1CBVL 4OJFL 4YHIB 5BZDB 1A4JA 1WQVT 1I85A 2VDLH 2EDEA 3KPMA 4XPBH 1M7DA 5T1LD 4NO0A 2BVOB 4CGTA 4Z7QF 3IFOB 4PJ5D 3QCVH 1SJVA 5KAQG 3CVHB 1F11A 4BZ1H 1NMAH 4QHLB 4CN6A 5AAMA 3TWCH 4EQ2A 1YC8A 3BEVB 2DIBA 5L88L 3GJFB 1BFVL 3PXHA 2NY6B 4KJWD 4FP8H 3OKNA 1U6AH 3RTQC 1YECL 2P43B 4XCCH 3D39A 3OKOA 5T33H 2WWKO 2VDPL 5T5FL 4OLZL 4YXLL 1XCTB 4NJ9H 3PIQA 3HC3L 4G6KL 4MA1B 5CJXA 1LO2H 3I6LE 4HPOL 4WW2B 5J12C 1ND0A 2JTDA 3VG0H 1EEQA 3C08L 2P45B 3MUGB 1WLHA 2GSGA 1NL0H 3ARPA 2HJFA 4HW6A 1R0AH 1Q0YL 5LAXA 5IB5A 2D03L 5B3NA 3LRGA 4YUEL 5HPMA 2Y06L 4YC2B 4POZD 1FZMA 4P46A 1WJ3A 3MV9E 1CFNA 1FJ1A 1B9ZA 1NGPH 2Y36H 3QEGL 2ESVD 1ES0B 4MLSA 1FNLA 3QPQC 4Q6IA 2VZVA 3K7UA 4G5ZH 2AQ2A 4NUGL 4OCXH 3V4VL 5KSAB 2DLGA 3FN0H 1KJMB 1IM9D 4KK9D 4U1NA 5ANME 4PG9A 3LQAH 2IAMB 4OQ1A 4K8RH 4U6HB 5HHMB 4ZS6D 3DNKA 2E7CA 2DJSA 4PGBB 2E9IA 3LKPA 5DQDL 5FO9A 4KPHH 4LSPH 5H2BB 4XPHL 5F97E 3CFBA 1Y18A 1R3IH 4I8DA 1QBML 1A9BA 3ARXA 43C9A 1CVSC 1VFAB 4RFEA 1HI6B 3GSXA 4HLJA 3SGJC 1A7OL 3MV7B 1AGEA 3GSVA 1UJ3B 2VDQH 2ZSWB 3ET9F 5D7IB 5C0CE 3ROLA 3HMXA 3FRUB 5CBAB 1U8PB 3NA4A 3Q3GA 2I5YL 3V6BR 5E6IB 4N5UA 3ZKXC 2R2EB 3UMTA 1MWAA 1T4KA 2DYPD 3ZTJH 5IHUH 3MREA 4NQXA 2WBWB 1I3GH 2ARJA 4I4WA 5A2KH 15C8L 4X6FB 2ZUQC 3P4NB 3PP4L 2DDQH 1B0GA 3F7PC 3E2HB 3OAYK 3ARBA 1A47A 4OLXH 4KKAD 3VXQA 2RFXA 5E8NB 4LSDA 1MCWM 4I5BB 2IQAA 3RIFK 5JPNA 1I7RB 5IKCA 5HYJB 1RUMH 4XVSL 5C0RH 2AEPH 1QPXA 1QLRB 4PJ5E 4KRMB 1QFUL 2DMKA 2VDOL 5IROC 3PNWA 1V7ML 2H1PL 4HS3A 5C0JB 3RX5A 2IANA 4NQSA 4L5FH 4YQXL 1ZT1B 3GBNL 3QR2A 3CX5J 3BWAB 3C6SB 4PJIA 3F58L 1J7VR 2VDML 2VLKA 3HE6A 4HBQA 4PD4K 1SEBB 3TZVB 3RTQA 4F7TA 4F9LC 4L4VE 1EHNA 4E5XA 4QXWA 4YNYA 3UJIH 1TJHH 3RZCB 4G8GA 4PY7B 2H6PB 1MVFA 3QEHB 2PTTB 3NA9H 1T3FB 3Q1SH 2CLRB 3C5ZA 2A6JA 2DD8H 5GXBB 5GRZA 5ETUA 5DMGD 5IJKC 3IDIA 4LVNB 1OD9A 3HPLB 4XC3H 1B0RB 1XH3A 2VDRH 4F7EB 4CMHB 3NPSC 3VXTA 4PV9B 1MI5D 1S7QA 1CE1H 3MJ9H 4LCWE 4UDUA 1AR1C 2W9DH 3KHQA 4PB9H 5C0IB 1FFOB 1EJOH 1V7NH 1CVRA 1IEAB 2UZYB 2ZJSL 2Q3ZA 4OCMC 5FK9A 1DUZB 2H9GA 2DN7A 5CINH 3MZGB 4PRNA 5DO2D 5TDPA 1Z9OA 3TGXA 3MRIA 3GO1L 4LLDB 1GOFA 3FRPA 4GSDL 4ZSOB 1U91A 3KPSA 1G7PB 1YJDH 3EYVA 2NXZC 25C8H 4OLXL 4JKLA 1VFMA 3MGOA 5DDHB 4Z7VA 3O81A 3TH4T 4XP1L 2W59A 1X3DA 5E94A 1FCGA 3MRQB 4R7NA 5LKNA 3ES6A 1UM5H 2YXFA 3F12B 1N5AB 3WFHA 4LF3A 5BXFB 2ZG1A 3O6LH 4NYLB 1DVFC 4K8RD 2H45A 1G9MH 2WWKT 5E2UL 1LP9E 3V5DA 1CDIA 3BT2L 2VZOA 2BDNH 4PPTA 1H3PL 3S8WA 2WWMC 5DUPL 3KLAA 1KTLB 4GKSB 3G04B 2CH8A 1MJJA 3HZKA 1KIQB 4R96A 4S0TD 5JIIA 3RUGA 4MLIA 5ILTH 4PJIF 5HGHB 3TBWA 2DQDH 4Z7WA 4PS4H 3M17A 4R2GC 3S96B 3QNYB 3HZYB 4IIQB 3VRLF 3ZO0A 3EYOA 2X4RB 2BSSA 3O3EA 4DQOL 1R3JB 3PQYA 4TPRH 4OTXH 5DEZA 3DXAB 3KJ4C 1R5VB 2EO1A 3HI5L 1M6OA 2FIKB 2Y07L 4M4PA 1A7PH 5D7LB 5ADOL 1QBLL 5H35B 1T89A 3HR6A 5IT2L 2OTUB 3QQ9D 4NJ9L 3MACL 3QDJD 3IFPB 3DECA 3PWPA 1EFXB 2J6EL 3VXRB 4G7VL 4KTDH 5ESVB 4FFWC 5ANMA 1MF2H 5EO1A 2X5PA 2FB4L 3QULA 1UB5A 2E3VA 2BNQA 4JVWA 5I19L 3S35X 3QG7H 4R97B 3FHQA 2R2BA 1FVCB 5GZNC 2F9BT 4X7EC 3BQUD 4K7PL 1YECH 1OAYH 1PLGL 1WICA 4KAQL 1G6VK 1BIIB 3SE9L 5FOJA 2Q86B 2EIEA 4LPXA 3FQWB 4N0FA 3EYFB 4NM4H 1X4ZA 3FFCA 4J4PD 3EJZC 4JG1H 5IB2B 3VDCA 3QHZH 2DM2A 1G7LA 1HHJA 1MEXL 2D7NA 3FFCB 3RY6C 4HIXL 4JGMA 4MVBD 3LEYL 1MCHA 1LEIA 2Q7YA 1NUDA 3GB7A 3QNXA 2JELL 3I3EA 2DQUH 1N59A 1XGPB 5I1CL 1FORL 1KPVB 3HS0A 4YUEH 3ZDZF 1UEYA 3SDDD 3WFEH 4JZOB 2VRAA 1NBQA 5IBLC 2ED9A 4Y5VA 1FCCA 4GQ9H 5SWZA 4PJGB 2ADGB 3AS1A 5F7UA 3B8SA 4JN2A 3GMOA 3ULVE 2XOTA 2QQLH 1XIWA 5ESVA 5HHNB 4KJYA 2AKRA 2AK4B 5C07E 5KTEL 1NDGB 1INDL 3C2SA 2CKBL 5E56A 1LO3H 3IS1X 2B2XH 2HVJB 3O2WH 1J8HD 4ONHB 5CD5D 2GCYA 3A6BL 1M6OB 2FIKA 2J8UB 1CD8A 2R4RH 3TIEA 1IGFL 3PGCA 1YEJL 2GQHA 4JVUA 2W0PA 3DBXB 5D7KD 2O93L 3L5JA 3H6JA 1OGTA 3HZMA 4LHUB 2W9LA 4MAUH 4IRSB 1BOGA 2OL3L 3CUPB 1CXEA 4WEMB 4OIBA 3B9DA 3TWCL 1CZ8H 1HH9B 4WFHE 4ZXBD 3TBWB 1C5DB 1CD1B 2VLRB 4PJXE 3WHE0 5E5UB 2PTUA 2F58L 4JG0H 4UQ3A 2CIIB 4OLWL 4P2RA 5C0ND 4KVCH 1JYVA 3CFEA 4HKZB 3HNSL 1QSFB 1NCUA 2APBA 4MSWA 1QO3A 3ROOA 4Z7NE 1JPGB 3P77B 5ACLA 5J1AB 3CXHK 2AERT 4I48B 2Y4SA 3LPWA 1KLUB 2WIIB 4ODSL 4F8TA 5CHNA 5DVNA 1IBGH 2HT3D 3I50L 2V2XB 3WO4C 2Y1VA 3GMLB 2EDTA 3TCXA 1ZS8B 3TBYB 4HFUL 1QEWB 3M8OL 3H9SB 3VRIB 1EMTH 5JQ6H 1P4BL 5HY9A 4E42A 4AEHL 2MCPL 1NUFA 2Y6SD 3S88L 1E4WH 2VYRE 1DQQA 1MFEH 3LVEA 3MLWH 1FVEA 4X6CB 2VQTA 3PGDA 4MNQB 4CMMB 3CSGA 3S36L 4ZMAT 3H9SA 3N06B 3S35L 4YDVA 2AJZA 2MQ0A 2GTZB 3MJ6A 4HUUA 5T3XH 2ERJC 3U30B 3SGDI 2NY1D 4NQDD 3K3QA 4OFKA 4OLVH 3MRJB 3OR6A 4YHKL 2A0LD 3MLRH 4JFOA 3TVMB 1EHLH 1VADB 3GSOB 3B9KA 3OSKA 4D8PA 4FTVD 3MRJA 3ARUA 4LRNL 5C9JB 5HGHA 4X6DB 3LMJL 1BVLB 1LO0L 1WWAX 1A7BA 2HJLB 3SY0A 4U1IB 1YEHL 1WT5A 5F6IC 1S3KH 2V17H 5DK0B 4ZAKB 4YDVB 3MYJA 4FQLH 4XVTH 1BOGB 1II4E 2AEWA 3O6MH 3PGDB 4LLVB 1HOCB 1JGDA 3CFDA 3IVKA 4Y5YA 4OT1L 5EULV 2YN5A 2VN7A 5HI5D 2HG5B 4PG2C 2JIXA 4PJAE 4QHNB 3OJDB 5ETUB 3JUZA 4R97C 5H35A 4WI7A 3ULUD 4PJ5A 5F3HA 4EDXB 1P7QB 3LRSB 2B4CL 3OJDA 4N0YH 3P30H 2P8LA 3VWJC 1PJ9A 2YRPA 4LSSH 3P9WB 4MD5B 2WWMD 4YBQD 1O7VA 2ENSA 4W81A 5I1DB 1Q9WA 1P84K 2KZWA 4Y19E 1LWRA 5DK0A 4ZAKA 1T6VN 4MJ5B 3O0RH 3FO0L 5A16A 4D9RE 3M17B 3Q6GH 3OXRA 1BQHG 3F62A 1EO8H 3DX7B 1AHWC 4R4FL 4R26L 2OM5A 2ZNWA 3HUJF 4NUJB 5FF6B 1F3RB 1I1YB 3HZVA 3IU4L 3K2UH 3U36B 4NOFA 4S1RH 5HHQB 3BAEH 1Q0XH 4KQ4L 2E7LA 4XP5H 3EDJA 2FD6H 2YPLE 1D5ZA 1T0MA 4RDQG 1GC1H 3HR5A 3LQMA 4BFGA 1MQ8A 1F2QA 1WFOA 3ZT5A 4X6BB 2CO6B 3ARFC 3GHBL 2PYEE 2N56A 1BIIA 3WO4B 3L5XL 1FVEB 4X6CA 3KPOB 1UVQB 3OAZK 2GK0B 4DTGL 2X1WL 3NCEB 2XZAL 1GC1C 4WU7A 5DD1L 1CD9B 2L7UA 3BPNB 4S1DD 4G6MH 4JHWH 1OTUD 4HWZA 5MHSE 3HUJE 2YMXL 5ADOH 2V9QA 1RK0A 5I16A 4Z7WF 3BKML 2WLYA 3BGAA 4KXZH 5C09E 2PN5A 3STZB 1S9YA 5CKGA 2AS5M 2XN9E 1BFTA 4L3ED 5C0NC 2C7UB 3OX8A 3MRKA 3ZKSD 4MS8D 3GSXB 4KTEH 1SEBA 1HQ4B 4PJ9C 4PRBA 4H8WL 3ROOB 3TFKC 1JZ3A 1GOGA 3MRCB 1GGYA 1SY6A 3QFJE 2X4RA 1FAIH 5TF1H 1DVFA 4YHLH 4JRYE 1ZMYA 5DQJA 4EUPH 2IH3B 4UDUB 4HBCH 5CGTA 3KGRA 1UB6A 3MRPA 4AMKH 1EJOL 3FO9B 1T5WB 1T6WA 2F54B 5DUPH 4PJ7E 4HAFA 5HHOE 3DBXA 3DYPA 2LTQC 5CD3A 3IDIB 1MJJB 1GVIA 4N8VG 1FZMB 3GBMH 4P46B 5KSUA 4M48L 5LBSH 1MHHA 3BWUC 5BV7C 1T3FA 5J13B 4OI8A 35C8H 3HLAB 1MQKL 5BVJA 3RDTC 4OZGE 2CJUH 5FKPB 1WSST 4NT6A 1IGCH 3ZMRA 4DGYH 2Z91A 4JE4B 4K9EH 3S37H 5C0BB 4LVHB 1DBML 4JZJA 4WWKA 3T1FA 3VWJB 3MGTB 3CFCH 35C8L 3V4PH 5F44A 2NMSA 2X44D 4ZOEA 5BXFA 4FNLL 2WBJD 5C1MB 1DN2A 1SYVB 2CUIA 1ZE3C 4UT9L 3QI9D 1JI1A 2ZZUT 1BAFL 4OFPA 3V6FA 3X12A 4PYHA 2NTFB 3IDXL 1KJ2B 5C6TH 3EOAB 5I1JL 1ZTXL 2HT4D 1QLFB 2AJSL 5IHZA 2FEEL 1N3NB 2HAZA 4NKOA 1WIPA 3N1FC 3KPSB 4M6ML 4P3WA 5IB2A 4NIKB 3GGWA 5DURD 4LAQH 4QHKJ 2GTWA 3C87A 2ZCKL 4P99A 4YXHH 1JJUA 2H9GB 3TBVA 4L8DB 2NYYD 4LVOC 3KPNB 4PTUA 1A4JB 4XPFL 2GJJA 3KLAB 5GSVB 1BVKA 3W0WA 5CD5C 1FNFA 4I0PA 2IFFH 5KSAC 2EC8A 4OD1H 5ID1B 2BNQB 5I71B 1YN6A 3LCYA 3QPXH 1I4FB 3FOMA 4JRXA 1QYGL 3V0VA 1HHHA 1AFVH 1SJHB 4JQXC 1OT2A 1FYTE 3FB8B 5J11B 4WU5A 2P8MA 4CJ1A 2H26B 4ONOA 4XNYH 1G6RH 3MBEA 4O2CB 5HJ3B 4K7FB 1YA5A 4MAYB 3L1OL 4JPWH 5J9PA 5C09D 3HE7B 1KEGL 2FATH 1RHFA 4JM2A 2Z31D 5DJ6A 2EZ0D 4L9LA 1NBZB 2FIRT 5GRVL 4Z9KB 4DTGH 2UYLB 1Q9KA 2V5RA 4BQCA 3U46B 4AM0A 3EFFA 3MOBH 3OKNB 4U1GC 1MF2L 3TO4C 5C86A 3H3KA 3FFCD 4J4PA 1JGLL 5SWZD 2E7LC 5EORH 1QFWI 3PWNA 5C0JA 2VKXA 3GSQB 4OCRH 3S4SB 4JQIH 2CXKA 1FHGA 3E6FA 2F8XC 1WFNA 4G3YH 3O45B 4GT7A 2XKUA 3O4OB 3RL1A 2YPLD 1JPFB 2IH1A 5HYQA 3NAAL 1E28B 4PGDA 3QSKB 2DL2A 3QJFA 4NKIH 2ZPKH 4YHIA 2O5ZH 5BZDA 4IOSD 1NCBL 5D1ZC 3QRGH 4HUNB 4QF1A 1T1ZA 4JFEE 2XV6B 3X3GH 4P4RB 3MXVH 4EN3C 2GSGB 3MV8E 4N5EC 3RGVD 1U8IB 3RVWD 1RURH 2QADD 2EH8L 3ZYIA 1J05B 2VDNL 4BH7A 4WEUD 3E8UL 1BEYL 2ARJB 3TF7C 1ACZA 1RZGA 3C8DA 4PRDA 1JFQH 2OZ4H 1LE9B 4NO2A 2CMRL 4KWUA 2DQGH 4LCCA 4MNGA 4GBXB 5SV3A 3ARYA 1I3RA 2VDPH 4NKQB 4WDIB 1P4LA 1OAKL 2CKBA 5BVPH 4AENB 5J7CC 4ZS6C 2ADFH 5I1LB 1QPPA 1DBKH 4PJGF 4OBRA 5DK3A 5HGBB 2OK0L 1PG7H 4ZFGH 3S37L 3FO2B 3AXLA 4YHZL 5SX4I 5H2BA 5DJYA 3L5WA 4YHYC 4FNLH 3PJSA 3MNWB 2X42A 5IR1A 1A1MA 4V1DB 1L9MA 3NIDF 1AQDA 4CBPA 5I8OH 1S9WA 2EH7L 4K8RL 4KRPB 5HHME 1JHKH 1KJMA 1CGSH 3MRBA 1NAMB 5E08L 2Q76A 2PYFA 3DWTA 1FLTX 1IC7H 4H0GA 2F5BL 4XBGB 4OJFH 5EU5B 5AG9A 4D0DA 3D85A 1RJLB 4YC2C 5K33A 2IPUG 3RVVD 4CJ0A 1T1XB 5I71C 5T1KB 2VL5B 4L8SA 3GKWH 3MV7E 1OL0A 3WLBB 5TH2B 1JWSB 1O5DT 5CEYB 1ITCA 1DQJA 4G9DB 3SHSA 4XMLH 3K4DA 4M6NL 1QQDA 4OD2B 3UYPA 4KQ4H 1U3HB 5D7IA 2DMBA 4Y4FA 3HE6D 2BVPB 4XTRC 5EZOL 5BOPA 1QFWL 4RISL 3M8OH 3PP4H 3MRNB 2YC1A 3EFDH 4KZDH 3DYOA 4OD3L 2JB5L 2QQQA 4ODBD 4KVCL 3LKPB 2BVTA 2PETA 3RVUD 1NCAL 5B38B 3LIZH 5ITBL 5DJYB 4LVOB 2DRUA 1TITA 2Y23A 4HX1A 4HUWB 2ITDA 3E3QE 2WINB 3B9KD 4HZLA 3L3DB 4ELKA 4EEEA 5E00A 5FGCE 4Q6IB 5FYJD 2VDLL 2JELH 4WDIA 5DFVD 3T8XB 4MQSB 3BP5A 1T1YA 1A3RH 4LPCA 1PG7X 1G1YA 1G0DA 5GGRY 4TVPE 3ZKNC 5CP3H 2HFGH 4HS6A 5DFTA 5BRZE 3S35H 2VZ3A 4O9HL 3QUMB 2WIMA 4LNRB 1A0QH 2R1WB 1OGAE 4MA3A 3M45A 1MCNA 2P8MB 2AABL 1CL7I 1NC2B 1I9JH 3VE0B 2QSVA 1HWGB 4BFIB 4ODWA 5MEQB 5IB1B 2VO5A 4UV7H 1Z3GL 3X13B 4I77H 1FL6B 2R56L 4PJ7F 1KCKA 3MXVL 5EUKA 5IFHL 5C6WH 5CJOH 1OAXH 1PX4A 5EU3A 4WHTB 1ORSA 3MLXL 2AJ3B 4TRPH 1IM9A 3WE6A 1OARL 5GJTH 3CMOH 4U1NB 3QT2A 2XT1B 5SWZE 2XZCL 3REVB 3BVNA 1OWWA 4UAOB 1P4BH 5GS1C 4BSVA 1WWWX 5HHMD 1KT2B 2E9BA 4EQ3A 1NBZA 2ZCKH 4D3CH 2QQKL 5D1QB 1NCDH 1HE7A 1OW0C 1PFCA 4ODSH 5BJTA 5IHBA 2J88L 5DQDH 2K1MA 5LAXB 5FM5O 3GJFH 4K3JL 3WFCL 2R0WH 1X5HA 4L4TD 5TGBA 3F7QA 3MUGA 4KKCC 5D7JB 1ZA3B 1B4JH 4G8FB 1YN6B 1UM5L 3VFVB 4NZUH 4TUOB 1RUPH 3AS0A 1RQ5A 2DYPB 3PABA 4Z7NF 1UH4A 1Q72H 1GL4B 3QG6A 4HK3J 5JO5A 2EDLA 5C07D 3WNMA 3EDDA 4L8DA 1ED3B 1IAKB 3G08B 2NY4D 3MCLL 4MYWB 1P2CB 4JHZA 2OP4L 3HMWH 5JIPA 4XRCB 3V6ZA 1AC0A 2JKXA 5FDYA 1JZ2A 1MAML 3EO0B 3SDXF 5D2NA 4JAMB 3P3YA 3UDWA 4DUXA 1OGAA 5D1QD 4PG2A 3IFOA 3MXWL 2P7TA 1YUHB 2UY6A 4Q6IC 4U0RC 3RGHA 2JJWA 4L3CA 5GGUB 5FYJE 5HHXL 4A6YA 3TPUA 1XF4A 4OCRL 1A3LH 2MHAA 5EC2A 3HE7C 1BQSA 2FBJL 4MDIA 3DTXB 1I3RB 4EI5B 1F90L 3GI8H 4PRBB 1FAIL 3IDXH 4FFYL 1ORQB 3BZFB 3IETA 5GRJH 3OX8B 2W9EH 3GMPA 3TIDA 3N1MC 4TVPD 1F4AA 4WCYH 3BD4A 2FJHA 3H7BB 1UYWH 1FVDB 4O2EA 1QZ1A 5D6DA 5GRUL 1EHXA 5D7LE 3FQXA 4GXVH 4KTEL 3H3PL 1P84J 3MO1A 3T3PF 5KOVC 2A6DA 1T1WB 2X1QA 3NFNB 5KSUB 1AE6H 1J18A 4QXTB 1Q9OB 4G3YL 1ZKAA 1M7IA 2VUYA 3JV0A 4APQD 3SQBA 1JZ8A 1AGCB 4WHYG 3QNZB 3WN5A 5GPRA 1C5CL 3BH9A 2B7DT 3O4LE 2FJFA 1HK6A 2YZ8A 5I1EL 1ZWIA 4PRIA 4JPVL 4MXVE 2ILLA 1F4XH 1ZLVK 3LRHA 2GT9B 2EYTA 3SJVB 4F8QA 5B38A 3IS0X 3HR5B 1TQCC 3PWNB 3INUH 4H5SA 2DQJH 1PYWA 2X89A 3L7FB 2DLFL 3MV11 4PLJC 2BVEA 1WEJH 2XFXA 2XG4A 4UV4H 5E6ID 3AXLB 5DJZA 5F9DC 4P0DA 3UX9B 3T3PE 5EIQA 2C1PA 4NQDE 4NUJA 4P2QE 1HILB 3IDYC 3SBWC 4IHOB 2OR9H 1L7IL 3HCVB 2G5RA 4Y5VC 4IDJL 1FFPA 2YOCA 2AEQL 3RJQB 4GW1A 4UNUA 5C71A 1EO5A 5E08H 1NCTA 4L8CB 1C12A 3G6JA 5D1XC 1G9ML 5B3JE 4K3EH 4S1SL 4ZS7L 1TXKA 1OF2A 5LGJB 1KLFA 1GGIL 3VFSA 4P23A 2XICA 5BZWB 3FT4B 3PWPE 5IM7B 15C8H 1H8OA 3C9NB 2P5WA 5IGXH 2D7TH 3HMXL 2Q76B 4M7LT 3MRBB 2EE3A 4LHQB 2FO1A 1QVOA 4KK5D 5CIPH 4QF1B 3WIHH 2E9WA 2BSRB 5HTSA 3MOBL 4YQXH 1D5BB 4P57B 3G6AB 1XR8B 1ODAA 3KPNA 1AR2A 2LVCA 5CKAA 5BS0A 3MUJA 3PG2A 4O5LH 1N4XH 4WW2F 3ARGB 4DEPB 1RSFA 1QUNA 1Q1JL 1U8HA 1VHPA 1DBBL 4JO4L 3PWJA 1QSEA 2VDNH 4NN5C 5IIEA 3QDJA 1HNGA 4DKFL 1AKJD 1CDGA 4F37K 4NKOB 2FWOA 1LMKA 3IAQA 1EV2E 4PJXB 4MJ5A 4G8EA 3F5WB 4MNGB 1TJGH 5JLZB 3UAJD 3EFFB 3KHOA 4LLMA 4BUHA 5IBLD 5E4EC 3H42H 2OXGA 3EZJB 4XBEH 4LKXB 3T0EB 1F6LL 3IJHB 3ZHLA 5FECA 4DZ8A 4HWBH 2VITA 2C3WA 2QADB 3O6KL 4UQ2A 5I1EH 3V6OA 1G7QB 1TETH 1MI5B 4IRSC 2FH8A 1FP5A 3H42L 4J6RH 2YD7A 1INQA 3NFPB 1A7NH 4FZEH 5GIRB 4XH2A 3ZE0F 4NNPH 1QRNE 4YPGA 1ZTXH 4XVUC 1HH6B 4Q74A 2B0SH 2CQVA 3FMGH 3KDMA 4I13B 3HFMH 4LLWA 5LCVL 4QRRB 3SCMD 4YIQA 3HKFA 1BREA 2QBWA 2VZTA 2ZNXA 3G5VB 1SJEA 2AGJL 5EORL 1GXEA 4JFPA 4LSVL 3SKMA 5GRYA 2BNRB 2IBBA 4F2MA 2FSEB 3ULVL 4F33A 3BPNC 4OM1H 3HMXH 3I2CH 5HYSA 3IFNL 1JGUH 3V5KB 3WIFA 1CFTB 3ILPA 2XQYK 4TQEL 1XF5B 4NM8H 4L3EE 4KV5F 2YK1L 1HDMA 1O7SA 2VIRA 4GG8B 4JFFD 4UQ3B 4UU9A 5IHLB 4MQXD 4RMVA 2YN3A 3ZE0E 3B8YA 5ACZB 4JO3H 1BF8A 5J06A 4JM2B 3UTSA 5SWSA 4J3UA 1NBVL 4MCYA 3QWQB 1ZT4B 5JHDD 4YGVA 2GAZB 4NNXB 1I8MA 1ZA6A 4DAGL 1NCWL 4FQHB 1KCUL 5C0EB 2A83B 4Y89A 4IS6A 1A2YB 4QGTA 2NY4C 4OD1L 3V4UH 1UZ6E 1P1ZB 3DX6B 2BRRL 4LASL 4RAUB 3HI6L 1DEEB 3T1FB 3VWJA 5ID1A 3GSNB 1R3KA 1PX3A 2XKSA 2QSQA 5J6GA 3HC4H 2NX5E 4U1MA 5FGSA 4RISH 4N0YL 2H32H 3QZWB 3EZ8A 1Q8MA 5DMKA 4WV1B 3TBVB 2V2TA 3ECBB 5BW7A 3BGMB 4HEME 5JR1H 1ZANH 4IMLA 1KIRB 5F89B 4CDHA 1T5WA 3FO9A 1GGCL 1MAJA 4LVHC 3MNZA 1CLZL 5IEKA 4YGVB 1GYAA 1KPVA 4GS7C 1CT8A 1AO7B 3UCRA 4K94C 4Y5XC 5JTWA 4XB7A 1XF3B 4C56A 2JJTC 1VFUA 4R4BA 2R9HD 2K9UA 3GMRB 4U1LA 5E8PA 1FAKT 1OGTB 1OPGH 3RKDC 4FN0A 3VFPB 5DC0A 5IMMA 2DQIH 4X99A 4PP1D 1F4YH 3D39E 3T08A 1I8LA 4MZ2A 5ADPH 1NFDB 1AGDB 1C16B 2HN7A 3DVIA 3DRQA 4K94H 4ZO8A 5I1IL 2C4FT 5C0BA 3D3VE 1TCRA 5KANG 4AY0A 1EGJH 1A1OB 5FV2A 4NT6B 3AMKA 1E4WL 1RUQL 2R2BB 3IU4H 1AY1L 1OB1A 3LRSA 4MAUL 4HPYH 5JPMB 3DGGA 5ICZB 4MS8C 5JOPE 4ELMB 1S3KL 2V17L 4M3KB 4WU7B 5I30H 4X4YB 1F5WA 3GSNH 4YE4L 5I8EB 4GKNA 3PWLB 2ZKHH 2X7LB 3LKRA 2GJZA 2I26N 2OR8A 1G7QA 2CR6A 2W0KA 1CK0H 3DIFA 3WL9B 2QQNL 2WANA 1NAMH 3WFEL 4CADA 2KH2B 1IM3A 4HJGB 4EI6A 2DM4A 2ADIA 3S98A 2FYYA 2GEEA 3FQRA 4U1HB 1JNNL 4JFFE 1M71B 1DR9A 4KJQC 1MHEA 3LY6A 2BSED 1PVHA 4U3XA 5IW6A 5EU6E 3KPTA 4JRYB 5HGAA 2KUTA 1EXUA 5GGTA 3DMMC 5JXAH 2ZOKB 4H25B 5CIPA 3RA7H 1FVCA 3EDFA 1TIUA 3R06B 3O2VH 3CCHA 3P4LA 4G6AC 1HXMB 1LNUA 2PYEA 4L4TB 1A14H 2IJ0C 3S37X 4DN4L 4Q2ZB 4I1NB 3BKJL 5T1DL 3O4OC 5I1IH 4NCC2 5DVLA 3PL6D 3UTOA 5GGRB 2JCCA 1UH2A 5D7LA 1D5XB 4JO1L 2I24N 3QCVL 2B2XL 5C0DB 1IGJB 1VA9A 4HCRA 4EXKA 5CJ5A 3GUTA 3BD5A 3FO0H 4FQXA 3H9YA 4LKXA 5DK2A 3TNMB 3T3ME 1H8NA 3BN3B 1HQRA 1PBYA 1JZ5A 2UVFA 1S7TA 1NBYA 4X7FC 4AT6A 2NXZD 1KPUA 4HKZA 1Z5LA 5MENA 5CJQL 2BHYA 5IV2B 2CRZA 3VFGL 3MLYH 1FZOB 1X5YA 3O2DH 3MNVA 4H1LB 4YX2L 3RUGB 4GW4A 4ZO7A 5IW6B 1BLNB 1LD9B 2MPAH 1AGFB 4RGNB 5I30L 3BKCL 1KF9B 3B6SB 2RJMA 5IQ9B 4KI5F 5JW3L 4R7DB 4DJMA 1WBXB 3MOQA 5JR1L 3MV01 2YEZA 2DF3A 1DDHB 3D39D 2VXSH 3K80A 4XT1C 4DCQB 3NZHH 1J5OL 3I50H 2DTMH 4MXWL 5KANI 4JR9H 1AGCA 5I8EA 5ISZA 7FABL 4WI6A 4TULL 2HVJA 4YGAB 1JPSH 3NGBB 3UPRA 2HG5A 4QHNA 3U82B 5DTFB 1T2XA 2D7MA 3ETBF 1DN0B 3OHXA 1ZLSH 4JPIA 1PY4A 4Y2DC 5HY9B 1D9KC 4P9MH 3JWOL 4TTGA 1C12B 4G8GB 5ADPL 3EO1A 2NX5D 2HLAB 1GGTA 1FFPB 4MJ6A 1QR4A 5CEZD 4OCYL 2QKIB 3LPGA 5HGAB 3BP4A 5E2VL 5FGBA 5LGHL 5BV7L 2I60H 5GHWH 3VGDA 4Y1AB 1NGWA 1K8IA 1QSFA 4MSWB 5ABDE 2X4QB 4KZEL 1HHJB 4PB0H 4WFED 3SKUD 3V52L 3KVQA 2V6HA 3ULUF 4XXCA 2VLRA 1UXWA 3WLWD 3SJVA 4OZHA 1IEAA 1BX2A 3KYNA 4LDEB 3U4BL 4Y16D 1W0VB 3TCLB 4F57L 3G5YB 1NAKH 4Y5YC 3LB6D 4BQ6A 5IQ7H 1HKFA 4CMMA 1J9CT 3HG1D 3HN3A 3BXNA 1MHCB 1K85A 1T66D 4PD4J 4JCLA 1TZIA 2J7LA 2XTJB 5FYKL 43CAA 4ELMA 5DT1H 3HNVL 3KJ4B 4POUB 3BYYA 4XCNB 4JFEB 1T1WA 3LDBC 3D3VD 1RK1A 4A6YH 4ERSH 4H8WH 3DI3B 3LSOA 1A1OA 2DYPA 3L3OA 5IBTH 2AKRB 1ACYH 4XCYB 2R4SL 5EZLB 3RVWC 1JTOA 4C56E 5GGQH 3RTQB 2R2EA 3ZDXF 3DX6A 1BQHB 1TJHL 1MVUB 3VXNB 3KWWB 1XAUA 4ODUA 5GS0D 3RJDA 1J87A 4KMQA 2X09A 4MA1C 3B2UD 2GAZA 3NCBB 4OCYH 3X11A 1ZHBB 5I18H 1I8MB 1PLGH 4PJCF 3GI9H 2AV1B 2GIYA 5SWSB 1OAKH 1WVZA 5J4MA 1NGZB 5CLTA 3MJ9A 3FT3A 4HK0B 4HIHA 3RWGA 1I7RA 3GFUA 3LZFL 5GRJL 1OQOA 2VLME 3N1GC 4R96B 3FMGL 1QTYT 2CK0H 3CH1B 4XRCA 3V6ZB 4V1DE 1FZKB 3CX2A 3QFDA 4PRPB 4ETQA 5KN5B 2D31B 3MCG1 1N7ML 4LCWA 1PSKH 4YR6B 1TETL 2JB6B 2PXYD 5EOCH 3RTQD 1A9EA 4PTTB 5EC1A 4KMTL 2X10A 1W8OA 1BECA 3BYTA 3QUXC 1ZA3A 2H2PD 5IMKB 1PQZA 4OZHE 3THMH 1QG3A 1CR9H 5EOCL 1IGIL 2EDFA 3LAFA 4RBPK 2W0LA 4JO3L 1LK3L 5IK3B 2Z4QB 5GISL 3QQ3B 1KENL 1SEQL 4EJ1C 1JV5B 3FT2B 4X80L 4FQQB 1WC7B 3IXAA 1T22B 3G6JF 3QB7C 1EEZA 2IBZX 2AXFB 3EKCA 3JBG7 4GXUN 3QDHA 3IF1A 5CJBA 2NQCA 3MLVL 1F4XL 5HGGS 4UTBL 3F5WA 4QKXB 3OKDB 4KI5E 3GI9L 4XNZC 1FH5H 2BOBB 5D4QA 5E00B 5ECJE 4F7CB 4YFLF 1CDYA 4KHTH 3VFTB 5B39A 4NSKA 1DQDH 2VAAA 5L2KA