3G04A

Crystal structure of the tsh receptor in complex with a thyroid-stimulating autoantibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
212
Chain Sequence
LTVLTQPPSVSGAPRQRVTISCSGNSSNIGNNAVNWYQQLPGKAPKLLIYYDDQLPSGVSDRFSGSRSGTSASLAIRGLQSEDEADYYCTSWDDSLDSQLFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN THYROID STIMULATING AUTOANTIBODY M22 LIGHT CHAIN
publication title Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2009-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04A01
3QNYA 3T0DA 1CZ8L 5EZOL 2AJUH 5I1HH 4LCUB 1JF1A 3V5KB 1NQBA 4LCWE 2CLVB 5DFWH 4GJTB 1M7IA 3SCMD 5CUSL 3CSYB 1F6AA 2BSRA 5HPMA 5GISL 1I9EA 1RK0A 1TJHH 2NY3C 4LFHD 1MY7A 3BPLC 3OAZK 3WV0A 2EH7L 4JKLA 1NBZA 1HK6A 1IEAB 4EI5B 3VFOB 4AEIL 5L0QB 4JO1L 1QR1B 1MWAH 1A02N 1CR9L 5GPRA 1VFBB 1VB9A 4JG0H 1IC7H 1MEXH 5D7JA 4GAYA 1EHXA 3VXPB 4WEUD 2GJ6A 3MRFA 3D18B 1FNHA 4AQOA 4H26B 9CGTA 3EO1B 3BH8B 2ZJSH 1OT1A 4M6NL 2CR3A 4N1EA 5KSVB 1YMMD 1MPAL 4IEFB 1OF2A 3QQ4B 3ET9F 2HFGH 4HSQA 4N5UA 3OHXA 3QP3A 4N0UE 1P4LA 1RURH 4XHJD 3C09B 4NC1C 3LPWA 5SX4H 5JQHC 2AQ3A 4XNZC 2BOCB 4OV5B 4EXKA 5IFJB 3C6SA 5DGRA 4FXLA 1MQKH 3FQUB 1EHLL 5D9SA 3C8KB 1OW0A 1R5WB 5F44A 5TF1L 2FSEA 3BVNB 4IRSA 3LQZB 3FONA 4K7PX 4ODUA 5GXBB 4N1HB 3MFFB 1ZGLA 5BXFB 3BE1H 3BP5A 1BGXL 4MB3A 1HHHB 1X9QA 1I7TB 5JIHA 3WNKA 5D2NC 1EK3A 3S37X 2Z93B 2VLRE 1BREA 4P2RA 3AB0B 4BFIB 5I17A 4K94H 4RGNE 2BNRB 1DLFH 1N5AB 3NGBB 5I30H 1VDGA 4ZFGH 1F97A 1J0ZA 3DURB 3WS6A 1TITA 3KXFB 3P0GB 3C08H 5GIRA 1J12A 2DICA 3TH2T 4LHUD 1UM6L 2VC2L 2E8YA 1G7MA 2XA8L 1HSBA 2BVQB 3CD4A 1ULVA 4LCCA 2NY2C 5C0IB 3RX8A 4ZUWB 2P48B 5D72L 5CGMA 3P11H 2VZ3A 1D5ZB 4Z76B 4BZ2H 1ZT7A 1ADQA 1QSVA 4I18A 3MBXH 2WZPD 1H5BB 4RNRA 1T66D 2EKSB 3JVGA 4F15C 2HTKC 5DS8A 2ICES 2WK2A 1U8NA 4R8WL 1DQJB 2DLTA 4WGVB 5CIPH 5A40E 3QG6A 4FNLL 5KSUA 2VDQL 1NKRA 1S9VB 3STZA 5FGCE 1KB5L 4LVNC 1E6OL 1OWRM 5CP3A 3UEZA 4XNQA 4P2QB 2DIAA 4NQED 1NFDE 2YMXH 1BFOB 3VXSB 1U8HB 5GRVK 3GDBA 2ATKB 4JFEB 4APQC 5JA9A 2LAAA 2HAZA 1IC1A 1C5DB 3MQIA 4MNGE 4Y19D 3TCLB 5J9PA 3WFDL 4ZUTA 4NHCH 4JDZB 2BSTA 3QIWA 1JZ3A 5A3IC 2Z4QB 3GIVB 4XNMB 2XOTA 1MSPA 4PGDA 4NKDA 1GGYA 3DV4B 4K7FB 5E99L 3V6OE 1PSKL 1YEDA 1LEKB 3L5XL 3DUSB 4XHQA 5K93A 4JG1H 2V5MA 5JXAL 4DN3L 5FGBA 1CDIA 5ANMB 4EN3D 4ODTH 1BOGA 5GGVL 1H8SA 4WV1B 3BAEL 4NM4L 2B2XH 3S96A 5EORL 4ODBD 4XXCA 2F54A 3BIBX 1HIMH 4FP8L 4X4XA 4ZXBD 4N8PA 3BGFB 3WFCH 2KH2B 3QIBC 5DYOB 2G75A 3LSOB 3EW3B 3LEXA 5BRZD 1U93B 3VWJC 5SX5K 3LEYH 1CICD 4J4PA 3VD7A 4LK4A 4NO0A 5DMIH 4KQ3H 3KYKH 3GMRB 3LCYA 3RJDA 4M7JH 1P7HL 3JUYA 4HJ0D 4OZIA 2XQYG 5AG9A 4F8QA 4R4FH 4PB0L 3GO1H 5SX5H 2CDEB 1GAFL 4XB7A 3HC4H 3LS5H 2ICWI 1KXVC 3OXSA 1PYWB 4JVWA 5T3XE 4DKEL 2ZUWA 1MVFA 4PLOB 3VH8G 4ENED 1DBKH 4KMQA 2J6EL 4GUPB 1PKQB 2EYTB 2R69L 3FCTB 4JN1H 4OF6A 4YHYB 3FHAA 5JLZA 2X1QA 3MRMA 5EA0L 1AXSB 4OUUB 2NY5C 4HIIA 3WHXA 2JJWA 5LWYL 2PO6C 4FQLL 2ADJB 1YUHA 4F3FB 3MRIA 3C5ZD 3ZMRA 2YD8A 4TOYL 2JELH 4MDIA 2QHLA 3I6KA 5IVXE 4C54A 4PJBA 1HE7A 2AGJH 2PXYA 3KWWA 2R56H 4I0PD 4LRIA 2Y5TB 4Q0XH 1S7SA 2APBA 2X9XA 5BJTB 4J1UA 3QR2A 2H26B 1ZAGA 3G6JA 4OIBA 4UIMB 4JHAL 1XAUA 3SDAA 1CDUA 5C0RL 4R4BB 4FQIH 2AJYH 4LCUA 3WJJC 3V5KA 3LQAC 5CINH 4WUUB 2CLVA 1MHCB 4DW2H 1H3TA 3RKDD 3FO9B 5IHZB 4ZS6D 3HMWH 3NA9H 3I02A 5DZOA 1CYGA 4DTGH 3W0WB 1J1PH 4LAJH 5IM7B 5L2KD 1PGRB 2YRPA 4L3CB 1JZ5A 5F97E 2YUXA 3UTPD 1LP9A 5ID0A 3G08B 1IEAA 4EI5A 1DVFC 3VFOA 2LVEA 1V7MH 1VFAA 2XTJB 4Y2DC 1VFBA 2P7TB 4JJHA 1RUAH 3VXOB 3WFEL 1SMOA 2VUYA 5SWSE 4X4ME 3V6ZA 3VXPA 4GAGL 3D18A 5DHVH 3O4LB 1JGEA 4H26A 5TQ0L 2FJGB 2X40A 5D7IE 3U0WL 5KSVA 3G9VA 3Q6GL 4G43B 3O8XB 4MMZC 5I1IL 1WAAE 3P9MB 3QQ4A 3QDGB 4ONFH 1PLGH 1UKQA 3I50L 1C08B 5FO9A 5GS1B 1T03L 1H8OA 3OGOE 2BOCA 3HA0A 4OLUH 4AQ1B 4OV5A 5GGTA 2HJLB 5IFJA 4ZUUB 2W0KA 3HNVL 4OLVH 4LOUC 3FQUA 3C8KA 3HE6C 1R5WA 1JHKH 1IGCH 2VDMH 3BVNA 3LQZA 3W2DL 1NUGA 1Q0YH 1KEMH 5C9JB 3MFFA 35C8H 1JZ6A 4X6DE 4CNIB 5BXFA 3SKMB 4JHZA 3O81A 3Q0HA 2BDNH 2YUVA 3EFFB 1HHHA 3ROLB 1WFUA 1CD1A 4UV7H 4WWKC 5DRXB 1I7TA 4U1HA 1KPUB 5B8CB 2Z93A 1TJIH 2BNRA 1FVEB 1N5AA 1XR9B 3P4OB 1FPTH 3DURA 1EEQA 1BFVH 5C0BD 1BQUA 1UJ3C 5I18L 1MLBB 2VLJA 5IQ7H 2APWA 4LLYB 5D7SL 5H94B 2ARJB 4PLJC 3DO3A 1F00I 3UJTL 4K71C 5E8OA 4BKLA 3QCUL 2C4FU 3WUWG 4GO6B 4BQBA 3VH8B 1AFVL 2E7LA 2E5EA 1NL0L 4KKCC 4YDVB 5C0IA 4ZUWA 5ELIA 4E42B 4BA8A 5GGSB 4YHIB 3B4NA 3BPNC 4KVCL 1ZANL 5FIEA 4BQ9A 1YNTB 1D5ZA 4OI8A 2MKWA 4LL9A 4Z76A 1OY3B 4JFFE 4IOIB 4Y5XC 1OCWL 2QQKL 4I1NB 1M7XA 4JFDB 4ZS7H 2H45A 5T5FH 1H5BA 5EULV 5GS0D 5DC0A 1CWVA 2EKSA 1W72H 5DJXB 3FL7A 1TCRB 4HH9B 3X14A 2IQ9H 1RZKH 5D7JD 1ZEAH 1NLBH 1UQSB 1S9VA 5F21B 3EOBB 3U9PL 2A9NL 4UI2A 2VDRH 4JM2D 5HVHB 4HKBB 4O58H 4P2QA 4X6CF 3CZFB 4XAKE 1OAUL 3VXSA 1U8HA 2DM4A 4JFEA 3QSKB 4BSVB 1C5DA 4ETQB 2BVPB 3TCLA 1AJ7H 4J7RA 4JDZA 4N8VG 4XPGH 4YNYA 3FQNB 4MXWH 3BN9D 2Z4QA 3GIVA 4XNMA 1JGUL 3EHBD 2ZG1A 4IRSD 3MA9L 3U46B 5GGVY 2OCFD 3DV4A 1DBML 4K7FA 4RFNC 2OR7A 2VITB 1LEKA 2GSGB 2VO5A 2V17L 1FSKB 3HUJF 4WRLA 3QG7H 2C3WA 5ANMA 1T0NA 5A1AA 3UTQB 4L4TE 4R96B 3MACH 4PS4H 4KK8C 4LHJB 1GGCL 4B7IA 3MR9B 5J12C 4OFKA 4Y0GA 5IHBA 3LDBB 4P2RD 1T5XB 3RNKB 3GSNH 4TUOB 3BESR 3VJ6B 5DYOA 2VSDA 3FFDB 3WIHA 3LSOA 3PDDA 1JF6A 3KPSD 3MRJB 5I1GL 1U93A 3T2NH 3P73B 4PJXE 5DJ2A 4LEOB 4GAJH 1DZBA 4KTDL 5FXCH 1QVOB 4J6RH 3IF1B 5E8EB 1A3LH 1DN0A 1RZ8B 1YJDC 3S35H 1N0XL 2FBOJ 2ID5A 5DFVD 4OT1L 1WT5C 2AEPH 1PYWA 1IFHL 1O7VA 4Q58C 4OGZA 2GCYB 5KVGL 1HKLH 2O93L 3HI6H 2EDQA 1YQVL 4O02H 3V5HB 1S7TB 1A7RL 5IF0A 3NN8B 1PVHA 3V4VH 1PKQA 2EYTA 4NM8L 4RFOL 5FYKD 1MRFH 3FCTA 3IDJA 3HCVA 1HYSD 3FMGH 2OYPA 2FH6A 1VPOL 4JFYB 1AXSA 4OUUA 2VH5L 3QO0B 2QR0B 4QCIB 4WEBL 3VI4F 4UDUB 5EFIB 2ADJA 4IDJH 1MHEB 3PGFL 4F3FA 4Y4HD 3O3DB 1F2XK 4C55A 1WITA 4ZPTB 2CKBB 25C8L 1M7DB 2I9TB 4NRYB 1PDKA 3R06B 5BJTA 2O5YL 3WUWB 2H26A 4Z6AT 2VXSL 4MS8D 4LP5A 1U8IB 4MQXC 4HLZG 4UIMA 4OZFG 1FFOB 2JLLA 3CJJA 4R4BA 4PIRF 1JPTH 4PRIB 3QIWD 4UOW0 5I8CA 5CCKH 1GGIL 4PR5B 2B1HL 4WCYH 1NCCL 3FO9A 1JWMB 5IHZA 3LKQB 1R3IH 3O41B 3W0WA 5JOFB 2KDGA 5IM7A 1PD6A 4H88L 4L3CA 4Z7WB 1EO7A 1ZHLB 5LJYH 2BNQB 4YBQC 5TE6L 5IJVB 1BJMA 3MZTA 3G08A 4N1CA 1H0DB 4YHZH 5I16B 3UYRH 3X11A 3GSUB 5T1KB 4TSCL 3KVQA 3U7WL 1X5HA 2F54D 1I9IH 3BD4A 4WW2B 3CVIH 4PG9B 1IEBA 4PTUB 3VXOA 5AG8A 1ROWA 4H8WL 2IAMB 2QHRL 3O4LA 4J4PD 5KG9B 4NO0D 2FJGA 4K3EH 1D9KC 4M43H 3O8XA 1JUFB 3P9MA 4N8VB 4XVSL 4YC2B 5DRWB 5TGBB 2Q87A 5GS1A 2Z31C 1YDPB 1HHKB 3GI8L 2K7QA 3QNXB 4DZ8A 4KDTC 1GL4B 1DBBL 2HJLA 4KHTL 2X1OA 2GY7B 4ZUUA 3QIUC 3QA3B 1Q9KB 1Q72L 1Z0MA 5F7KC 1X5LA 1T2XA 2V2TB 1AD0B 3TZVD 4R9HA 4OQTH 5B39A 4P2YA 1RUQH 4NZDA 1RFDH 4O9HH 1XF4B 1BBDL 3V52H 3WFZA 3UPRB 4CNIA 3ZL4L 5ESAA 3SKMA 4NNPH 3U6RB 3EFFA 3QYCA 1RJYB 4HW6A 3ROLA 3DI2B 4YEFA 3SBWA 1MUJA 2H2PC 3MLZL 4GSDH 4EOWH 4CU6A 1KPUA 5B8CA 3QUXC 5JOPE 2RBLA 1E0OB 4CVXB 5JIKA 5I8EB 1C5BL 2EE6A 3MLYL 1FVEA 2PXYD 1D5XB 3K2UH 1NMCB 3O6FC 1VGEL 3P4OA 5FM4A 3SGEI 3GMMB 5DA0B 1MLBA 1MCPL 4LLYA 5C09B 5H94A 2ARJA 4M6MH 4Z77B 1A9BB 3SDAD 3TBTB 3VGAB 4X5XA 4KHXL 4HWUA 3SQBA 5F1SA 2VAJA 3V0WH 2ZUVA 3T4YA 5HI4C 3VH8A 1EUUA 1QRNE 4YDVA 2DTMH 3CGTA 5GGSA 2H2SC 4YHIA 4WY7L 4M7LL 5C6TL 2YEZB 4Y88A 3VD5A 4DWHA 1YNTA 4S11A 3NABH 1KJ2L 4LSPH 3VXUE 1CFTB 4YGAB 1KELL 4JFDA 4NNYB 4PYGA 3X3FL 1A0QL 3X13B 2M1KA 1XFPA 2UV3A 3LN5B 4EI5D 4Y5VC 4RBPK 5DJXA 1CGVA 3F58H 5MERA 4POZC 1TCRA 2QV2A 4HH9A 1T6WA 1UQSA 4LSRL 5CJQH 4F9PC 1ZHNB 1MCOL 3G6DL 4P5KB 4WI6A 5BW7A 4UTAH 3EOBA 1A6WH 5C0AA 2ZPKL 4IRJB 1HHGB 1RUKH 3B2UC 1ZXQA 4PJFB 4HKBA 4LQFH 4UIKL 1MQ8A 3CZFA 4WDIB 4GS7B 4OAWB 4P46A 3GMOA 2FX8H 5E8NA 4G6MH 3VGGA 4YXHH 4Y1AE 4BSVA 3GRWL 4ETQA 2BVPA 3ESUF 4S1SH 3TYGL 2DRUA 4Y16C 1QKZL 4P2OC 3WJLA 2XZZA 1Q9WB 3BQUC 3HS0A 4CMHB 4GW5B 4NYLB 3EJYC 3U46A 2O61B 4UINL 4X80H 2VITA 5JR1H 2GSGA 1NGWA 1C16B 5E56A 1XGYH 4X9BA 3F7YB 2YPKA 1KBGL 1T89A 3UTQA 1WBZB 8CGTA 4R96A 1T1YB 4JZJA 2YD6A 3QEQB 4CDGC 3MR9A 4BFBD 2ITCB 3RNKA 1BZ9A 2C1OB 4R4NC 2BNRD 4LSUH 3VJ6A 5CJOH 3FFDA 3MRJA 4YK4B 4K9EL 4U1MA 4KRLB 5KW9L 2VLJD 1NBVH 4G8GB 5IR1A 3MJGX 2FO4B 3B9KB 1QVOA 1N5YL 5E8EA 3PGDB 5I71B 2QADC 2XG4A 4NOBA 43CAB 1Z9LA 1FN4B 1RZ8A 4NC2B 1RZFH 3SOBH 1A7OH 4CADA 3UPAA 5DD1L 3G6AB 2V5TA 5DUBB 2GCYA 3IB4A 1SJVA 1S7TA 1YECL 2P44B 3UTOA 4NQDB 1F4YH 3WDJA 3U0TB 2L4OA 4U0QB 3V4UH 1MCSA 1DR9A 4JFYA 2H32H 3T2OA 4DGVH 2QR0A 1IT9L 4UDUA 3ZE2F 5EFIA 4KPHL 3DX9B 1MHEA 2AJVL 2XY2A 5FV2A 4XMLL 4QY8B 4OCRH 4FTVE 5C3TA 5CJXA 1FE8H 3VD3A 5D7IB 3ZE1E 3VRLE 2VERN 1QLEL 4ZPTA 3N06B 2CKBA 3RGVB 1JZ4A 1C12B 2HKHH 1FO0A 2I9TA 2OSLB 3OKDA 3OQ3B 4NRYA 5BO1L 4Q9RH 3VXSD 4QOKE 4JFED 1CU4L 3L1OL 5GRXG 1U8IA 3HE7C 2N1KA 1TTUA 1CE6B 1IAIH 5F1NA 4GMSH 4PRIA 4LDOB 1FYTE 4LSTH 1HILB 2VWEE 4HUWB 3DECA 4NQTA 2FX7L 5ALCL 3LKQA 2ENSA 2WWMD 3O41A 2DWDA 3K7UA 5JOFA 3VFUB 4D9RE 5IB2B 4MJ6B 2HG5B 4I3SL 1ZHLA 1KTKE 2BNQA 4PJ9B 1LO2H 3G5YB 2EIZB 2F5BL 1BBJB 5GGQL 1H0DA 5I16A 1R3HB 3GSUA 5T1KA 5FYJL 4OZIF 2VLRA 4WW2A 2XQBL 2ZCHL 2LU4A 4PG9A 3CMOL 4PTUA 5TDNB 3ZTNL 2PUQT 1KYOJ 2IAMA 3QPQC 4JR9L 3U7AA 4XB8A 3MPCA 1HSAB 2H8PB 2JJTC 4B7LA 2R39A 4LGPB 4ONGH 4F7MB 5BS0E 2K3TA 1JUFA 4N8VA 1NAML 3A67L 4H1LA 2E9IA 5E4EB 3RI5F 4ZO7A 5DRWA 5TGBA 1YDPA 4P23C 1INEL 1NGZB 3QNXA 5C3LD 1LK2B 4PJHE 2AJ3B 5FUCC 1I9RH 1RJZB 3QA3A 4FMKA 4JZNB 3MYZA 5HHQB 1FLRH 2R29L 4ZUSB 4PJBF 4PGCB 3BN3B 3KPOB 2E9JA 2F53B 1XF4A 2P5WE 3K1KC 4NZUH 2HRLA 3RUGB 3UPRA 1KYOK 2A77L 3LHPH 3U6RA 3UDWA 2JE8A 3VFMA 2VISB 2DD8L 4RSVA 3SQOH 2ED8A 3PWVA 1SM3H 1FORL 3C5SB 5I8EA 4RMTA 3ZE0F 3O4OB 3GMMA 3VE0B 4OZGE 4Z7OF 1MCDA 2VMFA 1I9JH 5IFHH 5C09A 3IDXL 3TT1L 2YUWA 1A9BA 4ZOCA 5FM5M 1LP9F 3TBTA 1KPRA 5BCAA 1CZ8H 3ARQA 5EZOH 4BYHA 2N7BA 4V1DE 3RP1A 3QRFM 3I6LE 3OKOB 1P69B 2NCMA 2YEZA 4KK6D 3W0WD 3B43A 4R2GC 5M95B 1Z6JT 4YZFE 4YHKL 2ICCA 2OJZL 5GISH 4X99B 1CFTA 3BPLB 1PZ5B 3X13A 3ARGC 4OCSL 5DRZB 4OLEA 4G8IB 3Q1SL 3LN5A 2EDOA 2XTJD 4RA3A 4ZQKB 3BWAB 4AEIH 4JO1H 4PGJA 1CR9H 4ELKB 4TSBL 1ZHNA 3T0EB 4P5KA 3DI3B 4DUXA 3CZJA 3O4LD 4IRJA 1HHGA 2F74B 2MQCA 4PJFA 3O8XD 1I7RA 1E28B 2B8OT 2OP4L 4OAWA 4M6NH 1KENL 3F5WA 4HC1L 1VADB 1FNSL 1MPAH 4M3JA 3THML 4A6YL 4RDQF 5A2IH 5DO2C 1NCDL 2CLZB 2UUDH 3FOLA 3TYFA 3T77B 1U8OB 2DI9A 4OIAA 3OKYA 4PJGE 3UYOD 4KJQD 5B3JE 2R2EB 5HDBE 4NYLA 4LRNL 5IBUG 2O61A 1X4YA 1EHLH 1WBXB 5TF1H 3TPKA 2NW2B 3F7YA 5E2WL 1WBZA 4LBEA 3QEQA 2D31B 1QQDB 1F58L 1BGXH 2ITCA 2AEWA 5D2NB 4YPGA 3HB3C 4X7DC 5C6PB 3BGMB 1A7NL 1SYSA 4P3WA 5D2LE 4U1IB 3ULVE 2FGWL 2NX5D 1J0IA 2AVGA 4YXLL 4XVUD 2P8PB 1S9YB 2K7PA 3B9KA 3QT2A 2DMKA 1A3RL 2X9WA 4TTDC 1JI2A 1IKNC 3PGDA 43CAA 1JWUB 1UM6H 2VC2H 5BV7B 2XA8H 3MBEB 1OSZB 3KPMB 5E0QA 4JFHE 3U4BL 3G6AA 5DUBA 2EDFA 1RJCA 1CT8A 3FJTA 4TPRL 5D72H 2VR4A 1XZ0B 4X5LA 1F4AA 1VEOA 2VLLA 4NQDA 4JFDD 3U0TA 4BK5A 3CIQA 1RIUL 1WICA 4K3DL 1YNKL 1QNZL 4HBQA 4N0YL 4PY7B 4TUJB 3DX9A 4KU1A 2R0ZL 4X4MA 2Z9TA 5JW4Q 4QY8A 1FGNL 5CBAB 2N4IA 4R8WH 5C0AD 5D7IA 1QSFB 4FNLH 2VDQH 2OZ4A 4KUZL 1C12A 1KB5H 3HG1B 5IVZB 2OSLA 1E6OH 4PGEB 4P46D 5E2JA 3H42H 4DGIH 4APQB 1CE6A 3GSQB 4WNQB 4HEME 4O4YL 4D0BB 2Z91B 3MRLA 3SCMC 3WFDH 1HILA 4HUWA 2D7MA 3QDJB 1G84A 3L3DB 4W70A 2DQUL 5K9OB 5CWSB 2X4SB 5HYEA 3VFUA 5IB2A 5E99H 4XZUB 3L5XH 4PJ9A 1SHMA 4DN3H 1A4KB 3NIFF 2WIMA 1R3HA 2DJSA 5GGVH 3QEGL 3BAEH 4NM4H 1BIIB 2A6IB 5EN2B 5EORH 1A5FL 4D94A 3OBAA 2BXYA 2YPLB 4FP8H 5TDNA 2X6MA 2E8ZA 3EOTL 3QIBB 3PWJB 2OTPA 2MHAB 2X41A 3CFCL 1IAOB 2H9GB 4YAQB 1UT9A 3JWDC 1S7UB 3DUHA 4XVTL 3S97C 2XY1A 4XHJC 1A6VL 1QFWL 3JWOC 4LCWD 1II4E 2MWCA 1JPGB 1LK2A 3D3VE 5IBUB 3ARTA 4F7EB 2AJ3A 1RJZA 1FZKB 1GAFH 3EJZD 3B5HA 1U8LB 4JZNA 4JFFA 2XNAA 4EUPH 3VXUB 1MVUA 4PRNB 4ZUSA 4DKEH 4YDLB 2J6EH 4JQVC 3RUGA 4TYUA 1DP0A 1GC1C 4K8RD 3GHBL 5EA0H 4LDEB 5JUEL 1YN7B 2VISA 4UT7L 1ZTXL 2D7QA 5LWYH 4PRBA 4FQLH 5IESL 1NCBH 4HMCA 5IB3B 4MDJB 3C5SA 3G5VB 1HNFA 2XKUA 4TOYH 1RAMA 1NGQL 4LLMB 4PRHB 4PJIB 3KYNA 3VE0A 4EQ2A 4LLUB 4PGBB 1DJSA 2VQUA 2DMCA 3BKYL 4JFPB 4JPIB 5BMFL 1ES0A 1XIWC 2I25N 1FVCB 2DWEB 2D4FA 4UT9L 4JHAH 5C0RH 5KS9E 1KULA 1UADC 3WDIA 3HAEB 3BPOC 3OKOA 5JPMB 2HWZL 4DUVA 4YHPB 3JSSA 3DJ9A 4KY1L 4XC3L 5TH2B 1PZ5A 2GT9B 1T66C 2Z0BA 4W81A 4JN2B 4NKQB 4G8IA 1I1CA 5FYJE 3VW3L 5T1KD 5C0CE 1JCKA 4WI9A 1DVFB 2VLRD 1CL7L 4ZQKA 4RGND 3BWAA 1RUPL 5F7YC 3EDEA 3BYYA 1J0KA 1U95B 3NCFB 1JFQL 4OF3A 3T0EA 1SEBB 5MI0B 3T4AB 3WFEH 1PG7X 3SE8L 1LD9B 2F74A 4ORGB 2L7JA 3U2SA 4MA8L 2FL5B 2Q8AL 1E28A 1CFVL 3Q6GH 2BMKB 5I1IH 5GQBA 5JW4M 3I50H 1EAJA 1UCTA 1T03H 2CLZA 3DXAB 2EC8A 2WWKO 4P4KD 3T77A 1U8OA 5DEFB 3ZSTA 2R2EA 3HNVH 5IIEB 1FNEB 3QEUB 4EN3C 3DIFB 3L5WB 3RA7L 2NW2A 3W2DH 3TV3L 2PW1B 4JZOB 3SDDD 1OAKL 4KKAD 3AY4C 4M5YL 3DTXB 1DEEA 4NO3A 5EU4A 2RQ8A 5DC9B 4M00A 4ZXBC 5AAMA 4WWKB 1NUNB 5D2NA 2Y07L 5F3BA 1T5WA 1IL1B 3BGMA 4QRRE 1KIQB 4NCC1 4U1IA 3TESA 3HLAA 4DJMA 1MOEA 4QOKB 4OKDA 2P8PA 1EV2E 1S9YA 4HJ0C 4BSWB 5I18H 1T20B 4PP2B 1E4KA 1BD2E 5D7SH 3AMLA 3UJTH 3V79C 4F2MB 5ADOL 2P24A 3MBEA 5KSBB 1VKXB 4PY8I 4UOJA 3VGEA 3KPMA 2JJSC 1ED3B 3GMLA 4CN6A 2V9RA 5I1JL 2DI7A 1AFVH 3JBG7 4ENEC 1NL0H 1A1NB 1W0WB 2IANE 5E00B 3WKML 1G1YA 5GSRA 4KVCH 1ZANH 2WLYA 4QXTB 3BT2L 2NTSP 3PP3K 4DVBB 1HH9B 2R1WB 2ZKHL 1HH6B 1OCWH 2QQKH 3DYMA 1TJGL 3ZT5A 5F1OB 4KZDL 5A2JH 1AGFB 1J7VR 1UXSB 3TBWB 2WAHA 2Y7QB 4PY7A 4N9GB 4TUJA 5EZIL 1XCTB 2I60L 3NAAL 5CBAA 3ISWA 1Z9MA 3ZYJA 5CEXB 4I0PC 1QSFA 1RJLB 4IRJD 1DUZB 4F57L 1NBYB 3HG1A 2P42B 5IVZA 3U9PH 2A9NH 4PGEA 1TVBB 3AM8C 5J6GB 2NY5L 12E8L 4KRMB 2NZIA 3DX8B 4Z7UE 5IW1B 1HWHB 1OAUH 1P7QA 4AEHL 5KN5B 5T3XD 3GSQA 4WNQA 1L7TL 3RKDC 4Q9CA 5LCVL 2Z91A 4D0BA 4ZS6C 3WCYA 5DZNA 3QUYB 4AL8L 3QDJA 3AAZB 3L3DA 3REVB 3SO3B 3L7EA 2DM7A 3LH2L 5K9OA 1KPVA 1UG9A 1JGUH 2X4SA 3QEHB 5CWSA 4RFNB 4XAWL 4EIGB 3BH9B 1EZVX 3MA9H 2FR4B 1DBMH 3V0AC 3BGAA 2WW8A 4LLQB 2XWBB 4ESKA 3LQAL 1G0YR 4X8JB 5J12B 1BIIA 2A6IA 4BSJA 1GGCH 4JRYB 4NJAL 4HK0B 5FYLL 4YDJB 5GS2D 2CK2A 3RWEB 4Y4FB 1LNUB 3BJ91 5DQ9B 2FBJL 5D1ZD 3PWJA 3NFPB 2MHAA 4IMKC 4U05A 5IK3B 1IAOA 2H9GA 4YDIL 3HNTL 5I6XB 3HR5B 5I1GH 2FRGP 1S7UA 3B9KD 4KTDH 1KTDB 5SV3A 4X6FB 4M8VA 4V1DB 3U30C 1JPGA 2DIBA 1ERNA 4HLJA 1KEGL 4F7EA 4HZAA 5C0EA 1N0XH 1FZKA 2IPTL 4KTEL 1U8LA 3WHE1 4OT1H 1NMAL 3VXUA 4PRNA 1IFHH 5D4QA 2NXYB 5KVGH 1MFDL 4NQDD 5INCA 4FQHB 4JFQA 1YQVH 5IOPB 1A7RH 5JDJA 4TUKL 4NM8H 3QRGL 5C07B 1VPOH 1YN7A 5MEPB 1JMXA 1CLYL 5DC4B 4WEBH 1P2CA 4HF5L 4X98B 3W5MA 5IB3A 3PGFH 4G6JL 3GBML 4MDJA 3VFSB 3G5VA 4PB9H 3KYAA 2EEBA 4WFGE 4WENB 2JJUA 4LLMA 4PRHA 5F72S 4PJIA 2YD3A 1ZLVK 5F7FA 2C4XA 4M8QA 25C8H 4JFPA 4JPIA 4CVUA 1MJUL 3MUHL 1FVCA 2DWEA 2O5YH 2VXSH 3HHRB 4HKXB 5E8DL 4OCWL 4JQIL 2B0SL 3CMGA 4WW2F 5ILTL 1SY6A 1GGIH 3B6SB 2YR3A 3BMVA 1NPUA 3HAEA 4PJDE 1IGML 5JPMA 2B1HH 5KAQG 4OI7A 1NCCH 4YHPA 2Z8SA 2FDBP 1YPZE 5TH2A 4PJ9D 5DK0B 4JN2A 3V6BR 4M1DH 4H88H 5DXWA 4JQXA 1UWXH 5JHLL 3T3ME 2X9YA 5TE6H 2ESVB 1DVFA 3FB6B 1UEMA 5D7JC 7FABL 4ZSOB 1GYAA 5ECJE 5D2LB 4TSCH 3U7WH 1AGDB 3FRPG 4HAFA 3AROA 1CFSB 1U95A 4HBCL 4PJ5E 1SEBA 1GGBL 1MELA 4R90L 3QUZA 1ZMYA 2AERT 4H8WH 2AABL 2APFA 2QHRH 4NO2A 2FL5A 4PRAB 3BHBB 3PWPE 2FJHB 1Y18B 3IRZA 2IPUG 2BMKA 4LAQL 2APXA 2FLRT 3ECBB 4KFZC 5DVMA 4E0RB 4XVSH 2Z31B 4YX2L 4W6WB 3BN9C 5F8QC 1OW0C 4ZG1A 2YOCA 3EHBC 3GI8H 5HHMB 4JFFD 3QIUB 1DBBH 4IRSC 2VJXA 4KHTH 5DEFA 5DQJA 4YHNB 5IIEA 4JY5L 1Q72H 1FNEA 3V9FA 3BZFB 2ICWJ 3QEUA 5CFHA 2DAVA 5DI8A 3DIFA 3O45A 4FS0A 5MENB 1BBDH 5HGBB 2I27N 4OD3L 4AMKL 1G7JB 2BCKB 2DJUA 2OX5A 3ZL4H 2FEEI 3DTXA 1DUYA 3NVQA 4WJ5A 3GMPB 3I75B 3EDDA 1IL1A 3WS6C 3MLZH 4HWNA 4LU5L 3L5IA 3MRKB 4KI5E 1KIQA 4XAKD 3ZZ1A 2ZSVA 1C5BH 3MLYH 4G8EB 4JVPA 3O6FB 4QOKA 4NO5A 1VGEH 4HIJB 3BZ4B 4BSWA 1T20A 2Q8BL 4K23L 5HVWA 4PP2A 1EFXA 1MCPH 4FXGA 2QSVA 4LCCC 4XT1C 5DFVC 5FM5O 4F2MA 4PLNC 5KSBA 1VKXA 4KHXH 1ED3A 5F7UA 5FO7B 3TO4B 3W81A 1A1NA 1W0WA 5E00A 1IJ9A 4TSAL 1A6UL 3W9DB 4M7LH 5C6TH 4I18C 4L4TD 5HSFA 1HYSC 2JIXB 5J57B 3JVGC 1HH9A 1A7PL 1KJ2H 2R1WA 4PJFF 4XCEB 3ZDZE 3L3KA 3FN3A 4NKIL 3ES6B 1KELH 3X3FH 4AIXA 4DFIA 1UZ6F 1YJDL 1A0QH 3BEVB 4JO4L 4JKKA 3ZTJG 4N0CD 2Y7QA 4N9GA 4U2ZA 2X4TB 5FCSH 4GMTL 1AGBB 2D7TL 4F37K 5ITFB 1XCTA 2NZ9D 2QEJA 2VQ1B 4LSRH 1U3JA 1DUZA 4L4JA 1MCOH 2C3GA 5LG1A 2ZPKH 3FN9A 4MS8C 4BK4A 3V7AE 2IMNA 5J6GA 3MX0A 1HXMB 4G9FB 5IW1A 3DX8A 4UIKH 4M7ZC 3QIWC 5EUOE 5D70L 1WBYA 3VDCA 1WZKA 2V7HA 5KN5A 3BXNB 4CKVX 1N59B 1P84J 4L4VB 3TYGH 2ZG2A 3FQTB 5ICXA 3CVHB 1QKZH 3QUYA 1LMKA 5IVXF 1D5IL 3AAZA 4G7VL 3REVA 1TQBC 5EZLB 5FGBC 4JFZL 3QEHA 3CAFA 4CN4A 1WFOA 3BH9A 4XCNB 4XGZB 4UINH 5LBSL 2FR4A 3ZHLA 1LO4L 4N8CL 2CIIB 4LLQA 4YGVB 4XXCC 2AEQL 1KBGH 2XWBA 5E1AA 5HXMA 3L7FB 5T5NG 1OAQL 5EU5B 4KV5F 4X8JA 3L3IB 1LEGB 1LO5B 2QQLL 4HK0A 4JB9L 5K9KB 4YDJA 3VFRA 4Y4FA 1LNUA 3RY6A 4OZGA 4J4PC 3NFPA 5IK3A 1UWEL 3NCCB 1R3LB 4OD1L 2WIIB 5F6HI 1G6RL 1CXKA 1P84K 3HR5A 3RVWD 4K9EH 4Z7VB 5KW9H 2D2OA 4RQQA 2AV7B 3J8F7 3BEWB 3S36X 1BWWA 2CDGB 4G80B 3QI9A 2QADB 1N5YH 3MBED 4GXUM 3CDGB 4V1DA 3RDTA 4HUKB 4OCLC 4RFEB 4JRXB 1U3HB 2P8MB 3I3DA 1Z0NA 1F3DJ 1EAPB 5DD1H 2XKNB 1LDSA 5D7IF 4UT6L 2EXWD 3MCKB 4FQHA 2ILLA 2AXJA 5IOPA 4MNHB 1YECH 4UQ3B 2AK4B 4EVNB 1QHPA 5C07A 4JCMA 3VXMB 4WI2A 3C9NA 5MEPA 4OZHE 1RMFL 1IT9H 2DYPD 4N0FB 2PXYC 4KPHH 4X98A 2AJVH 4XMLH 1QSFD 3GMNA 4LRIC 3L3JB 4YXKL 2IPUK 1QLEH 4C56E 2SEBB 3SDAC 3MA7B 5BO1H 4Q9QH 1P7QD 1CU4H 3HE7B 1WCBB 4Y4KA 4HKXA 1H3WM 3PDOB 3QDJD 3F7VB 4EDWL 4EDXB 3B6SA 4OZ4B 3MZGB 2XN9E 1JNLH 3K2MC 2FX7H 4MAUL 5ALCH 1WSST 2BSED 3S36L 3TVMB 3DVFA 4EI5C 5DK0A 5L0QC 5JZ7D 4I3SH 1MJ8L 5HPOA 5JOPD 2ESVA 2F5BH 3FB6A 4M3KB 4W68A 4HS6B 2DLGA 5CZKA 3ILQD 5GGQH 1ZVHA 4ZSOA 5FYLE 5D2LA 1JYVA 5FYJH 4IS6A 4L3EB 1AGDA 1BZQK 1GOHA 3DPBA 1CFSA 2FHBA 2ZCHH 3CMOH 3BFOA 4LPXA 1MCWW 3ZTNH 4JR9H 5KVDL 5I75C 2GFBB 4PRAA 3C09C 3QXDB 5CEZH 2W9DL 1YY9D 3RUGF 4O5LL 3UTZB 1QRND 1I1AD 4E0RA 3ECBA 1NAMH 3A67H 5IEHB 1Z3GH 2Z31A 1CD9B 4NKMB 4KJWD 3NPZB 4CL7A 1CTNA 2ICWA 1L0XA 1INEH 1BP3B 1PAMA 3DX6B 1XR8A 1SBBA 1B6DA 3N9GL 3VXUD 5HBBA 4YHNA 3I9GL 4MLSA 3FOMB 2DF3A 1FQ9C 2YA2A 2CGRL 2EDKA 3BZFA 4OZFH 2R29H 5CJ5A 3EOAA 1BIHA 1OB1B 1EGJA 3DROB 1HZHL 3G9AB 5HGBA 5EO9B 1EJ6A 3MRRA 1G7JA 2DQFB 2BCKA 5F7NC 4K94L 3AB0C 2A77H 3CVHL 3MJ8B 1OTSD 3NGBC 3I75A 2BFVL 4Q7DA 2DD8H 3JTSB 1WWBX 2R1YA 3P4LA 4LNVA 4PRHD 3ZT7A 3MRKA 3W5NA 3TO2B 1FORH 4G8EA 2X7LB 1X5YA 1S3KL 3BKJL 4Y1AD 1GH7A 1A21A 1SJXA 3GRWA 1ZGLP 2XZCL 3O2VL 5I15L 4PJEB 2ITDB 3MJ9A 3VA2C 4J3VA 4KXZI 3IDXH 2E7LC 3TT1H 4XCYB 2R2HB 3FN0L 4QHKI 2XIDA 3MGOB 2XT1B 5DJ8B 3IT8D 3TO4A 5E6ZA 2KL6A 3ZYZA 4ISVB 4PRPE 4R2GB 3W9DA 3ABZA 4FABL 1WISA 1H5BC 2JIXA 4R0LB 4YHKH 4XCEA 1T0MA 3F6LA 2OJZH 2DMBA 3ES6A 2OTUB 3BEVA 5CLWA 2MCPL 4OCSH 3Q1SH 4DEPC 3EYVB 4X5WB 5F9JA 4G6KL 5DQDL 3D5OF 5ITFA 1J0YA 3VXTB 2QSQA 2VQ1A 4GRLB 3QUZD 1ZS8A 2YMXL 3IDUA 4TSBH 2VXQL 1OL0A 4HAGA 15C8L 4LNRA 1AO7B 3ARDD 4C4KO 1HXMA 1EEYB 4G9FA 5DMGD 2OP4H 1U2HA 3D3VA 1LE9B 1KENH 4HC1H 4WFHE 1CLCA 1FNSH 4A6YH 3THMH 3RVTD 3BXNA 1E4WL 1N59A 1MCJA 1W8NA 4L4VA 3FQTA 4G6FD 2FIRT 3ORJA 2WWMC 1NCDH 3SGDI 2GTWB 4M7KH 4MQSB 4PP1C 5EZLA 2EDHA 4RMRA 1OAZL 4LRNH 3VG0L 3QWQB 3EFDL 1PQZB 1F90L 5FCUL 4YGVA 2COQA 2MNUA 5CBEB 3U9UA 2VABB 2CK0H 5E2WH 3BGFC 3L7FA 2IMMA 5EU5A 2F58L 4NJ9L 1F58H 1JRHL 3BW9B 5C6WH 1UC6A 2I24N 3ZT6A 4MA7L 1A7NH 4QOKD 1R3LA 2WIIA 1DQML 2FGWH 4HIHB 4Z7VA 1NCUA 5EIIB 4YXLH 2AV7A 3ULUD 4GBXB 1ORSB 1EFXD 3BEWA 5FOBA 3KNBB 3PGCA 3D85B 4OLYL 1FYTD 1KNOB 4G80A 4KMTL 4XMKL 1A3RH 4LHUG 4I2XE 5HI5D 3CDGA 4BQCA 4Q74A 4RFEA 1U3HA 2P8MA 3ZYOA 1A2YB 2J3SA 3C8HA 2BSSB 2BY3A 3IGAA 3QDMB 3BSZL 4HQQL 1EAPA 1YYLL 4KGLA 3U4BH 4D9RD 4Z78A 2UWEE 3NCMA 4YHYC 1AHWA 1DN2A 3O6LL 4TPRH 3MCKA 4OD2B 1V3JA 4MNHA 2HN7A 4UQ3A 5A2KH 2AK4A 4HHAB 1CD0A 4YFDB 3VWKA 2DKMA 1RIUH 3V6FB 4K3DH 3WD5L 1YNKH 1QNZH 3AS2A 3HZYB 1MJJA 4N0YH 1ZLWK 4PJ7E 2JCCE 4ZFOL 1MFNA 1AGCB 2R0ZH 4Z0BL 4X4YB 2Z8WC 1FGNH 5MP6L 3O3EB 1PBYA 4LMQI 3C60B 3KAAA 4HMDA 1MRDL 3WFBL 1A1MB 1DE4B 4KUZH 2EE3A 2SEBA 1OARL 4NWTL 1UACL 3SGEH 4OM0L 1ACYL 4Y7MA 3D39E 1T4KB 3HE7A 3HN3A 1KG0B 1WCBA 1FCCA 2X1WL 4K55A 3RIAF 3QUYD 3PDOA 3F7VA 4KK6C 4O4YH 5F1KC 3VGDA 4EDXA 2G2RB 3NPSB 4OZ4A 4XP6L 3OAYH 1INQB 4O2CB 3MLXL 2QL1A 5L8LB 3UYPA 4BUHA 2QKIB 1AC0A 4WTXA 2X42A 3TVMA 1GCFA 3MGTB 1J05B 5H37H 2XTJC 3O6KL 1ND0B 5IHUL 2HRPL 2EDTA 2R15A 2DQIL 3LB6D 1Y6KR 3TIEB 4P9HC 3OR7B 2C26A 4L3EA 3OPZL 3QEGH 4Y4FD 2YRLA 3L3HA 2P1YA 1A5FH 1FAKT 1JNNL 1FFQA 3O8XC 3EOTH 5IMLB 1YMMB 1QFOA 4WFFD 3CFCH 4JM4L 3WNMA 2DQJL 4NPYA 5GS1C 3QXDA 1S7XB 4O00A 4XVTH 3QI9D 2BJML 5B38G 1WV7T 3UTZA 5E2UL 1A6VH 2Y06L 1QFWH 4OLVL 4V1DD 5IEHA 4TVPE 3RDTD 3I6LD 2HVJB 1UH2A 4KJQC 2IANA 5E1HB 4CW1A 1D6EA 3DX6A 1EERB 1KEML 5DEZA 2FEDD 2NXYD 4GG6B 2X5PA 3KLHD 4PJIF 4LSSL 4NRXB 2GAZB 2YKLL 2OTWB 3SBWC 1OB1A 3DROA 3PWLB 5DFTA 6FABL 5EO9A 3FQWB 5B8CC 1WWAX 4NUGL 3H8NA 3PF2A 4L8DB 4UU9B 5JUEH 1DFBL 5FDWB 4UT7H 2K9UA 1ZTXH 3JTSA 3JV5A 1RY7B 3CU1A 3OR6B 4QRTB 5IESH 4NNXB 4XVUC 3IJSB 2X89A 1OGTB 2E7CA 3TO2A 1IAII 2P5EE 3CX5J 2X7LA 2WINB 1NGQH 3L3GB 2B1AL 1A6PA 4LHUB 3PP4L 3HMXL 3A0OA 2W0PA 4PJEA 2ITDA 3BKYH 4ZOEA 5BMFH 1INDL 4Y4KD 2KZWA 3NIDE 4XCYA 5CKAA 2VDOL 5DJ8A 4UT9H 1DEDA 1F3JB 3CDFA 4KDWA 1MI5E 6CGTA 2Z92A 3IETB 5EOCJ 2DOCA 4ODVL 1PY9A 4BQ8A 4ISVA 1QBMH 2HWZH 2W07A 4R0LA 5DEGB 1W72L 3IFNL 4XP9L 1YZZA 4KY1H 4XC3H 2IFGA 1ZOXA 3TP4A 3MNVB 3S35X 2ESVD 2VZUA 3CX5K 1CVSC 2HP4A 1B0WA 3EYVA 4X5WA 2J8HA 4YQXL 3R0NA 5IB5B 3E6HA 1CL7H 3ULVD 2VDRL 2HJFB 3MTRA 1RUPH 3PJSB 3VXTA 3QUML 5HVHC 4GRLA 4S1DC 1XT5A 1JFQH 2Z8VC 4P46C 4LQ1A 5C08B 2HT4D 3SE8H 1AO7A 4M1CD 4K3GA 4MA8H 4XCFL 1EEYA 4Y19B 2EO1A 2Q8AH 1U8QB 1CFVH 3WJLC 1LE9A 4JFHD 3ZKXB 5MHSD 5ITBL 2F8VA 2PKDA 4X9IA 1XH3B 1B88A 4RGMB 3U1SL 4E5XA 4X6CB 2OL3B 1FSKC 1YEEL 1X5XA 5C9KA 1T89C 2HFEB 2PYEE 3CFJB 4JGMA 2NY1D 4EN3B 3CSPA 2P4AB 1PQZA 4JZJC 3I85A 3HZVA 2GW5A 2QSTA 3PNWB 5CBEA 3RA7H 2MQ3A 3DMMB 3GSNL 3ULUF 3TV3H 2VABA 3LDBC 1J0HA 2N56A 1OAKH 4R7NB 4ZXBB 4M5YH 4HWBA 1IVLA 3UTTE 5KSBF 3WXVL 3BW9A 1KIRB 4GAJL 2Y07H 1CLZL 4FFWD 1I3UA 4JO3L 3VXRE 1CICB 2RHEA 1B4JL 4QF1B 5B38B 1OAXL 4Z9KB 4HIHA 5K59E 3TN0B 3S35L 3H6JA 4GBXA 1ORSA 3KNBA 3MRQA 4YE4L 3D85A 3IDIB 5ETUB 3KPPB 4DZBB 4WU5B 1IGTB 3TA3B 5FGSA 3EJZC 1U91A 4PJDA 5ADOH 2XN9B 1A2YA 1KCUL 4Z7QE 1N26A 2BSSA 2EDLA 5EBLB 3QDMA 1DTUA 3OXRB 5I1JH 3BX7C 1FLTX 3JWDL 4X7CC 1AP2B 1VESA 2JIXD 3WKMH 1A7QL 1KGCE 1UVQB 3WNOA 5IMOB 5CP7B 1TIUA 3JWOL 4K8RC 4HHAA 1FNLA 3BT2H 2ZKHH 5SWZE 1RI8A 4DOHB 3V6FA 1TJGH 3W11D 3HZYA 5A2FA 3C5ZB 4PJ5A 5CJXC 4KZDH 4OLWL 1JYXA 2VDPL 3K4DA 2C3VB 3DV6B 1AGCA 2E7HA 1J18A 1GOGA 1RIHL 4GRMB 4X4YA 5EZIH 3MOQA 3NAAH 5AYUL 4I0PB 3O3EA 4I0KA 3PWPA 3VGHA 3C60A 1D5BB 4F57H 5H8DA 1A1MA 1SBSL 5JOEA 1DE4A 1GC1L 4R6UA 1IGJA 4G9FD 3LRSB 4JY6B 3D3VD 1S7WB 4X0KA 2NY5H 5M94B 12E8H 3CCHB 4MAYB 3STLB 1QRKA 1KG0A 4P5TB 4L4VD 4AEHH 2ZSWB 5DWUL 1LEIB 3MXWH 1L7TH 5LCVH 2G2RA 4O2CA 1INQA 3RWJA 4AL8H 2A2QT 4OZGF 3VFGL 3WO3B 3MUY1 3LH2H 3MGTA 1J05A 4XAWH 4OFYA 3PL6D 4WU7B 3UTSE 5IWLA 1ND0A 1OAYL 2GEEA 4RGNC 4WW2C 2AV1B 1MHPL 2EYRB 2AQ2A 4H0IA 2NY7H 3LQAH 3OR7A 5EC2B 1RK1A 1ZLUK 4NJAH 2YD1A 5FYLH 4Y8AA 3TH4T 5CSBA 1N0LA 3K8LA 2FBJH 5IMKB 4PJAE 5IMLA 2FO1A 4YC2C 4MLIA 4YDIH 1S7XA 3HNTH 4ZNCD 3H3BC 1U8JB 3KPRE 5KOVC 4U6YB 3GJFB 2HVJA 1FZMB 3S3SA 4XRCB 2DS4A 4N0RA 4OQTL 1KEGH 1RUQL 1S7RB 2IPTH 4PG2A 3B3IB 4KTEH 1JPFB 3KDMB 5IV2B 4GG6A 1NMAH 4HCRL 3T65B 4LVOC 4ZO6A 5AUMB 4B41A 2IBGA 5FYJD 5C0CD 4NQVB 2GAZA 3UDWC 1MFDH 4KKAC 1IAIM 4GSDL 1K8DA 3VWKD 1DDHB 3PWLA 4TUKH 3OB0K 3FQWA 3QRGH 2UY6A 4O2FB 4L8DA 3S4SG 4OBSA 1A14L 4MHHG 5DHYA 5FDWA 2EDDA 1I1FB 1CLYH 5B3JF 3ARFD 1UKSA 3O2DA 5KJRL 5HDBF 3OR6A 4POYA 5GRZA 3TJHD 3KPQB 4HF5H 2Q3AA 1FDLL 4QRTA 3SE3A 4NNXA 1BOYA 3IJSA 4G6JH 4YFLI 2LV4A 3HKFA 2ADGB 5HTSA 2WINA 3H0TB 3FT2A 5EUOA 1U41A 4CMMA 1DQLL 3VGAC 1QBLL 2NLJB 5IT2L 4JAMB 1JF1B 4V2BA 1MJUH 5E9DE 3GJFK 5L7XL 1U0QA 3K1DA 4OF8A 3ZSSA 5E8DH 5D2LF 5ISZE 4OCWH 1RK0B 4JQIH 2B0SH 4M9OA 5IB4B 3ULVF 3IETA 5ILTH 5EU6E 1IGMH 1MCBA 3GSOB 3TVMD 3BRFA 1I8LA 5DEGA 3WNNA 2WNGA 4AH2A 2WANA 5LXGL 4LKXA 1QSEE 3GIZL 2YC1A 3MNVA 5CJQL 4BUGA 5D7JB 4QRRD 3SKOA 4L3ED 5IB5A 4L1HA 7FABH 3LKNB 3PJSA 4IRJC 4ZNEA 5JQ6L 3MRFB 5A16A 4HBCH 1TMCB 4JM2B 4M4RA 4GS7C 2ZCKL 2VZSA 4R90H 5FDYA 5C08A 2AABH 3OHXB 5DVKA 3ZDXE 2IALA 2PCPB 3LS4L 3ME0A 2R8SL 2EE2A 4M1GL 2JKXA 3C6SB 5E94B 4CMHC 4LAQH 1UKTA 2IAND 4ZUVA 5GGUB 2PW2B 3MC0A 3A6BL 4YX2H 3EYOA 1Q94B 4UDTB 4OTXL 1S5IL 4F37F 3IXTB 1P1ZA 4MWFA 3CFEB 3ESVF 2HFEA 1IKFL 4JY5H 2UVEA 3F12B 3C6LB 4Z5RB 5LAXB 4OZHA 1A9EB 3H7LA 3DMMA 4OCMC 1S9WB 4NN6C 2EZ0D 1MNUL 3WHE0 4P2RB 4OD3H 4R7NA 4AMKH 1I3GL 4JKMA 3ARSA 4YK4C 3HZMB 1KC5L 3KPSB 1KIRA 4NQSB 4GRWB 1P7KB 2X89D 3QBTB 1CICA 1URLA 2FHCA 5EO0B 4LU5H 4QF1A 2W59A 3B9KC 5B38A 3ZDYF 4S1RL 4HIXL 5I71C 1V8HA 3TN0A 1HSBB 2BY1A 3MV9E 1A7OL 4P3CL 3IDIA 3O6ML 3BMWA 4GKNB 4QLRA 4BH8A 2Q8BH 2A74B 3KPPA 4K23H 3ZKMD 3PHOB 1FH5L 3TA3A 1RHFA 4PYHA 2Y4SA 2HMID 2XN9A 2JJSA 2XYCA 3RFZC 2VLME 5EBLA 4DVRL 1LWRA 3MJ6A 3OXRA 2EIEA 5L2JB 5EBWB 1M6OB 2A6JA 4TSAH 1UVQA 5CP7A 3ZKND 2P43B 3S4SB 2YWZA 3GNMH 3QHFL 1A7PH 4M48L 4OCRL 1MLCA 2NTFB 3CH1B 4F8TA 3U0PA 2VXTL 4NKIH 1YJDH 4Y4HB 4JO4H 3C5ZA 3PQYE 5KAQF 4KGJA 2C3VA 3DV6A 4YIQB 5IMMB 4GRLD 4GMTH 4TN9A 4GRMA 1NJ9A 4XNQB 1L9NA 2D7TH 5J11B 4I0PA 5AWNL 1D5BA 3RL1B 1AO7D 3H3PL 1TLKA 2MTPA 5DD5L 4CJ1A 1JZ8A 3MV11 3LRSA 4MAYA 1G7QB 4PJ8B 3STLA 3JTTB 1TQCC 3MLSL 4P5TA 5D71L 4MVBD 5D70H 5L8KB 1LEIA 5F9AC 3OV6A 3M17A 4F7TB 4NKDB 3KJ6L 3OKEB 2XZAL 3UZQA 1D5IH 1TQBB 4G7VH 2F19L 5E5UB 4PJ9C 1W0VA 1A47A 1OP3K 4GLRI 3RNQB 3TM6A 3T2PA 4JFZH 4Z7VF 4WU7A 5LBSH 2IBBA 1LO4H 4N8CH 2F54B 2AV1A 2ZOLA 2EYRA 4MNQB 4RDQG 5I0DA 2AEQH 4OF5A 4WFGD 1OAQH 1T21B 2QQLH 4JB9H 5EBMA 2ZZUT 5CMAB 3VFPB 2I9LB 5IMKA 1OP5H 4DKFL 4I9WE 5E4EC 1UWEH 4OD1H 3QFDB 1G6RH 1DANT 1G9NC 3D85D 1P4BL 3OF6A 5T3ZD 3OGCB 3GJFA 1FZMA 5JMRA 2ED7A 4P57B 3U48A 1K9TA 3U4AA 2FX9L 4X9GA 4XRCA 5SWQA 4FN0A 1LO3L 4EEEA 3U79A 1T22B 3QDMD 3T0VA 2ERJB 1ZWIB 1S7RA 3TZVB 4ZFFB 3B3IA 5I9QC 3Q5TA 4PY8J 1JPFA 3NCJL 3KDMA 5IV2A 2E6JA 5AUMA 4LCYB 4UT6H 1FBIL 4NQVA 1MCLA 1DDHA 3O3AB 1SM3L 1BJ1H 2R2BB 1SEQL 3MRIB 4PJ5D 4HPYL 5EU3B 2YWYA 4MDIB 1RMFH 4KAQL 1IEHA 5KSAA 5EG6C 2XICA 3O4OC 3KWWB 4NP4L 3GMQA 1H8NA 3PWPD 4FXKA 3C60D 1B6UA 1UXWA 2ADGA 4YXKH 4GKOA 3H0TA 4OIIL 2D3VA 3SDAB 2NLJA 4JAMA 3N1QC 4W6YB 1UB5A 4R26L 3I02B 3MO1B 4RMVA 3PV7A 4XVJL 1IRAY 3VI3F 1BMGA 2EIDA 4HV8B 4JPKL 5IB4A 4EDWH 3GSOA 4ODHL 5IP4A 4MAUH 1U3YA 1LP9B 5ID0B 4OFYD 2BVYA 4OGXL 3S36H 1IGIL 2G5BA 1VFAB 4N0CC 3LKPB 1JPST 2VR9A 5HYJE 3UTTB 5DF0A 1W8OA 1T7ZA 4U3XA 4KK9C 1MJ8H 1YNLL 3T0EC 2NZ9C 5DJZB 2PR4L 4KI5D 1Z9OA 3C2AL 5F7EL 3GSVA 3V6ZB 3F62A 3VXRB 3LKNA 1ADQL 1JGEB 5FYKL 2V2XB 2LU3A 2VNCA 2CKNA 4ETYA 4JM2A 1FYHB 3CFKB 1S9XB 5EO1B 4M6OL 3SGJA 5TE4L 5I75B 5KVDH 5FO9B 4MCYB 5T5NF 2M2DA 2W9DH 2PCPA 1I1RA 3ARYA 5E94A 4O5LH 4HKZB 4KDVA 2PW2A 5E7BA 5GGUA 2Q7YB 5ACZB 2CRYA 1A6ZA 4YWGL 3GM0A 4NQEE 4Y89A 1BQSA 5FV1L 1AXTL 4HDIB 1Q94A 4M4PA 4UDTA 5DR5L 4BH7B 5KZCD 3CPLB 4MZ3A 3IXTA 1OOAA 3CFEA 3N9GH 3T0BA 1K6QL 5CIPB 3I9GH 1NLDL 5K9QI 2NYYD 2CGRH 1IGYB 2EYSB 5INDB 3TGXA 3F12A 1LDPL 3C6LA 2AI0L 5J3HC 1D3CA 1CD1B 5EH1A 4Z5RA 5LAXA 1A9EA 4PJEF 1CE1L 1S9WA 1WZMA 4U1HB 2JCCA 1EFQA 1HZHH 1MCWM 3WIIL 1IZJA 2VDKL 4MJ2A 2WQ8A 3H3KA 3CVHH 2XPGA 4U6VH 2W65A 3HZMA 3K80A 3KPSA 2VZVA 2BFVH 4NQSA 4POUB 1P7KA 1CIUA 3S3JA 2VLJB 1CF8L 3RVWC 5EO0A 1PEZA 1J8HE 4KROD 1MCHA 1RHHB 1E4KC 3P2TA 4UUJB 2W60B 4PJCB 4FMFA 2KKQA 2ZUYA 3PV6B 5E8OB 4BKLB 5BV7C 1S3KH 3BKJH 2GY5A 3MBEC 2XZCH 4G42B 4GKNA 3O2VH 5I15H 2A74A 4HXAL 5K9JL 3PHOA 3PHQB 4CN1A 2IH3A 2W0FA 3TJEL 3HUJE 5BRZE 4LPCA 1YEKL 3FN0H 4K3JL 1GZQB 3EO9L 2EXWC 5IROA 5L2JA 3BP4A 5EBWA 1M6OA 1B90A 5DD6B 3UTSB 4JANB 4FABH 3S4SA 3CFBB 2NTFA 4OF7A 3CH1A 1KJVB 2HLFD 3TH3T 3X14B 4DEPB 1FVDA 2GJJA 4Y4HA 2MCPH 3D0VB 4D8PA 1FFRA 1QPXA 2NY4B 1CBVL 4G6KH 4YIQA 5IMMA 4HJGA 5DQDH 4MXQD 2I07B 2QLVB 4F80A 2P46B 2V9QA 4G5ZL 1CFQA 3H42L 4DGIL 5C08D 1F4XL 2IEPA 3RL1A 4LMQE 3ARRA 3IU3B 5BVJB 2VXQH 15C8H 4FOMA 1LVEA 1G7QA 4PJ8A 3H7BB 3JTTA 4YNYB 3EJJX 4J2XA 3NOIA 4YR6B 5D93C 5KVEL 1E4WH 4F7TA 3OKEA 1GVIA 5GZNC 1VFOA 1SMAA 2YZ1A 3OSKA 2ENYA 1T0NB 1WTLA 3RNQA 3CC5B 4D9QE 3WN5A 2X4RA 1OAZH 5B39G 3VG0H 1YEJL 2B4CC 3EFDH 3DMMD 5FA3B 1F90H 1BF2A 5FCUH 3ILQC 1C5CL 5CEYB 3MV8E 4MNQA 5LQBL 3FFCE 4ZAKA 3MMEA 3CDYA 4XNYL 4U1JA 1MCCA 3O3UN 4NZJA 3D6GA 1QOKA 3DARA 1T21A 2F58H 4NJ9H 4PJDF 1TDQA 4P49A 1JRHH 3WL9B 1MIML 5CMAA 3UTPE 5DJ2B 3VFPA 2I9LA 2AJZB 2VLKE 3TN0D 4MA7H 1YY9C 1DQMH 1DN0B 1GSMA 2X09A 3QFDA 4P0DA 2W9LA 4KJWC 3TA3D 3OGCA 3N1MC 3NH7L 1J87A 4OLYH 1FG9C 4KMTH 4XMKH 1MI5A 4P57A 1P9MA 2XN9D 3KS0J 3QFJE 4MD0A 2EDWA 2NR6D 1MCFA 1T22A 5IF0B 1QFUL 1ZWIA 1MWAA 4YDLC 5TF0A 3TZVA 4ZFFA 4CGTA 1MCQA 3IDJB 3BSZH 4HQQH 1YYLH 3HCVB 2EEAA 1KSRA 4LCYA 3O6LH 5HHXL 3F6IA 3DSNA 3VG9B 5GGTL 1BAFL 1VACB 5FYLD 4HWZB 2F8OA 3O3AA 1NCBL 2R2BA 5B22A 5EU3A 2RR3A 3WD5H 1GZPA 4QGYA 5ALBL 1FRGH 2J8UB 2J5LB 3INUL 1XGTB 3ETBF 4Z0BH 5C0GB 3N1GC 4Y2DD 4AENB 4IHOB 5MP6H 4PLKD 2Q6WA 4MD5A 1MRDH 1OM3L 3WFBH 4MAYD 5I8CB 1OARH 4NWTH 3ARZA 3TIDB 1UACH 5CJBA 4P5TD 5J13B 4OM0H 3KLSA 1N6VA 1ACYH 5C0BE 1BVKB 3MO1A 3KS0H 3H9SE 4HV8A 4KI5F 4AJ0A 2FNBA 4XP6H 3RTQB 3MLXH 3L5JA 1FFPB 4JQXC 3RY5A 3X11B 4MQTB 3LKPA 1PFCA 5F1IA 1KLFA 3LAFA 3UTTA 3O6KH 1IEBB 5IHUH 2HRPH 5HYIA 5DJZA 1AY1L 5MI0C 2DQIH 3VXRA 4JDVB 3QUZC 2GHWB 1KIUA 2J2ZA 3OPZH 2V2XA 5F93C 3EZJB 1WJ3A 3CFKA 1S9XA 5EO1A 3GUTB 3FAWA 1JNNH 4GG6F 3BDYL 1MIEL 5DMGC 1MRCL 3UJIH 4JM4H 2DQJH 4MCYA 3RVTC 3OF6D 4DZ8B 2DTSA 5F6HJ 2GJ6E 2BJMH 2BNUB 4FQ2L 4CAGA 3OKNB 2Y06H 3PXHA 5E2UH 4YHML 4HKZA 2DLIA 3GSWB 2Q7YA 5ACZA 5KANG 4PRPD 3VCLA 4HDIA 4BH7A 1IC4L 4EBQL 5AEAA 5TFSL 3CPLA 1H3XA 5B39B 2GUOB 4QXUL 1NDMA 5CIPA 2G9HB 1JL8A 3FKUS 5F3HB 5ESAB 1IGYA 2EYSA 1F11A 5INDA 5GSVB 4LSSH 5EUOF 1MUJB 5IEKB 3DRTB 2YKLH 5FHBL 5D8JL 6FABH 3MRGB 4NUGH 3GSRB 5ICZB 5KSAD 5D5MB 1DFBH 1OGAE 5D7LE 2NX5B 3EYSL 1NMBH 5E5RB 5I1DB 3ULUC 1RHHA 4MX7B 4UUJA 1FIGL 2W60A 4MJ4A 4PJCA 3PV6A 1MAJA 4WFHD 2B1AH 4X5XB 4GKZB 3PP4H 2VWEC 3HMXH 5HI5C 1RPQA 4G42A 3F7QA 1BQHA 2Y25A 3T4YB 3PHQA 3WIHL 5HYFA 2WM0A 1INDH 1E4XL 1GZQA 2VDOH 1FFNB 1IM9B 2D7NA 4IRZL 3I84A 4ODVH 5DD6A 2IQAB 3UTSA 3MROB 4JANA 4L9LB 5C71A 4AEFA 2WBKA 3CFBA 4M5ZL 1LILA 3IFNH 4XP9H 3R0MA 5MERB 5D1XA 1KJVA 3D0VA 4AT6B 1GOFA 2FJFB 2NY6D 4WI8A 5C0AB 4YQXH 5FYKE 4PJAA 1JYNA 2I07A 3OJVC 4BM7A 2NQCA 3L5HA 3QUMH 5AAWA 3HNSL 3RL2B 3V5DB 2YN3A 4P46B 3GMOB 3IU3A 5E8NB 5BVJA 2HKFL 3RPIB 1WC7A 4XBGB 2NW3B 4N5ED 4H1LG 4OZHF 2C7UB 2DQTL 3H7BA 4XCFH 3QUYC 2JK5B 2AP2A 4L29A 3HS0B 3SO3C 1A64A 2YUZA 4YR6A 5ITBH 2X4QB 3UZEA 3U1SH 3ZE2E 1NGWB 2YPKB 1YEEH 5C92A 4D9LL 4S2SB 3CC5A 3C6LD 2NNAB 4JZJB 3AXLB 4ODSL 5FA3A 3LB6C 3O0RL 2Q7NA 5CEYA 4ZFOA 5IG7A 1BZ9B 4Y4FC 3RY6C 3HPLA 1YQ2A 4YO0A 5ICYA 5KVMC 2W92A 4U1MB 2X4NB 3WL9A 3WXVH 5I6XC 1KT2B 1I4FB 4HFWB 5IR1B 3BPCB 2AJZA 2X44D 1CLZH 3DO7A 2DM2A 4JO3H 1EIBA 1B4JH 3D39D 3QI9C 5IJKA 3LRGA 1OAXH 3UC0L 4LCWB 5E9DA 2YS4A 3AU1A 5FO8B 3RDTC 5JDSA 4P9HL 4CADB 4YE4H 3RVXD 1E6JL 1NCTA 1RZ7L 5IB1B 3TNNA 2FEDC 4DGYL 1T6VN 5EU6A 3ARVA 2NXYC 4WHYH 5B21A 4QHKJ 3KLHC 4XWGL 5AZ2L 1F13A 1KCUH 3VXQA 3JWDH 1A7QH 3QCTL 1YY8B 1VACA 4HWZA 5DHVA 3E1F1 3JWOH 1DQQA 4PB9L 3ZYIA 3SDXE 1ZA3B 5J1TC 1RZIB 2YPVL 3EIFA 4FFYL 4OLWH 4P3DB 2J8UA 2VDPH 4H0HB 1FO0B 4RIRA 1XGTA 3OKDB 5LGJB 4N0UB 1RIHH 3BO8B 3DOSA 5C0GA 3VXNA 1EO5A 4AENA 4IHOA 5AYUH 1G9EA 4OGAD 1BJ8A 3VGFA 3UZVB 4XPHL 1R0AL 4TVPD 1AQDB 1SBSH 3I2CL 4Y4KC 5F1NB 1GC1H 1NC4D 3P4NA 4FZEL 4PJ8D 4L5FL 4X7SL 3TIDA 43C9B 3R4DA 4P59L 2B5IC 1BVKA 4KXZH 1D9KD 1HDMB 5DWUH 3VU2A 2DWDB 1OQOA 3G6JE 3B9VA 2R0LL 1EA9C 4M1DL 3RTQA 4OF0A 4XBEL 4ZTOL 1FFPA 2PTUA 4CBPA 5DMKB 3VFGH 3MNWB 2GSIB 1XF5A 3IDNB 3L3OB 2IG2H 2XFXA 5D6DA 3QUKB 2VLRB 3ZE0E 4RGNB 4MNQD 4NQXB 4ZAKD 5C0ND 1OAYH 3ULVC 1SVCP 4B53A 4ZDHB 1MHPH 4JDVA 1ZSDA 1J1OL 2JJVA 3U7YL 3DWTA 4RX4A 5I1LA 1CFNB 1CXFA 2H3NB 3K74B 5HDQH 2HT4C 5DJAB 4M1CC 3JV4B 4H1LB 3GUTA 3DVIA 3HI1A 5IW6A 2BY0A 1FGVL 2DQHL 3K4AA 5FM8A 4LGSB 4QXGL 3IDGA 1MI5D 2BNUA 4P4KB 3OKNA 4U31A 4OJFL 3GSWA 5FYKU 5F9DC 3MREB 2Y36L 2BVEA 3GM8A 5E6YA 1W72A 1Z5LB 2GUOA 2NY1C 4HWEL 2AKRB 3RVVD 4M93B 5DVOA 3GZKA 4GKSB 2G9HA 1T7WA 3EZ8A 4LVOB 5F3HA 3SGDH 3SDDB 4HCRH 5GSVA 4Q2ZB 2FECL 3VFMB 1N64L 5F7DB 5IEKA 3DRTA 3N1FC 2APTA 3NIGE 5FGCB 1AQKL 3PWVB 2YHGA 3MRGA 3GSRA 3ROOA 2FATL 1ZLSL 5ICZA 4FFWC 1A14H 1NFDB 2RFXB 5D5MA 1S5HA 2OL3H 2NX5A 3LMJL 5EDXA 5KJRH 1FDLH 4MNGB 5C7XL 5I1DA 4MX7A 4I48B 3RWCB 4LVEA 1MHHB 2WWKT 1J8KA 5GRWA 4GKZA 1KPRB 5TDPA 2PNDA 1DQLH 4U33A 1BM3L 1QBLH 1JTTA 4UNTA 5IT2H 4M62L 4ZO8A 3KXFE 3TO4C 3B2UD 2EDEA 4Y8DC 5JW3L 3RVUC 5L7XH 1MFAL 1JTOA 1FFNA 1IM9A 3RIFF 3ILPA 3KPNB 2EH8L 2LFGA 1D7FA 4OGYL 1NAKL 1UM4L 4JM2F 3GSNA 4OB5L 1BZ7B 2IQAA 3MROA 4NHUB 4L9LA 4X6BA 4HZLB 3MV8B 1OPGL 1AR2A 3BQUD 4HUUB 3T08A 4IIQB 3W11C 3UTTD 5LXGH 5T1DL 2AJXL 3GIZH 5DJCA 2JTDA 1DL7L 3VXRD 4AT6A 2FJFA 1P53A 1F02I 1JE6A 5JQ6H 4J3OC 5EZJB 1QFWI 4FQ1L 4Q97A 1I7RB 3UO1L 3RL2A 3V5DA 4K8RL 1FL3B 3F5WB 1WFTA 1KN2H 1OLZA 4QNPE 2ZCKH 1ORQB 1VGKB 3RPIA 1JV5B 3VRJB 4XBGA 2NW3A 4XP1L 4ALAL 5D7KD 3QH3B 2C7UA 3FOLB 3TYFB 5HGDB 2JK5A 5JXEA 2JCCF 3LS4H 1A1OB 2R8SH 3FT4A 1CI5A 1OP9A 2CKBL 2DB8A 3I6GB 4M1GH 1FO0L 2H32B 4P2QE 4E41E 3QXAA 2X4QA 4JEGB 3VXSE 3A6BH 4JFEE 5GGRB 4GRWF 1T7VA 4OTXH 1S5IH 4S2SA 5I74B 4UQ2B 1JBJA 4LBEB 4JGUA 2NNAA 3AXLA 4TNVK 1IKFH 3B2VL 2BC4B 2AEIT 4L1DA 1WIOA 5IVXB 4NN6B 4YPGB 1VEMA 4KRPB 4NQCE 1SYSB 1T1WB 1MNUH 5D1ZB 1A4JB 2BERA 2KUTA 1I3GH 5ANME 4QHNB 1ITCA 2X4NA 4I8DA 4EI6A 1KC5H 1KT2A 4U1SB 5LKNA 1I4FA 4HFWA 1A3QA 3BPCA 1FNFA 3D9AL 4NUJA 2OI9B 5FUZL 4S1RH 4HIXH 4LCWA 4LLDB 3K8KA 5E6IB 5FO8A 4S0TD 1G7PA 4P3CH 1AC6A 1JK8B 4XBPB 1LGVA 1U3HC 3O6MH 3WIFA 3L95A 4L8CB 1FH5H 2GKIA 5IB1A 1CT8B 2WUCH 1AHWC 1JIBA 3OX8B 2VLLB 3CUPA 1IQDB 4U1GC 4DVRH 3UTSD 2CJUL 1CL7I 2HH0L 3VWKC 4P4RB 5DSCB 1YY8A 3QNZB 5SWSB 5C70A 5D1XD 3S34L 3QHFH 4FQPA 3LKSA 4M48H 3E6FB 5JNYB 5AYQA 4LSQL 2VXTH 1ZA3A 2NY4D 1PKQE 3TJHC 4W4OA 1RIVL 1RZIA 4P3DA 1X6LA 5LGJA 4N0UA 3BO8A 4Q9QL 2XRAL 3RWGB 2QQNL 5AWNH 2V7NB 4WI3A 3KJ4C 3H3PH 1AQDA 1L0QA 4AM0B 2EDJA 4IM8A 1W0YT 3FO1B 4I3RL 5DD5H 4KJPD 3MRLB 4OQTA 43C9A 3MUGB 1TQCB 1JNLL 1GGTA 3MCLL 3MLSH 5D71H 3VFTB 1HDMA 1VEPA 1CGTA 2V2WB 5A43C 4U7KA 4X6DB 3TVMC 3KJ6H 1AI1L 4BJLA 2XZAH 5GGSY 2F19H 5DMKA 3MNWA 2GSIA 3L3OA 3IDNA 4WUUE 3Q48A 1U58B 3QUKA 1FC2D 3CU7A 4NQXA 4K3HA 4AK1A 3W0WE 4MMXC 4R97C 4ZDHA 1CVRA 1IILE 5D7LB 1KCSL 3F7RA 2FD6L 5EIQA 1J8HA 4JPWL 4YDKL 1CFNA 2H3NA 5CEZL 1G9MC 3D2UB 5DJAA 1FJ1A 2VL4A 2XTJE 3JV4A 1Z3GL 4DKFH 1KFAL 2OM5A 3PWUB 5E9DD 5C2UB 4JPVL 4XNUL 4PPTA 3IJHB 2LTQB 5ISZD 1P4BH 5ESQB 1TETL 4WHTA 3O4LE 4P4KA 4JCLA 5J6HB 4JFFB 2XNAB 5DURD 4KWUA 2ZOKB 1AE6L 5EU6D 5JW4R 1MVUB 3MREA 2FX9H 3QDGE 4NRZB 4QEGA 3K8MA 1LO3H 1WCQA 1Z5LA 2AKRA 3DGCR 5I9QB 4GKSA 1QSED 3IDMB 3GFUA 1RU9L 2I5YL 2IPKB 2XI9A 3NCJH 3RQ3A 3M8OL 3SDDA 5T3XL 4Q2ZA 2EZ0C 1A7BA 1FBIH 4Y5YB 5F7DA 3MRDA 4RCAA 4PRBB 1V7NL 4ELME 4UILL 1SEQH 2FLBT 2YXMA 5JW4N 3QXTA 5BQ7A 5JW5B 4HPYH 2RFXA 1NFDA 2ARWA 3BKCL 4GQ9L 4XX1E 3KYNB 4KAQH 3EO0B 4NP4H 4MNGA 1ZV5A 2AS5M 1ES0B 3R1GL 4I48A 3RWCA 1MHHA 2VOTA 4KJYB 3FB7A 1CXEA 3GB7B 4M61B 3ZKMC 1VSCA 4JE4B 1M4KA 4OIIH 2XKSA 3TPUA 1QPPA 2HMIC 3V6OA 3REWB 2EECA 5CGTA 3CK0L 3KPNA 4K2UL 4R26H 4XVJH 4R0LC 4H20L 4L4TB 3RTQD 4JPKH 3OKKA 5K59F 5GS3A 3VMOA 1MH5B 5DO2D 4L8SB 1BZ7A 4NHUA 4HZLA 4ODHH 1QFWM 3MV8A 4HUUA 3WLWD 4IIQA 1VHPA 3TF7C 4OGXH 5IKCB 1IGIH 4JJ5A 1M1SA 4TQEL 2YD4A 1A6TB 1RQ5A 4GRLC 4OFIA 3RKPA 1JZ2A 4WUKL 5JPNA 2HTLD 1YNLH 4JFDE 4PJXB 3AREB 4RX4D 2PR4H 3C2AH 3R8BB 5F7EH 3ARBA 3U2SB 1ADQH 2WQRA 3IYLW 5EZJA 2UUDK 4CRPA 5FYKH 1FL3A 5GJSL 3K3QA 3SGKA 4M6OH 1ORQA 1VGKA 5TE4H 1JV5A 3VRJA 1KIPB 1TZGL 4MVBC 3JV6B 1MFBL 3QH3A 3RBSA 3QFJA 5HGDA 4J8RB 2VLMD 3KG5A 2OZ4L 2EKJA 1UH4A 1A1OA 3GBNL 4M7KL 3UBXI 3I6GA 2H32A 2K1MA 3P4MB 4JDTL 5CD3A 4JLRA 5CP3H 5GRJL 1ZT4B 4X9HA 1H3PL 4YWGH 5GGRA 2QSCL 5JHDE 1AXTH 3SN6N 5DR5H 1P6AB 2CK0L 4I0CC 4UQ2A 1K6QH 4DKDC 1NLDH 4AIOA 4PJCF 1DEEB 4NO3B 5EU4B 1LDPH 2BC4A 2AI0H 4QHUB 1KB5B 3GEWB 5IVXA 5F3BB 1T5WB 1CE1H 2QBWA 5E24E 1T1WA 1AGEA 5GJTL 5D1ZA 1A4JA 3WIIH 2VDKH 5MEOB 5IVNA 3HLAB 4QHNA 3E2HC 1N8ZA 1OHQA 4ZPVB 1N6UA 4U1SA 2MPAL 1KLGA 2X1PA 4GBXC 1YEHL 1CF8H 3B9EA 2DDQL 3MLVL 5CHNA 1XGQB 4LLDA 2RAMA 5E6IA 2P24B 3HC3L 4HH8A 3RZCB 5BZDB 1JK8A 4XBPA 3GMLB 3WSQL 3H9SA 4HXAH 4L8CA 2H6PA 5K9JH 3UCRA 3TJEH 1IM9D 3CFDB 1EHAA 2HT2C 3E3QE 5GSRB 1YEKH 4K3JH 5SV4A 4PJAF 3OX8A 3M1BB 3ZO0A 3EO9H 3HAEG 1IQDA 3T8XB 1O7SA 1G9NL 4P4RA 5DSCA 3QNZA 3S8WA 1XF1A 4WO4A 1H3GA 3Q5OA 5SWSA 5FFLA 5CD5D 3RI5K 5J1SC 4CVWA 3E6FA 4J3UA 5JNYA 2DYPB 3PUCA 3HZKB 4LLWA 1I8MB 2LE9A 3C60C 4I9WD 3VFNB 1BEYL 1WAAA 1CBVH 4G8FB 4P48A 3W39B 4TVSa 4G5ZH 3OAZH 3RWGA 2DJ4A 1JGLL 2V7NA 3TCXA 4EUPB 1F4XH 4MQ7B 4ZOBA 1P7QB 1NANI 4AM0A 3FO1A 2PN5A 3WNLA 3ARWA 5JXED 4LCIL 1R6VA 4OBRA 3ZHDA 3MUGA 5TPWL 3NPSC 4HULB 5H35A 4KUCD 4CDHA 2YD2A 3D69B 4QKXB 3L7EB 5D93B 3VFTA 5J1AB 1MY5A 1KPVB 2V2WA 4KZEL 5KVEH 4X6DA 3FTGA 2YSSB 4PRIE 5C0FA 3IRPX 5IWLC 3AGVA 5EWIL 2IGFL 2DQGL 4QTIH 2WUBL 1U58A 4WI7A 3TNMB 1OTUD 3MLRL 1YEJH 1EPFA 4KI5C 3IKKA 1NEZG 1C5CH 3SEPA 4HKJB 3MLTB 1OGAA 5D7LA 5LQBH 2A6KB 4Z7WE 3GK8L 4XNYH 2BNQE 1E4JA 1G0XA 2FHFA 2X4UB 1N2RB 2X10A 3D2UA 4ZFZA 2E7BA 1MIMH 4G9DB 1OLLA 2E9BA 3PWUA 3WKNA 3OJMB 1QRNB 1I1AB 1ZVYA 5CLTA 3WEXA 1L6XA 3IJHA 2NY0D 2J7LA 2XA3A 3G5ZB 1WTGT 4H5SB 5ESQA 5C0EB 1AR1D 2LQRA 3B5TA 4URTB 5J6HA 3NH7H 2ZOKA 4PG2C 3FRUB 2J4WH 1XIWD 4NRZA 5INCB 4JFQB 2NYYC 2J8UF 4S10A 1IC5L 1QFUH 4K07A 3IDMA 5HYJD 2E27L 3CSBA 2IPKA 3ZDXF 4F9LC 4HIEA 1X5GA 5HHXH 5GGRY 4Y5YA 5HHNB 3C2SA 3VDAA 5GGTH 1BAFH 2R23A 1NFKA 1P2CB 3BZDA 3IVKB 2R0KL 1CCZA 4LLAA 3MOAL 3SE3C 5JW5A 1R3JB 1GRWA 5ALBH 4KROC 3EO0A 4M8QB 4Y1AB 2P47B 3INUH 1D5MB 3MXVL 4KJYA 4K7PL 3GB7A 4M61A 1JNJA 5DK2A 1TZHB 2QQQA 1OM3H 4KH2A 4GFTB 4E41B 5EU7E 1PG7W 1U8PB 3REWA 3LY6A 1QBML 3QHTC 5C09E 1V3KA 3S37L 4LEXL 1I8LC 4KTYA 4NFBA 4L4TA 1JPSL 3SE9L 1YYML 4HT1L 5BOZG 1FV1A 5BV7L 1MH5A 3BP6B 4L8SA 5FUOL 3DHJA 4W4NA 3FQRB 4Z7NF 5K9QG 2HLFC 1ZA6B 3Q3GB 5IKCA 4NQCB 4QT5A 1MJ7L 4QRSB 3MRBB 4U7MA 2CPCA 1RV6X 4U7SA 4MXQC 2FYYB 1A6TA 2EC9T 4PJXA 3QUZB 3AREA 1J8HD 1AY1H 1LO0L 4HEPG 5CEZE 4QRPE 2ZUXA 4HGMA 4NO2B 4XX1G 3ARUA 1I85A 3QPXH 3ARDB 5TQ2L 3ZKXC 3IFOB 3BDYH 1MIEH 1MRCH 1KIPA 2A73B 2P8LA 5K33A 2R9HD 3JV6A 2VIRB 4HPOL 1QEWB 4PV9B 4RGMC 4J8RA 3IAGC 4G6FB 4P5MB 4PJFE 5DQJB 5DMJB 4OM1L 3G5XB 4LPYA 3P4MA 4NN5C 4KKBD 4FQ2H 1YEFL 1U3ZA 5IBTL 4YHMH 1RUML 1UZ6E 1X5JA 1EEUA 1ZT4A 1YA5A 5D5MF 4FQXA 5DI8B 1IC4H 4EBQH 1L7IL 5TFSH 3O45B 2OMBA 2RCSL 4QXUH 2NPLX 4RAHA 1X6NA 2GK2A 3DMMC 1JP5A 3BIKB 4U2YA 3WXWL 1NEZB 5KVFL 5CAYB 5FA4B 1DUYB 1QBAA 4WJ5B 4FTVB 3SDXA 4QHUA 1KB5A 4GLRH 2RIKA 1RZGB 2AW2A 1QD0A 2F5AL 5CSZB 5FHBH 1P6FA 5D8JH 4ZTPL 1CICC 5MEOA 2YK1L 1EJOL 2ZSVB 2CSPA 4ZPVA 4C4KT 4NO5B 5L88L 3TN0C 2W9EL 4FFZL 3CSGA 3QEQE 4BZ1L 1CFBA 4P9ML 3EYSH 1EFXB 2B4CL 4FXGB 5DJDA 3WBDA 1FYTB 1XGQA 3TA3C 1FIGH 5JMOC 5F9WB 4HFUL 3CLEL 3RZCA 2GYSA 4D0CA 5BZDA 2WSKA 5LGHL 3QO1B 2NR6C 3WIHH 4G8GE 5FOJA 2CUHA 3CFDA 3QWRA 1E4XH 1V5JA 1BHGA 4D9QD 3M1BA 2BHZA 4KV5E 2EDNA 3T8XA 3L3KB 1EDQA 4IRZH 5ENWB 3MV8D 3FFCD 3CSYA 4HK3J 3C5ZC 4MSWB 3BOVA 4M5ZH 4LSVL 2DYPA 5J8OA 2ORBL 4GXUN 2DM3A 3HZKA 2KZ1B 4NQDE 3WLBB 1I8MA 4Z18A 3ARBD 4KUCF 5BS0B 3DYOA 2VLKD 3VFNA 1QR1A 1F45A 4G8FA 4PLKC 2X70B 1HQRB 3W39A 3N85L 5DDHB 1KXQE 1MAKA 3HNSH 4EUPA 4MAYC 4MQ7A 2OXGA 1WBYB 4PJHB 3CX2A 1U92B 2V7HB 4P5TC 3MXWL 2HKFH 3EO1A 1QSZA 4LVHB 2Q3ZA 2VKWA 3BH8A 3QFJD 1WIPA 5ICXB 2J6EA 2X1XR 3A6CH 2DQTH 3EYQD 3D69A 1UM5L 5J1AA 2C5DC 5ID1B 2GK0B 2P5WB 5HY9B 1BLNB 3FAXA 5AZEL 3P9WB 4YBHA 2YSSA 1UB6B 5HDOA 3H9ZA 4PREB 1FAIL 2NY7L 1KJ3L 4D9LH 5I73B 5E1AB 3TNMA 4ELMB 5DHXB 3IS1X 3AVEA 3OAUL 4C58B 1SY6L 4ODSH 3O0RH 4MA1B 3VFRB 4KRPD 4HKJA 3MLTA 4BFEA 2A6KA 4OZGB 2IADB 1NC2D 1WUNT 2NXZD 1HNGA 2X4UA 4AG4L 1N2RA 3HFML 4RQQB 4G9DA 5J4MA 2XZQL 4BFIA 5CZXD 1OTTD 2CIKB 4GAFB 3QI9B 1QRNA 1I1AA 5E6ID 3KXFA 4Q9BA 3H2WA 3RDTB 3G5ZA 3UC0H 3FHQA 4GG8B 3H9SD 4H5SA 5I1EL 4P9HH 1E6JH 1CK0L 32C2B 3FRUA 2BVQA 2UZIL 1RZ7H 1CD8A 2MFNA 4DGYH 1M71B 3JZ7A 4XWGH 5AZ2H 2CXKA 3X17A 1CDGA 4WTZA 3C9NB 2DI8A 2IBZX 2BVTA 4WO4D 5SWSD 2RB8A 5HHNA 1Q0XL 3QCTH 3IVKA 5KSAC 2ZNWA 3IFLL 5CILL 4LF3B 3GMNB 2F53E 4A2MA 1C7TA 3RUGE 1R3JA 2Z35B 4K7PY 2YPVH 1K4DB 4FFYH 4EQ3A 1DQJA 1QLRB 2VE6B 3DX7B 1HCVA 4Y1AA 1D5MA 3UX9B 2GJ6D 4YBLB 3U4EB 4JFXB 4LIQL 1EVUA 1TZHA 2XQYK 4XPHH 4Y4KB 4PJGB 3C87A 3WDHA 1R0AH 3I2CH 4GXVL 4CJ0A 3KYMB 4FZEH 4OCYL 4X7SH 4L5FH 4E41A 1BFOA 1U8PA 4UAOC 1UWXK 2ATKA 2B5IB 2PTVA 2Y5EA 1BVZA 2ZUQB 4P59H 5JHDB 4NN7B 3OKLB 3ULUL 1HOCB 5I19L 2E3VA 2XG5A 4FHBD 5GS0C 1CGUA 2R0LH 3BP6A 4FG6D 4UV4H 1HN1A 4XBEH