3G04A

Crystal structure of the tsh receptor in complex with a thyroid-stimulating autoantibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
212
Chain Sequence
LTVLTQPPSVSGAPRQRVTISCSGNSSNIGNNAVNWYQQLPGKAPKLLIYYDDQLPSGVSDRFSGSRSGTSASLAIRGLQSEDEADYYCTSWDDSLDSQLFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN THYROID STIMULATING AUTOANTIBODY M22 LIGHT CHAIN
publication title Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2009-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04A01
1GOFA 1MCHA 3QUXC 3KLHD 2YD7A 5FA3A 1XF4B 4LSPH 3RVVD 1UJ3B 3MTRA 3GM0A 5L9DL 4LSUL 1F3RB 2E8YA 2EEBA 2VZ3A 4LLVB 1FVDA 2JE8A 3KG5A 4FFYH 3QIBA 3QCUL 3MLWL 1F4XH 3ZSTA 2PXYC 3VXSD 4ZPTA 5I8EA 2AKRB 1OD9A 4Y0GA 4YIQA 2FD6L 1KCVH 1S5IL 4WI2A 5EIQA 1AJ7L 3ELAT 5L0QC 2E6QA 5F3HA 1G7LB 4LHUA 3L5WB 2YSSB 3MRNB 1FH5H 5IGXL 4KK6D 4IMLB 4P2RE 4EI5B 5A3IC 1NCAH 2OMBA 4MJ2A 5E8OB 5LCVH 5DD3H 3LH2H 4Y2DD 2R2CA 2R9HD 4PRHA 2OK0H 2EC9U 1AHWB 4KZDH 1ZLVH 12E8L 4IOFD 4UOW0 4YBLB 3OF6D 5B8CA 3WNMA 3VFRA 2CUIA 2JJWA 3C8DA 3SDAD 3DV6B 1QR1A 5F7UA 5EUOA 3T1FB 1CE6B 1FNGA 5HPMA 4UMGA 3T0EB 1GC1H 1U42A 1G7QA 4G8GB 1OAYH 1JHLL 1W2KT 3S37L 4E42B 4WWKC 3KPRA 3I6LD 4NC0B 1CXFA 1GGBL 1IGMH 3PHQB 4ACPA 3CLFH 4JPKH 5EU6B 1CK0H 2A9ML 3EO9L 1OTUD 1JN6A 4HG4J 1QFOA 3EUUA 5KW9L 4L3EE 3FT3B 3R06A 4QXGL 5DJXA 3HC4L 2NY2B 4HJ0C 1I8KB 4NNYB 1YNTA 4MMXC 3Q1SH 4NQTA 3O6FC 3L7EA 3ZL4H 1RAMA 1H0DB 4I1NB 2Q7YB 3PGFH 4NNXB 3G6AB 1PKOA 4JFZL 1P5VA 5DT1L 3DNKA 3VXUD 1A5FL 3KYKL 3BFOA 3SDCA 3ARFA 2X4QB 1DUYA 4ZOBA 1A9EA 4LQ1A 4PJ5A 2YC1A 5EPMA 1TZIA 5J9PA 5T5NG 5L88H 1IAOB 5A1AA 1NFKA 1YMHB 1ZHLA 1IGJB 1NBZB 1A2YA 2W0LA 5D1ZD 4DUWA 5HGBB 4L8BA 2HG5A 3BEWB 4MD4B 5DLMH 2R1WA 4RBPH 4E41B 2ADFL 5SV4A 4N8PA 5SX4I 1M05B 3HAEA 2YR3A 4Z7UA 1ZANH 3GHEL 5FUCE 2EDHA 3BZEA 1FFRA 2B4CH 5JXEC 1C12B 1K4CA 1T0NB 1IM3B 3GDBA 4D0BA 4HHAA 3G5ZB 2VQUA 4CBPA 2BCKB 4XCCH 2HJFB 5I71C 1RJZA 1QFWM 5EZJA 1AO7E 4RFOL 4BA8A 2ZSVB 5EU7C 5DHVB 1ZVSA 1U58B 4OQTA 4ZPVB 4KQ3H 4QRPA 1LDSA 4UQ2B 2KDGA 4ZS7L 2V7NA 1N6QL 3V4UH 2IFFL 3E2HB 4P2RD 4Q97A 4MA8L 5B38B 4FA8A 4AENA 4LRNH 4XMPH 2UWEA 5CWSB 2XQYG 1IGIL 2FZ3A 2EIDA 1BFVL 2P49B 4TQEH 3SDDD 5DWUH 4LPUA 4NM8H 4LLQB 3O3EB 4XNQA 3OTTA 4ZTPH 1BIIA 4HQQH 5JORB 2IPTL 4KVNH 2QEJA 4JQXC 3V6ZA 3CFKB 3GB7A 4PJXE 1FVEB 1KPVB 1W72B 1D6EB 2WP3O 4X6BA 5ITBH 4LCWE 4JO3L 4YR6A 4KKLC 4FQXB 5C0CE 4R2GC 4I48B 1MCCA 2AGJL 3NCEB 4WWID 2APBA 4GKZB 3RP1A 2AEWA 2JJVA 5DS8A 4L3ED 4UIMB 1HWGB 1KN2H 2A6JB 5IT2L 4XPBH 3TN0C 3ZKND 3T4YA 4LASL 3MRQA 3G6DH 4PG2A 4QTHA 5HHXH 3EOAB 2XWTB 2XG5A 4G42A 5IG7B 1RQ5A 3BMWA 1BQSA 1UB6A 3PHOB 4YNYB 4A6YB 3GSNB 1XMWA 2DQEL 5GISH 2P5WB 1N0XL 1DFBH 3V4PL 4JY6B 4YZFE 5DQJA 4PJXF 3L5XH 5DHXB 2BOCA 3GUTA 1Q0XL 2BDNH 1MFNA 2CKBH 1OGTB 1A6VL 5E56A 2OR8A 4G9DA 2Y6SC 5F88B 5CSZB 1C5BH 4UQ3B 2P46B 4O9HL 5I16B 2AV7A 3RGVC 3TH3T 3KPOA 1G9MH 2CDFA 3O6ML 5FHAL 4CADA 5I17A 1U2CA 4U1HA 5J13C 5K9KA 3IXTA 4K8RD 4X7CC 2OQJB 4JQIL 4W4OA 4LOUD 1RV6X 5K9QG 3K4ZA 3INUL 5DC9B 4RAVB 4LSSL 4AH2A 2AQ1A 2R1XA 4AQOA 2V17H 1A7RL 4BYHA 3FAXA 2HFEA 4RNRA 3N06B 3BD4A 1R3JA 1G7MB 1KJ2H 2FB4L 3QA3B 4HUUB 1ZT7B 2HFGH 4UTAH 2IJ0C 2DI9A 5E99L 3LKRB 1K6QH 1VGKB 4YZFF 1RZ7H 1AO7D 3DIFB 3HE6C 4H5SA 4B7IA 4NQSB 2OZ4L 3FCTB 3C5ZA 4M93B 5BZDB 1OD7A 2OTWB 1OY3B 3HI6L 1JNNL 3TP4A 1U8OB 5HI4D 2N7BA 1IZKA 3GGWA 2NY6B 4HIXL 1ZOXA 5ISZE 4Z5RA 2ENSA 1DQDH 1XGRB 4KMQA 4OD3H 4U1SB 5HYJE 1B2WL 2R0LL 5M95B 3SO3C 1UFUA 1OAUH 2E8ZA 1WSST 5MENA 2NX5E 4O51A 2G2RB 5GS2D 1FZOA 2NZ9C 1MHPH 2X70B 2Y36H 5D6DA 3WNKA 1BJMA 3RWEB 2GJZB 1WTGT 1QVOA 3HPJB 4XVTL 5E2VL 3UP1A 4WEMB 4Q7DA 1BBDH 3SPVB 5E4EC 4LCWD 2FWOA 2IANA 3ARDD 1SEQL 4PLOB 5C0CD 1IGFL 2SEBA 3FO9B 4Y5VB 4HS3B 4Y88A 3AFLA 2DL2A 4M6AA 1NUFA 5F3BA 3ILQC 1A6UL 2DKMA 3CH1A 5E8NB 5F7DB 4G43B 4LLDA 3V0WL 1FFOA 2X4RA 4LHUG 2YXFA 3E6HB 4OCRH 4M03A 2DTML 5GGSY 1GYAA 2AEPH 3CSPA 2F8XC 4JN2B 5JPNA 1BWWA 2CK0H 3IDGB 5C09B 3U30C 3UCRA 5E6ZA 5E5RB 1IGYA 3DROB 3MBED 3UTSD 5KOMC 4LSRL 3Q0HA 2ZCLH 4XNZB 4XNYH 1G7PB 3P30H 2FECI 4X7DC 5CSBA 2M1KA 4WI4A 2EDRA 5FDWA 1PEZA 2A74A 4OCWH 3SE8H 2I5YL 2AERT 1T0MB 3O6KL 1MCOH 1Q9WB 2MQ3A 4GG8B 2A73B 5IVXA 1FSKB 4MCZA 2RJMA 4RWYL 5CD3B 2AI0H 4IRZH 3U0PB 2ATKA 1DZBA 4JFEB 4OLZH 4TRPH 4FFZL 4G7YL 5GJTH 3RUGE 3MZTA 2D7QA 3MRMA 3BQUA 2VDPH 4LIQH 2HT3D 4TUJB 1DTUA 4JM4L 4NP4H 5HDQL 4OZIA 4UV7L 4XB8A 3FZUC 1AI1L 4XVUD 1OCWL 4PLNC 4KKBC 2ZWLT 1B4RA 1L7IL 3H3PL 2JK5A 2UYLB 4XI5D 4OCSH 5EFIB 2O61A 1ZLWK 1G9NL 5ICZA 2F9BT 5D1XA 3NAAL 4XP5H 3UYRL 1YUHB 1A7PH 4P59L 3BDYH 1FFPA 1W72H 2A9NH 2WIIA 4YGAB 2OXHA 1HIMH 4N5ED 4GG6E 1UZ8B 1OAQL 1SM3L 3O3AA 4ZO9A 1U8PA 3NN8A 3OKKA 4Z0BH 2C3WA 1NDMB 3KWWA 4I8DA 3T2PA 5ISZD 2LU4A 4P2QA 3ZTJG 5AD0A 5EG6C 5HYJD 1MCPH 3QFDA 3T8XA 1UWXH 2NX5D 2NW2B 1UXSB 3RUGF 3RIFK 4XP4L 5IHUH 3U9UA 4BZ2H 4JY5H 5J11B 3L6FA 1DBMH 4XP1L 1UQSA 4U1NA 4JZJB 3HAEG 3P77A 4AK1A 2QTEA 5KN5B 4JY4A 4OSUL 3TO4A 3VWJC 2NCMA 1I7ZA 1MWAH 3OB0H 1MVFA 2ZSWA 5KSAC 2VC2L 1BEYL 1RZJH 1EGJA 1XGUB 3VJ6B 5DEGA 1UJTA 4KKNA 1KBGL 1R3HB 4FS0A 4MVBD 2H26A 4RWHA 5CJQH 1C5CL 1U8QA 4UNVA 1NCCL 4GG6F 1EO5A 2FIKB 1SYVA 1AGBA 4AM0B 1JCKA 5T1DH 5D7IE 5IFHL 4KROC 4NM4H 4P57A 3EOTL 5I1DA 2YPKA 3GIVB 4JEGB 4FN0A 2UY7A 3IXAB 4JZOB 4R0LB 3U36B 1FJ1A 4O02L 5CZXD 3FHAA 3AAZB 4U6XB 5E6IC 1L0YA 4OGAC 4ISVA 3I3DA 1GJIA 2ZCKL 1MLBB 3L3JA 5E8DH 1LO5B 2BJML 1MCWM 1XR8B 1VKXA 1INDL 3B2UC 3F8UB 4B53A 2BVQB 2KL6A 4MQXC 2N56A 3VMPA 5I66A 4HGWB 1MIEH 3IAQA 4X4MA 5D5MB 4OF3A 2FGZA 1UVQA 3FQNA 3S88H 1D5XB 2KH2B 3UTTB 1A8JH 1H8NA 1RUPL 2GTZA 4KHXL 5IVXE 2ATPA 4XBGA 3U9PH 3B43A 3TZVD 1FGNL 1NCUA 25C8H 4HF5H 4GKSB 4LPCA 3ALWA 3IDNB 5CBEB 4HV8A 1FHGA 4KMTL 3H9SD 1RULH 4ELMB 3LZFL 1DBKH 2J7LA 3BIBX 1MCJA 1JMZA 2YD1A 3RPKA 1B0GB 4MQSB 1DEEB 4WV1A 2M26A 2DF3A 3M17A 4EN3B 5D7IF 1CL7I 3DHMA 5BS0D 5IKCA 2VH5H 2VAAA 1T03H 5T3ZE 2PCPB 4PREB 5AYUL 2Q8AL 3STZB 2RB8A 2PW1B 4PGCB 4XVSL 1O5DT 3C9NA 1NDGB 1IEAB 1RUMH 3LVEA 4IRSC 5FB8A 3MR9B 4LNVA 4OIIH 5F7LB 1VFAB 3QWRD 2FO4B 5INCB 4UT9L 2GKIA 3NABL 2FYYB 1QEWA 2WK2A 4OCMC 5CHNB 4I77L 3E8UH 5C08E 1S9VA 3WFCL 5T1MA 4XTRD 1FL5B 3HCVB 1CLZL 5EUKA 4X8JA 2VDOH 4PGEB 4MJ6A 4EDXA 5KBNC 5IVXF 1U3HB 2J8UE 2JLLA 1OVZA 1ORSB 2WINA 2KZ1B 3C5JB 4X5WB 4WW1B 5TE7H 2VRAA 4X99B 4PJ7E 2DB8A 4ELKA 1LEKA 4D3CL 1M6OB 5FYJL 3SCMC 3TV3L 1IQDA 2EZ0C 5J7CC 4DGVH 2A77L 4OF7A 4PJDA 1T2XA 3TIEB 1U8LA 2X89A 4J3SA 1ZXQA 5ACMA 2VLRA 3QRFM 1T83A 5FF6B 3CDFA 5C0JB 1NJ9A 2W65B 4UINL 3ARGA 1MHHB 3N85L 2ESVA 1PSKH 1SQ2N 4ZQKB 3QULB 3IDJB 1UKQA 1CTOA 1KLUB 4TNWK 4J4PD 5EZIL 3MGAA 2JJSA 3A6BL 4ZS6D 2J8UF 3PGDB 4JANB 4KPHH 3A6OA 3WIHH 4FZEL 5ESAB 1E4WL 3Q5YA 3JV5A 4L5FL 3CXHK 4PJ7F 3TNNA 2JF1A 5DA0B 3LKOA 4XMLL 2B20A 4X7TB 2LFGA 2A6KA 1J86A 1EJOL 2BC4A 4KUZL 4S1RL 2FRGP 4PY8I 4Z7WE 4JKPL 3MXWL 4X4ME 5H35A 4DW2L 1X4ZA 4QOKE 2GSGB 1F00I 1K8IA 3HC3L 3OXRA 3UJJL 5D1QD 5D96C 2YA2A 1P69B 3PJSA 2AXGB 4ONGH 4JO2L 4I0PC 4L8DA 5JMRA 4XBPA 1JNHB 2HA1A 3IFOB 3KVQA 4PV8A 4NWTL 1CFQA 1XIWA 2VE6A 4PTUA 5FAAA 3IRPX 1VFBB 1MJ7L 1XZ0B 4MA1C 3NA4A 1T1YB 4YDJA 3MNWA 3IDUA 4P2OB 1JHKH 3GNMH 5T3ZD 2LV4A 1RZKL 3BP4A 3GMMB 4G6FB 5EO1A 3ZE2E 5A2LH 5ALBL 2X9YA 3CSGA 4P3CH 3BHBA 4ZD3L 3MROB 4UTBH 4Z7WF 2PO6B 3QFJA 5C08D 3GSWB 2K9UA 2WV3A 2OJZL 3SE3C 4K3JH 4NIKB 3OAYK 5DJAA 2XQYK 5K9OA 1NH6A 2V2TB 5FGCB 4J1UA 4MXQC 3K8MA 1AC6A 4TTDD 5D7LE 3U7AA 4HX1A 4P9HH 5JHDA 1V05A 1P7KB 3BH9A 2P43B 2HKFL 2E9IA 5MHSD 4OM1L 4K3HA 5DYOB 4KFZC 4NRXA 4H0GA 2DLEA 2R0WH 1P9MC 5JLZB 1WBYB 2PTTA 3QQ9D 3TH2T 1MCSA 4G6JH 5I1HH 3ZE2F 4L8SC 4P5TA 4LLMB 3D39E 3QIBC 3VW3L 1AGFA 4NQEA 4PY8J 2ESVE 4Q9BA 1Q9OB 2V5TA 3U0TB 1JPSH 1O7SA 1Y0LB 1AH1A 4FNLL 4FP8H 5GZNC 3C08H 4R9HA 3DUHA 4F8QA 1IKFL 5C7XL 2EH7H 5AZEH 3MRHB 1PZ5B 3NCFB 1Z3GL 1OSPL 2VN4A 3MNVA 4EVNB 3QDGA 1X44A 1KIQB 4PJFE 1J88A 1W8OA 4PP1D 1L0XA 4QRRB 1OTSD 3VWKA 5H37G 5ACZA 5B8CC 3ULUE 3LB6C 1AD0B 1A0QL 2AK4B 3CMOH 4XB7A 4N90E 5DF0A 3BPCB 3ECBB 3QJHB 2AEQL 2OCFD 2MQCA 4QOKD 3E3QC 4N5UA 1HXYA 5JR1L 5I8KH 2ITDB 3MRKB 2MKLC 4YFLI 2XOTA 4WHCA 1RY7B 4EUPA 2IBZX 5H2BB 5KZCB 4H25A 2I26N 2WBJB 1R3IH 4QXUH 4Y16D 5BVPH 1J05B 2UY6A 1NBVL 4PJIA 2G75A 5SX5K 1F4HA 3B9VA 1MI5E 3IF1A 1J1XH 2DQTH 2Y5EA 3ZO0A 4FABL 2BOBB 4KKAC 2J6EA 5GRZA 1R5IA 2Z91B 3D0VB 3NFPB 3QYCA 5DRNA 4RGMC 4PJFF 4X6FA 3VFUB 1A6WL 3O8XA 4I0CC 3DSFH 1LO4H 4LDOB 1OSZA 3ULUF 5L6YH 1CN4A 4YO0B 4OCNC 2GK2A 4DFIA 3V5DB 3SDCC 3ARFC 5GGQL 5FOBA 3MRCA 3C60A 2IQAA 3W0WE 2NXZC 3HPLA 3UTZA 2B2XH 1NBYA 3L3HA 5TQ0H 4HUWB 4NHUB 1NKRA 4XCYB 5GJSL 4BK5A 2ZJSH 1BFTA 3GSXB 2XNAB 4NUJB 1IT9H 3X12A 5CGYD 1J18A 1GZPB 2OZ4A 2O93L 4NQCB 4U1IB 2DN7A 2L0DA 1KEMH 3T65A 1I8MB 3W9EA 1NEZB 1P1ZA 1RIVL 4RGNB 5EOCJ 1HHHB 4U2ZA 3WN5B 4PJHA 5TJWK 1N2RA 4QY8B 1SEBB 4X98B 2ADJB 2O5ZH 3MXVL 3KJ4B 3D39D 3MUGB 5ITFB 4BM7A 2V5YA 3MBXL 3OXSB 4NQEE 4APQD 3PV6B 4M7LH 3CXDH 3V8CA 2R4SH 4LEOB 4NN7C 3PABB 3VA2C 3VE0A 1F4WL 3FFCA 3OAUH 3BOVA 4P9MH 3V52H 2YUXA 5M94B 3VG9B 5DC4B 3BZ4B 4KK5D 1T04B 1C5DB 1OPGH 4H0IA 3QDJB 1Z2KA 1I4FA 4JLRB 4TSBH 4HEPG 3P11H 4H26A 1IAKA 1XGTB 2WNGA 3EJYC 2XKSA 5FDYA 5DMIL 4ORZC 5HD8D 1CFVH 3RVWD 3RZCB 4KZEH 3WIFB 2ZUUA 4A2LA 3NOIA 3ULUD 2ADGA 5GRVL 4V1DD 4N90D 2NY0C 5D7JA 4O4YH 1S9XB 5E2JA 1KJMB 4P23D 3V6FB 3ZYZA 1IC5H 3S3JA 3IFPA 3EHBD 4FHBD 5FECA 1WC7B 1MFCH 4ZUUA 1MFEL 1AGEB 1G7JA 2E7MA 1QFHA 4ALAL 5IFJB 4D8PB 5HGHB 3NPSC 1A7OH 1GGCL 3GMRB 1RZGA 1UT9A 5HJ3A 3AXLB 1HCFX 4R7DB 4DKEL 4KH2A 2AV1A 2BNUA 1E4KA 1TVHA 1T66C 1T0PB 3L3OA 3O9WD 4FQIL 5C8JB 3GJFK 3BP7B 3BPNB 1MI5D 4XWGH 3ZT6A 3FQUA 4MQ7B 1NAKL 4PG2C 1T5XA 4JGJA 3RL1B 4M5YL 2JCCB 4DAGH 1N3NB 2F74A 4X4ZA 3P9LA 1QP1A 1GGUA 1YEJL 4NO3B 1BVKB 4OLEA 4OCXL 3D25A 3G5VB 5J56B 2I9LA 1ND0A 4X6CA 4F7MA 4DKFL 5F9JA 1TJHH 3VFWB 5F9DC 4GXUN 3W0WD 2HP4A 3SGDH 3MLZH 2UVEA 1T6WA 1FVCB 2WLYA 2C3XA 1ZTXH 1I1AD 3FB6A 5E9DA 3WO3B 3JSSA 1JPGB 4Y4HD 3RWCB 1HOCB 3ZDXE 1WCBB 5T1KA 4YWGH 1U95B 3OKLA 4NQUA 4YPJA 5C0AE 3D2UB 2DYPA 4WHTB 3W5NA 5I1EL 5IB1A 3PWLB 4W4OC 1MY7A 2RFXA 3VFOB 3MGTA 3KS0H 1U6AH 3C6SA 3FOLB 2WUCH 2WQ8A 2PN5A 1R5WA 2EICA 3KLSA 2CK2A 5JIHA 1U93A 2EXYC 5DQ9A 3EDJA 5E08L 1CGUA 4YX2H 2P8PA 3MRFA 3C2AH 1LO2L 2PYEE 2FR4A 3BUYB 4GSDL 5JW3L 4IHOA 4WTXA 1S8DA 4RFNC 3C5ZC 3F65A 4K94H 4M1GL 3QWOB 3NTCH 2ZOKA 3D3VE 5I71B 4LKCB 1GAFH 3BN9D 3ZDXF 4LFHD 1RMFL 3RFZC 3KYNB 2YKLL 1N59A 3MNZB 5JPMB 3HR5B 4UB0H 1AY1L 5I9QC 3WL9A 2FEDD 4PB9L 2P48B 1A3RL 5JNYB 3AC0A 1QHPA 2NW3B 1DDHB 3KPLA 4LLAA 5EZLB 4F15B 5F7HA 2NY4C 4F57L 1ZA3A 1F11A 4QT5B 5D6DC 4NO2B 1DE4A 3OJ2C 4PRPE 5D8JH 1JPST 5F96L 4P46A 3REVB 3KPTA 4G6KL 1A6ZB 3C6LA 5C07D 3MZGB 3S96A 2FIRT 5DXWA 2H3NB 2NR6C 3BPOC 4OGYL 4UDTA 1OT1A 2O5YH 1M1SA 1QSFB 3O4OC 4GQ9L 2NTFB 4Y19E 3MRDA 4RMUA 5EIIA 1DUZA 3QUZB 4BSVA 3TCXA 3L3DA 4YXHL 5DUPL 1Z6JT 4JRWA 3EDDA 4ZOCA 4PJ9A 1BX2A 4GMTL 4Y2OA 2F5AL 3TBVB 3G04A 1I9RH 5FUZH 5EC1A 2OJEA 3TGXA 4DKDC 1QLFA 1M71B 4EJ1C 3VXRE 5A2IH 1ZHKA 1BQUA 4MHHG 2YK1L 3OV6A 5F1KC 5MI0C 3VRIA 1OW0A 2AXFB 5T1LB 1CICD 3TNMA 4ZNEA 3FT2B 4Y5YA 3MRBB 3TFKC 2XPGB 2R4RL 3VRJA 4MJ5B 1NKOA 3HE7D 2VXUL 3LSOB 2GCYB 1TQCC 2BSTB 1CGVA 1N64L 2JB6A 1FNSL 1XCQB 3CXHJ 3FB7B 1UKSA 5C0AD 5FCUL 4HXBL 2OL3L 3GO1H 4EUPG 4O00A 4LSQH 1I3GH 1QNZH 3HNSL 3HUJA 1NEUA 2ARJB 3SDXE 3WS3A 3BQUC 4YHZH 3TEUA 1QRND 2CKBA 2EH8H 4AIOA 5HHPB 3H7BA 3UROR 1DQQA 2JELL 4WUKL 5DJZB 3UX9B 3B9AA 4C55A 4NZRL 5TE6L 5D1XC 2YUWA 2R2EA 1FZMB 1IM9D 3MV8A 3EOBA 1EEUA 3VG0H 5IR1A 2QQKL 3ALPA 3QXDB 4X7EC 2PYED 3RBGA 3PNWB 4PY7A 2BVPA 4GW5B 1X5XA 3DBXA 1HDMA 5TDNB 3QWQB 2ZUTA 4YHLL 4M7KH 2XFXA 3RGHA 1MQKH 5EBLB 2DWDA 5HYQB 3D3VD 4ODUB 5IF0A 2PW2B 5E2UH 2FX7H 1TPXB 1HQRB 5J1AB 1CFSB 1XGQB 3GI8H 4U4BA 1UWEH 3LD8C 2ZG3A 4TN9A 3KPMA 4HH9A 3G08A 1L9MA 1N5AA 1TITA 4WU5A 3ZLQC 1SJXA 4LLYA 3SDXF 1GGTA 3MACL 5D7SL 5I1GL 5E5MB 4DJMA 2OTUB 4M7LT 4P5MB 4ZUSA 1QFUH 4PRPD 1R3LB 2NY1B 1YQVL 1GSMA 1P4IH 2GITA 2EYTA 4JDZA 2G5BB 3PIQB 3G6JB 3S5LB 5JW4N 3WS6A 4YPGA 2BSSB 1JPFA 5GGSA 4KRPD 1HH6A 4FXKB 3C87A 2B0SH 4RQQB 3PQYA 4Y19D 5GRJH 5E4EB 3EZ8A 4YHIB 1EFXD 2ZUWA 4H20L 4JFOB 3A67L 4MD5A 2C7UB 4O2CA 3EYVB 1W8NA 2VTFA 1D6VH 3BYTA 1RUQH 3DVFA 5DO2D 5IB3B 2OI9C 4CU7A 4CVZA 5I1LB 4IIQA 3VXRD 2CIKA 4HLJA 2JIXD 2Z35B 5KVGH 2BNRA 3C5SB 4BZ1H 5C0RH 3IU4L 2F53B 4PFEA 2Z8VC 1T21B 1H3PH 2HMIC 3QDAA 1EEYA 4BH8A 1YEEH 1QFPA 5F7WC 4ZO8A 1CXEA 2MPAH 3GMLA 1QG3A 2W91A 1B6DA 1G1CA 2Z4QA 4FXGB 5C0IB 4LCYB 1OARH 5F8QC 2L7UA 3ARPA 4J6RL 3OX8B 4XT1C 3HZKB 4J3VA 1ZS8A 5JMOC 2A0LD 3JUYA 1TFHA 3V6OA 3HUJE 3OBAA 1KPRB 3IJYB 4OLUL 1MH5B 2OLDA 1XF2A 4KGJA 2ZP0T 4U6HA 3AVEA 1C08A 4JO4H 4H88H 43CAB 2DMBA 2RBLA 2UV3A 3GRWL 4LARL 3CFBB 3FAWA 4QHMA 5KG9B 3EJZD 3QDMB 5SWZE 2X44D 4S2SA 1UM4H 4JFPB 3HZVB 1QLRA 5KSBE 3RVXD 4NO0A 1AFVL 4MNGB 4Y5XB 2OM5A 1ZSDB 5IROA 3O11B 5LKNA 4HGKC 3TT1L 4NQDB 2VL4A 1L0QA 3PDOA 2OX5A 4RZCA 5BJTA 4Q9CA 4GRLD 3RKDC 3IVKB 1QKZH 4P0DA 4C57C 4EZMA 4WDIA 2Q86B 1UB5A 4PJEB 4PJ8A 4WENB 4NBXB 3HLAB 1CQKA 4YEEA 3V9FA 4FQQB 1FRGH 1VGEL 4LPXA 1CS6A 4PB0L 1T83C 5IQ7L 3QUKA 3GBNH 4JPWH 2C4FT 5EU6E 4YHPB 3IDIA 3ARGC 2GYSA 3S3SA 5EORH 1X7QB 2IPKA 3CX5J 5ALCH 5JW5B 3MRIA 4JR9L 4G9FA 4LVHC 5T33H 5KSBF 3E0GA 5EC2A 5SWSA 5LGHH 4P4KD 1Q0YH 1U0QA 2BHYA 2JJSC 1HEZA 2WUBL 3K4DA 5ENWA 1YEDA 3QEUA 4BQ6A 1CD8A 4NZUH 1A7QH 5I8CA 3P4MA 2CXGA 3AS0A 4KUCD 2FL5A 4HK3J 4R8WL 1WLHA 3GMQB 4OJFL 4KROB 6CGTA 4W6YB 3QEHB 3MOAL 4NQXA 1Q94A 4E5XB 4L8CB 2HH0H 3K4AA 1CE1L 4LHJB 5E6IB 5GGTL 2FX9L 2R29L 3JXAA 3QCTH 3UTQB 5C3LD 4WU7B 4JPVH 4JRXA 1HQ4A 2CJUL 3SDAB 2FNBA 1G0XA 5GS3A 5FEBA 4X0KA 2D3VA 4MJIE 4FG6D 5GZOC 2IG2L 2LU7A 1S5HA 3TJHD 1MHEB 2BY2A 5BMFL 4KTDL 5CS7A 3LRSB 4JHBA 2QR0A 1IGTB 5I0DA 3LKNB 2GEEA 3IJSA 4GRMA 3BPLC 3NIGF 1S7XB 1NCWL 1OB1A 1RJLB 2CKNA 2DM2A 3PG2A 1TETL 5SWZD 4WW2F 4UU9B 2QHRH 3RWHB 5FV1L 1OL0A 8FABA 5L2KE 5FO7B 1IBGH 4P3DA 2P7TB 4Z7VA 3VXUB 2DQJL 1IRAY 2MHAA 3LEYL 4YGVA 5FKAA 1P6AB 4HC1H 4LIQE 3HRPA 4K71B 5A43C 3KYMA 2O26U 4U0RC 5KVEH 1VDGA 3L3IB 2GJ6E 3RDTB 2NTSP 3ZHLA 4FFWD 4GAJH 3GJEA 3KPNB 1JRHI 1D7FA 3DXAA 5HYIA 4XH2A 5FA4A 3PWVB 2BY1A 4R26H 5D1ZB 3X17A 1RZ8A 4Y8DC 2AJUH 5CZVH 3K3QA 2X4UA 2FSEA 4N8VA 4G8GD 3I02B 1L7TL 3M8OH 4QRTA 4ZUWB 5CEYA 5CEXA 1H15B 4LVOC 5IW3A 1JTTA 3UBXI 5FUOL 1HK6A 5EU6D 1HILB 3FO2A 2XY1A 4P5TC 1F97A 4FRWA 7FABH 3EGSB 5I1CH 1F6LL 1C16A 1MQ8A 1CIUA 1ZKAA 5SWSE 3EYUL 3STBA 1T3FA 5DRWA 3LPGA 1BZ9A 3DRQB 2H6PB 3IDMB 3MRGB 3Q1SL 4IOIA 4NJ9H 3SQOL 3P0YL 1U8KA 2VISB 5ID1A 4WTWA 4ZOAA 4XWOC 1U8JA 3VWKC 4UV4L 4P2RB 1IQWH 3IAPA 1ADQH 4JDVA 1ETZA 2CO6B 1EAJA 1NGYB 2E9JA 4HMEA 1FO0B 1B0RB 3GHBL 3D1MC 2X7LB 4FFVC 4U7MA 5CCKH 3MJ7A 1MY5A 1XFPA 3SE9L 5JO5B 3EAKA 3TO2B 2KQMA 4WO4C 4E0RA 4Y7MA 4OZ4A 4MJID 4Z7OE 4ZOEA 2YBRA 3EFDL 1WFTA 3HG1E 1DBJL 1H5BA 2R2HA 1EZVX 3SGEH 1FZKA 2D7OA 4I0PB 4R96A 5FYKL 1NC4A 3CLEH 4HIJB 3MUZ1 4I18B 1I7TA 2D0FA 4L3CB 4L3EB 3O8XC 2MCPH 1ZHBA 1M7DB 3ROLB 5I15L 1WEJH 1A1MB 4MA1B 2B1AH 3FFDB 3OR6A 5I73B 1KCRH 1Z9OA 4AIZB 4L9LA 5L2KD 2PKDA 3AU1B 4KMLB 1D5MA 1BGXH 3CVHB 1E6OL 2EDJA 3MLXH 4ODVL 3QZWA 4OT1L 2HT4D 5E00A 3LMJH 4KQ3L 3O2VH 2VNCA 2YWZA 4Y2DC 32C2B 4G6AC 5E94B 4UT7H 4JFFE 3CFJB 2D9CA 2GJ6D 4LDEB 3HFML 4F7TB 1R0AH 5B21A 4YQXL 3UAJC 5JQHC 1XEDA 3BP5A 1MCDA 2VLLB 4Z7OF 5HHNA 2DQHL 1U41A 5FO8B 2HFFB 4Z95L 2DQCH 5TDPB 3K2MC 1FYTA 4GW4B 3NFNB 2X10A 2RCSH 4NKMB 5DMYA 4KRLB 3KNBB 3BZDA 3BWUC 2UZXB 4HIIA 4K23L 1B4JL 2VO5A 4HUKB 4FQXD 2XXCB 4MAUL 4AG4L 2HLFD 1DJSA 3OPZH 1TNMA 1OTUC 2HKHH 5ICXA 5I30L 5IV2B 5HBBA 4Y1AE 5J89A 1NGXA 1YJDH 4OZGA 3X3FL 4JFQA 4FXLA 2H2SD 5BXFA 4Q9QH 1MHCA 5F6IC 1SYSB 4IMKA 1FVDB 1CT8B 2YZ8A 3VD5A 4QHNA 3QIBB 1KCSH 1U91A 4NYLA 1X4YA 1I3VA 2XTJC 4ZPTB 1AO7B 3GKWL 5I8EB 4YIQB 3C8HA 3NH7H 5JZ7C 2EECA 4KV5E 4M6ML 5DJ2A 1QLEH 4AL8L 4YHMH 1J8HA 1Q72H 5F3HB 3BRGC 2FX8L 2BSRB 2AEIT 1C1EH 1LP9A 5I75C 3AY4A 1LO3L 1A1OA 4UILH 1WZ1H 1BZ7A 1XCTB 3D0LB 5C71A 3D85A 1T7YA 4OAWA 4JE4B 4RMTA 3WSQL 4RX4A 4PRHB 3BUTA 2QQLL 2C1PB 3BW9A 3WFDH 2EYRB 5IFAH 1N7MH 2DJUA 5GGVH 3VFRB 4AEHL 4HIEB 3QEGL 4TOYL 3MMEB 3JVGA 4JFEE 4PJXB 3T2QA 3ZKXC 3WDIA 5J6GA 2D03L 1ED3B 3WFBL 2ID5A 5C2BH 1ZHNB 1IAII 2JB5H 5DK0A 4C83B 4LCWB 3D69A 3HG1D 3KPSE 5C0CB 4Z77A 1AQDB 2D4DA 5CUSH 2FATH 3GSUA 2XA8L 4MA7H 5EZOL 3TJEH 4L4TA 5HHVL 4KV5F 4DK6A 1GPOL 3IAGC 2OL3A 4KI5E 4OKVB 3MV9A 3R06B 5AUMA 3IKKA 3GJFB 5DJXB 4NKIL 4LNRA 1GHFL 1HE7A 1QSEE 4ONHA 3QCVL 2B8OT 3WUWG 3F12A 1JFQH 1IL1A 5A40E 1X5GA 1BOGB 2PETA 2BVTA 2B1HH 3MBEB 3OKMB 4MX7B 2NQCA 1HHJB 2VXVH 3GBML 3ZTNH 3QQ4A 3BIKB 4J8RA 5DTFB 4JFFD 1D3CA 3IJHB 2BZDA 1HINL 1A9EB 4M9OA 4F2MA 2YC1B 3WXVL 5J9PB 1OHQA 5DR5H 4MWFA 5BV7B 1QR4A 2K1MA 1A2YB 1EXUB 2I07A 3GSQA 3ARBB 4P23A 4OGXH 2DDQH 4L8BB 2PYFB 4MS8C 1MRCL 5CP7A 1YEHH 2AJZA 4I4WB 2W0FA 5FM4A 2DRUA 2FEEI 4KI5F 4FTVE 2R1WB 3OHXB 3JWOL 4MNQE 1YEFL 2KPNA 1KCUL 1V7NL 4NN5B 5JTWA 2W9EH 5CIPA 4WJ5A 3EYOA 1RJCA 3S4SA 5FYLE 3LN4A 4Z7UB 3LKQA 2HTLC 2Z31D 2LU3A 4Y1AD 3BZEB 3CSYA 4PRDA 1S7UB 1FO0H 3QNZA 3K46A 1K4CB 4HK0B 4PG9B 4X6DE 4PBXA 4JVWA 4OLXL 2F58L 4HHAB 5IMKB 3QO0B 5ADOH 4ZUTB 5D6CA 1SHMA 5EZJB 1JMXA 5GSRB 1YEGL 3HS0A 4QEGA 5CAYB 4TNVF 1NBQA 4RMVA 4HK3N 1T22B 1JF6A 4AZ8A 2XZAL 4Z0XB 3RVUC 1XF5A 2IAMA 1LP9E 4DN3H 2P1YA 4Y89A 3SOBL 2C3GA 3B6SA 1J0KA 5ISZB 1ZLUH 4MAYD 6FABL 4M5ZH 5HYJB 1D9KA 4N8VG 2NX5B 4P46C 3AREA 3WHXB 1JZ4A 3Q48A 3C6LC 2Y7QA 3LHPL 4X8XA 1BIIB 1MCOL 2NY0B 4F37F 1G7IA 2M2DA 2O5XH 3BZFA 4JFED 2GSIA 1TLKA 3V6ZB 3GB7B 2ZCHH 3NZ8B 5IMOA 4LOUC 3V7MA 3W81A 2ZKHH 4ODHH 4X6DF 1ZLVK 3ZYOA 2DKUA 4Z78A 1F02I 3KPSD 2AVGA 1DLHA 3LKSA 1EX0A 4FQHB 5F7YC 5EU4B 3BEVA 4KI5D 4OLYL 4S1DD 5I1AB 1J10A 1LP9F 2VDLH 4OZFA 3B83A 4XHJD 4R7NB 4YK4B 3MRQB 3VXQA 1FLRH 2V2WB 3KDMA 4G42B 1QSED 5E2TH 4U6YA 2X4TB 1OW0C 1UB6B 3Q3GB 1Z0MA 4Y5YC 5CINH 1S7VB 1SJEB 5IESL 3T1WA 3EO1B 4GKOA 3K8LA 3V7AE 1INEH 3RA7L 1KTLB 2PR4H 5HI4C 5C0EA 3GRWA 2VKWA 1OM3H 1SY6H 4POUB 3QG6A 1XGYH 2OSLA 1MEXH 4KTYA 4NZTL 3S3PA 1A9BA 1NC2A 4R90H 4ZFZA 5JW4R 1IEBA 3BGMA 3N1PC 4G9DB 1CXLA 2I9TA 3TZVB 4MLSA 4OGZA 2OP4L 1N0LA 2XZQH 3WUZA 4M62H 1P2CA 2LTQC 3DUUA 3ZMRA 3IDYB 4XNMA 1RJYB 5K9KB 4JPIA 4OZHE 4FZ8H 4FTVD 3IXTB 4OFKA 3ARDC 4MNQD 5F9WC 3RUGB 5E1AA 3IETB 3EO0A 4A6YL 1OAKL 3GSNL 4LU5L 2YZ1A 1CXKA 7CGTA 1RZFH 2APTA 2EKSA 4RNRB 1D5IH 1R3JB 1Y6MR 1N4XH 1MFDH 5IW6A 2ZPKH 3BIAX 3ULVL 3QZWG 2QJDA 5DRZA 1FCCA 4Q0XH 2X4NA 5I18L 5F97E 3W5MA 4H5SB 3S6CA 3TLRA 5I8OL 1G1YA 3GSVA 2XZCH 4XPFL 3C5ZB 1FQ9C 4PRBA 1NSNL 2MWCA 4C54A 4KJWC 2W59A 5J1SC 2WQRA 3K8KA 1CD9B 4XGZA 3P73A 1AXTL 4L3AA 2YPVH 4HUNB 5A16A 1RIUH 1NANI 4JFYB 5I9QB 5TE4L 5IIEA 4OZHF 5ID0A 4K3DH 1QPPA 4ETQA 4O51B 2AJYL 4JKWA 5ANMA 4JJ5A 3WS6C 1JV5B 2Q6WB 1A4KA 1IFHL 3CFDB 5EU3B 5K33A 1WZLA 2P47B 4HAGA 1RVFH 4KY1L 5JHLL 1AKJA 4NN6C 5F7NC 1HWHB 4NNPH 1I85C 5GGTA 1AGCB 2HT3C 3PWNB 1FV1A 3IKCA 4JO1L 4ZXBA 2IANB 3IDXH 3VGGA 5C0BA 1NLDH 1VEMA 2SEBB 2VERN 4XVUC 3DHJA 1DVFA 1ONQB 3CC5B 4I2XA 5A2JH 4NBZB 4K7FA 4Y4FA 1TCRB 3VXPB 2HWZH 4U1MB 3X14A 4MSWB 4X4XB 2X4OB 5DQDL 3CH1B 2J5LB 4WFHE 3OG6B 4IIQC 5TF1H 4HXAL 5D7IB 1CLCA 3F6IA 3ZTJH 4XNUL 3WLBB 4ODSH 4I13B 1WFNA 5JPNB 5HHQB 1KJ3H 3RTQA 4K2UL 1RZKC 2CGRH 4MNHB 1U3HD 1QFWI 3B2VH 4ODWB 3HAEH 4J7RA 3PP4L 4ZFGL 3FO0L 4JM2F 5FDWB 1UGNA 5HI3D 2QQNL 5JDSB 2YRLA 2ZUSA 1WJ3A 3K1KC 5FV2A 3AM8A 3V6OC 5IVXB 2CUMA 3FOMA 4MCZB 5D1QB 2V9RA 1CU4H 5TGBA 3WCYA 4WUUA 3IRZA 3I2CL 4OQTH 1P4BL 3BD5A 1S9WA 4J3XA 1VEPA 1VEOA 4LK4A 3MRMB 5JUEH 2IBZY 4OD1H 1IGCH 4HWEH 5A2KH 1ES0A 3N1QC 4OZIB 1TTGA 2FH6A 1MFBL 3DX8A 3MJ9L 4S1SL 2JK5B 3DMMA 3W39B 1MSPA 3B4NA 4HFWA 3EYFB 5D1XB 4MHHI 1TXKA 4WFFE 3V7AG 3QRGH 5F1NA 1OP5K 4CN4A 2NY3C 2R69H 1SVCP 1HSAA 5C08B 4KPHL 1YDPB 4X80H 2DBLH 4LBEB 2CLRA 3GMPB 2IGFL 1KLGA 1KELL 1KFAL 5HVFB 1EO8L 5I1JL 2P4AB 2J8UB 1BECA 3PL6B 1U8PB 5IB4A 2DQDL 2W60B 3JV4A 1MCEA 4U05A 3KWWB 4I5BA 4PJ8C 3ABZA 3ORJA 2DLTA 4P2QB 3LD8B 4HKJB 1CLOL 4MA3B 1D5BA 4XC1L 3B9KA 3QFDB 1DLFL 3MLYH 4KK9C 5ANME 4YHNA 2FJFA 3U9UB 1RU9H 3L6FB 4L4VA 3K81A 2EDNA 4BH7B 1UQSB 2E9WA 4U1NB 3TT3L 4XC3L 3P77B 3FQRA 5IEKA 5KVFL 1A14H 4JM2D 4UBDD 2C3VA 1JK8A 1JJUA 3WEXA 5HGAA 3UTPE 4JY4B 3TO4B 4X6EA 2R2BA 1YYML 4KHTH 1A7NH 3QI9A 4P2OD 4XNXH 2YPLE 1IC4H 5I1KH 4JG0H 1TZHB 5IJKC 1OAZL 4NT6A 2ITCA 4TVPL 3UJTL 1MAML 4WFHD 1Q9LA 5J6HA 4ETYA 1UACH 2PO6D 4P57B 1RK0B 5I1DB 1NMCC 4XTRC 2YPKB 5I1IL 3O6LH 1MCIA 1TJGL 3BKCH 1CG9A 2DIJA 3RWJB 2OI9B 3QUYD 4LSTH 4ISVB 1EK3A 1KTDB 1UWGH 3GFUA 1XAUA 1GIGL 4GBXA 3SGKC 1FDLL 3FO1A 5I66B 4Z7WB 1S9YB 4JJHA 2IADA 4M8QA 3LDBB 1UVQB 1DANU 5EOQH 2R8SH 1YEKH 4G80A 3CGTA 4OTXH 5TPWH 1M7XA 2PUQT 5LXGL 2ATPB 5DUML 5I6XB 3F5WA 1QQDA 1J9CT 1PG7H 2R23A 4WUUE 2Y07H 1UM5H 4HV8B 3O41B 1L6XA 5HSFA 4TULL 1B3JA 4Y16B 4WV1B 4YDKL 5DD0L 1HYSC 1JHTA 1E4XI 3DX9B 1BBJB 4CRPA 2P5EA 4M6OL 2NNAA 1OP3H 5IKCB 4EBQH 5KJRL 4XPTH 1NL0L 4POZD 3HHRB 1TQBB 1YMMA 3HI5H 4K7PX 3VXTB 3QH3A 4HUMB 3C9NB 3STLA 3WJJA 1TVDA 3VCLB 1R5VA 4WCYL 5FHBH 4MJ4A 4H1LA 4G8FA 1MRDL 3GSRA 1MUJA 4JHWL 2VIRB 4OBSA 1QEWB 2W9DH 4GH7B 3P9WB 4X7SL 5EB9A 2VITA 3RJDA 1S9VB 5T1MB 2CRYA 3HTLX 2R39A 4UOW1 1MJJA 1BJ1H 4MJ6B 4EDXB 2AK4D 1KG0A 4OLVH 4P49A 4CJ0A 4EXKA 4JG1L 3NCBB 1UCBH 5D7LB 4NDMA 5GHWH 4AT6A 3O2WH 4Z8FL 2A1WH 2HT2C 1BZQK 3JBG7 4ELKB 1F3DH 1YC8A 2YUVA 3VXME 3I50H 3QHFH 4AIXA 1DSFL 1IQDB 5TDOA 4EDWH 2GFBA 5TQ2L 2BY3A 1FCGA 5DGQA 5KZCD 5I8KL 1BREA 1JGLH 1U8LB 2WBJD 3VH8B 4R97B 3D18A 4DN4H 1UWXK 3MGOA 3UTPD 3MUY1 4NOBA 2J2ZA 5FO9B 3GIZL 1NJ9B 1UJ3A 3D39B 3NCJH 3ARGB 5KAQG 1YNKL 4APQB 2JCCE 2ESVB 3NZHL 2CDGB 2YPLD 4I3SL 3WIIH 4LVHB 1NMAH 4WI7A 3KJ6L 3CFCH 3BESR 2AKRA 3OB0K 5IB2A 3BE1H 3QXUA 5I19L 2VQTA 5JDJA 3VGEA 4JFDE 1J1PH 1WWCA 3L5WA 4B5EA 2YSSA 3EFFB 4HFUL 3MRNA 3TNNB 5MP6H 4IMLA 4EI5A 1P7QD 4PJFB 1N5YH 2YMXH 3LKOB 5E8OA 3RVTD 3SJVE 5IBUG 1K8DA 4WNQB 2BC4B 1AHWA 2VWEC 4LQFL 2R1YB 4ENED 2EDXA 3T1FA 5DJ6B 3SBWA 3T0EA 4QNPE 3OXRB 1F58H 4Z18A 3E1F1 4HS8H 1XT5A 2JCCF 2Z8WC 3FB5A 4JKKA 3NGBB 1KC5H 4L8DB 4E42A 1JP5A 1KENL 5EA0L 4XBPB 2GAZB 5BQ7B 4WHDA 4HBCL 5IHZB 2FH8A 1YY8B 3G5YB 1CFQB 1XIWB 2VE6B 5BRZA 4YAQA 1T1ZB 3QUXD 2VDKL 1MI5B 1BIHA 1DBBH 1X5YA 4BFIA 2NY7L 3N1MC 3FT3A 2G60L 2J8OA 4YDJB 2VDQL 4L9LC 4NNYA 4UI2A 2X2YA 2DQIL 2CIIA 4UIKL 4BQ8A 1YMME 2EE3A 3EOYG 1MJ8H 3U1SL 1H0DA 5D71H 3BP4B 2PXYD 4NNXA 1T2JA 3R4DA 5LQBH 4YLQT 1U36A 3QUMB 5EU7E 2Q8BH 4KQ4L 3BHBB 2BNQE 1HN1A 3R1GH 5E70A 1H8OA 3W0WB 4Q6IA 1MCWW 2X4QA 3JV6A 1I1AB 4OCYL 3SDYH 4QNPF 5A3ID 4QCIB 3T2NL 2YEZB 4KI1A 1EGJH 1OWWA 5DJAB 1IAOA 1CGSH 1CFVL 4Y4KA 5JOFB 1GH7A 4NGHL 4OLWH 1YMHA 3V0VA 1IGJA 1NBZA 2CQVA 3QG7L 3PUCA 3WDHA 3BH9B 4R4FH 4NKOB 3V8OA 3THML 2E7LA 2Q7NA 3VXMD 4YXKH 4Z7NE 3KXFA 4NRXB 5CLWA 3TBYB 4E41A 2H2PC 1ZAGA 5GRVK 4XPHL 5E8PB 1MAJA 1MJUL 2PTTB 3VFGL 5KTEL 3AS2A 1E6JH 4N1HB 1JUFB 2BRQA 3CCHB 4P5TB 4YHKL 1IM3A 4OV5B 1AGFB 4NQEB 5AZ2H 3HNTL 3CDCA 3LS5L 2BP3A 2HJFA 3P0VL 3R8BB 1PLGL 4NWUH 2DAVA 4HJ0D 4YEFA 3O6FD 1QRKA 4HMCA 5DHVA 1DL7H 1U58A 4ZPVA 3U7WL 3DUSA 5HVWA 3AY4C 5F7EL 2C3HA 5AAWA 4JFDD 2FECL 2DKSA 4OCLC 1MRFL 4KTEH 3BH8B 1A7BA 3SJVD 1DBAH 1MF2L 5ESVA 1VPOH 2UZIH 4Z7NF 1V7MH 3VWKB 2HRPL 5HGDA 1VFMA 4XVJH 3D2UD 4LLQA 1YN7B 2VXQL 3JVGC 4FQLL 1BFSA 5EWIL 4RISH 1GXEA 1DN2A 1DR9A 3CFKA 1EEQA 1FVEA 1NCBL 1PKQE 1NMBH 1D6EA 3DPBA 1AP2B 3D87B 5DEFB 3SY0B 4EUPB 4V2CB 1WV7T 4DTGL 1CFNB 1OAXL 4H25B 1EFQA 5L9DH 4LSUH 2ADIB 4I48A 1YY9C 1ITBB 4GKZA 4N68A 1HZHL 3QCUH 3BSZL 2KUTA 4UIMA 5JXED 2A6JA 5LJYH 3QT2A 1OF2A 2FD6H 1MCQA 4LCUA 3V4VL 5INDB 1S5IH 3EOAA 1AJ7H 5IG7A 3H3KA 3PHOA 4PJGA 1YPZA 1JWUB 3AGVA 4A6YA 3GSNA 5IGXH 4K94L 4QTIL 2P5WA 1CICB 2BNQD 2ZOLA 1NGQL 4N1CA 4PRNB 2JTDA 3C60B 4JB9L 3RY6A 4TNVK 1ZA6B 4JY6A 12E8H 1Y6KR 4P23C 2ED9A 2DICA 2NXYB 4HZLA 5C0AB 5F88A 4S10A 5CSZA 3BO8B 3DVGB 1AXSA 5D8JL 3ESVF 1JHLH 3S37H 4WEUD 5DVOA 4CU8A 4LDLB 5HDBE 3T65B 3KXFE 1GGBH 1J1OL 1QSFD 3OB8A 2OQJA 4F37K 1GOHA 1Q1JH 2AJVL 4GS7B 2A9MH 3EO9H 5CEZD 3ESUF 5SWQB 1DQLL 1A3LL 3QUZD 4KKLD 4RAVA 5KW9H 4ZO6A 4QXGH 4R2GD 4J3WA 3HC4H 4FQ2L 1IM9B 3QPQD 1G7MA 4Q9RH 3QA3A 4HUUA 2PYEB 1GOGA 3CK0L 4LAQL 4H1LG 2IWGA 5DVKA 3GI9L 3LKRA 4JFZH 3KLAB 4N0UE 5DT1H 2ORBH 4PJBE 5GGRA 3D3VB 3FRUA 1U92B 1A5FH 2GK0A 2IAMC 3FCTA 5IW1A 1S78C 4YXLH 4H26B 2XWBB 2IMMA 4PGBA 5E8EB 3K2UL 3QPXL 1D9KC 3S9DB 5ADPL 3AREC 4I3RL 1XGRA 5HDBF 2VDNL 1FPTL 2G2RA 4JAMA 1G9EA 5D7JB 4PRPB 2X70A 1F4AA 2VLKA 5GS0L 3VDBA 2COQA 2BX5A 2Y6SD 5FECB 1I1CA 1CDJA 2ADFH 2AK1L 3RGVD 1G7JB 1KT2A 2BRRL 4KRPB 3GHEH 1ACYL 4N8CL 2NYYC 1CL7L 3C09C 3VXOB 2YUZA 4Y19B 3FO9A 4KDVA 4HS3A 2AJ3A 4PJBF 5HVHB 1EFXB 1ITCA 2EH8L 3DGGB 1MFAL 1T5XB 4RFOH 3MA7B 5MEPA 2VLJA 1LEGB 2JKXA 2D7PA 1CGXA 3VXNB 4M9PA 3D25B 2WP3T 3DX6B 3DYMA 1QSZA 3BN9C 2I9LB 4PJGE 4ZS7H 3HE6D 3C2SA 5C09A 1N6QH 5IBLC 2JIXB 5I0ZA 4MA8H 1Q8MA 4M7KL 2ICWI 5F9JB 3WV0A 1G7PA 1IGIH 1BFVH 4JFHD 3MJ9A 2XKNB 5CBAB 1F42A 1TENA 1PYWA 4J12A 3PXJA 3TYFA 1T0MA 2IPTH 5J4MA 1Q9WA 5I74C 5T1KB 3OKLB 5KSUB 4U33A 1BD2E 3QQNA 5F7MC 4KXZH 1GRWA 2NZ9D 3CPLB 4KK8C 1LDPL 3U0PA 4MYWB 1NAML 3BJ91 4M8VA 3FONA 3SDXB 4JO3H 4KAQL 1GGYA 2WBWB 2XI9A 1JGEB 4MQTB 1JWSB 4UNUA 4QXWA 4JQVC 2AGJH 4TUJA 2VN7A 2B0SL 2DD8L 5IT2H 4PJGF 3TA3A 2UYLA 3I75A 4LASH 5GRJL 5AWNH 3GSOB 3ILQD 2FR4B 3AS1A 1NUDA 1YUHA 2V7HB 4IHOB 3QAZC 2J4WL 3NACL 2DQEH 3B8YA 1BM3L 5D93B 4QHKI 1N26A 1N0XH 2ZOKB 3GK8L 8CGTA 4GW1A 1UZ8A 4LEXL 1J0HA 3V4PH 1EAPA 4EUPH 2F53D 1WTLA 1N59B 2DIBA 1N8ZB 1NDMA 2APXA 4GRLB 4TUOA 5F7FA 1A6VH 2APVA 3HZMB 3KPLB 2Q87A 2AJXL 2FO1A 1ZA3B 1F11B 2H45A 2Z93B 4O9HH 4JRYE 1Q9KB 1CD1B 4CDGC 5FHAH 3O6MH 1HNGA 4M1DL 1ORQA 5DFWH 4RSVA 2XWJA 3NIFE 3O4LA 4JQIH 4JZJA 3LQAL 4OUOA 1GGIL 3S96B 2YHGA 4ZXBC 2ICWJ 5GRXG 3INUH 1KV3A 4LSSH 1DVFC 1VADB 1C7SA 5FOJA 3S8WA 3TH4T 4Y4FC 1T20B 1OLLA 1XGUA 1S9KC 1A7RH 3MRDB 2HVKB 5JW4M 2FB4H 4P4KB 1DUZB 1R3HA 3FN0L 2KBGA 4OI9A 2J3SA 5JQ6L 3FZUD 5E99H 3L3DB 2FIKA 4DCQB 4KKBD 1K4DA 5F1SA 3O3BB 2VLJE 4K55A 4JKMA 4PJ9B 4UAOC 2OZ4H 3OZ9L 2IALB 3GIVA 3G04B 3FTGB 3RTQC 3V5KA 4WFED 5EC1B 3WD5L 3IXAA 4R0LA 4HPYL 5J1TC 3HI6H 1WBXA 5T5NF 1UA6L 1CFBA 3TNMB 4HIXH 1LO5A 4Y5YB 1XR8A 4PS4L 1T1WA 3VRJB 1B2WH 1HYRC 2R0LH 3NIFF 2BVQA 5CILL 1IC1A 1BAFL 5IJVB 5K59E 3OWEA 4HGWA 4XCNB 1AD9A 4HDIA 3MRPB 3AM8C 5D5MA 5CEZL 35C8L 1NUGA 3E6FA 5DK2B 2ZUYA 1IC7L 3RWGA 1D5XA 1V5JA 1F90L 2JB6B 3UTTA 1BD2D 3AB0C 4XVTH 4QHKJ 1Z5LB 3OAZH 4GKSA 3IDNA 5CBEA 4D9LL 4ELMA 4KRMB 4M43L 3HUJB 3BGFB 4C4KO 3EDFA 1OGAA 1SY6A 3Q6FA 1SEQH 5FK9B 2ICES 1IGFH 1LILA 4D9RD 4P4RB 5CSGA 2LTQB 3IU3A 4EN3A 1KXTB 2DLHA 3FMGL 4L8SA 5J3HC 3VWJD 2CKBB 2LVEA 1EZVY 1A6UH 3H7BB 1DQQB 5KSAD 3DMMC 3JTSA 3HA0A 4PREA 4NO5B 2R2EB 3V0WH 3I6GB 2PW1A 3EOBB 5SWZB 5IR1B 1IEAA 5FFLA 2DTMH 4IBLT 4FQCL 3MR9A 3MOQA 3RAJL 4WIQA 1M7IB 5KSBB 3LN5B 2FO4A 5INCA 1HDMB 4Q6YA 5K59F 2FYYA 5EOCL 5CHNA 4KROD 4NZUL 2XFXB 3OGOE 2DWDB 4LSRH 1FL5A 3HCVA 1DQTA 4KDWA 2VL5A 4P5KB 4OGAD 5E6ID 3T2OA 3QQ3B 4NHCL 5L7XL 1FG2B 3NVQA 1KJ2B 3KPMB 1ORSA 3C5JA 3B9KC 3H6JA 3O6KH 4WU5B 4WW1A 5TH2A 3IFLL 3B2UD 4ODXB 4LLYB 2QSCL 4MQXD 4PD4K 3OKYA 3MJGX 5EN2B 1M6OA 4JRYD 4RWYH 4OF5A 4L29B 2GITB 4JDZB 4PBWD 4P3WA 2IPUG 4F9PA 1QYGL 4FFZH 4R6UA 4G7YH 5LVEA 4DZBB 5F9OL 1D5ZB 3O4LE 4YPGB 4LF3B 3ZYJA 5IEHB 5FF6A 1O0VA 3QI9C 4JM4H 3FJTA 5HDQH 5C0JA 4UV7H 3ZKMD 2W65A 5MERB 2HJLA 1AI1H 1RZIA 1MHHA 1OCWH 3MA9L 1L7IH 3H3PH 3QULA 3IDJA 3UYRH 1NGZA 1KLUA 4P59H 4ZSOE 4JANA 2F54E 1U8HB 4QO1A 3PF2A 1OAQH 1IBGL 1SM3H 2CIKB 3VI4E 4X7TA 4RRPA 3RDTD 4WW2B 4PUBL 3RHWF 4GBXC 1I9JL 5J12C 4Q74A 4L4JA 4BUHA 2GT9B 1S7QB 1ZT4B 2QSQA 1EEYB 4YBQD 4XP4H 4BH8B 4C58B 2CMRL 2J88L 3DTXB 4XP1H 2GSGA 4XP6L 4O2EA 4B0MM 4MJIB 3SCMD 2EZ0D 2E7HA 3DX7A 1DCLA 1KXVC 3EW3B 4CMHB 3MRLB 4OSUH 1CR9L 1J7VR 4XRCB 3MLUL 1YNLL 4OM0L 1BEYH 2IH3B 4P2CG 2ILLA 1KBGH 4K3EH 4U6HB 1C5CH 2AP2A 1NCCH 5MEQA 1NLBL 3WJJC 2BHZA 3VI4F 2ERJB 5DFTA 5IFHH 3EOTH 5L2KB 4S2SB 5T3XE 3VGHA 5CFHA 4O02H 4HAFA 1QLRB 1H3XA 1SJHB 3MROA 3T0DA 3QEQA 4LVEA 1FFQA 1YN6A 2ZCKH 4EQ2A 1RIHL 5LGKA 3GSWA 2BJMH 3VFNA 4OFYD 1CWVA 4OF0A 1ZWIA 2J8HA 3GMOB 1INDH 2HFTA 2GJ6B 4O5LL 4HSQA 4IDLA 4PRHE 3PDOB 5HYSB 4RZCB 3P4OA 1ZT1B 2V2TA 4F7CB 4C56A 2BXZA 2YOCA 1P7KA 3ARZA 3MLSL 1RUPH 4WDIB 4KHXH 5EUOE 1I8IA 1FGNH 2ICWB 4PJ8B 4W68A 4KMTH 4PRIA 3E3QE 3U7YL 5HY9B 5JLZA 1V3KA 5EBMA 3ZZ1A 3KPRE 3FN9A 1A47A 1U8NB 3NFSL 3QIUA 4I0PD 2DMCA 1UJ3C 3IDIB 1DP0A 4M7ZB 4IRJB 1T7VA 1R6VA 1Z9LA 3HRZB 2VDRL 3CVIL 2IPKB 3BKML 3MRIB 1CDCA 4G9FB 5E2WL 4UT6L 1F4YL 2Q3ZA 5DVMA 5AYUH 1CGYA 5SWSB 1Q9OA 5EC2B 2Q8AH 3ARVA 2VUYA 5E7FA 4XVSH 1W0WA 1NFDA 4JCMA 5IVOA 1AIFB 3U0TA 3QNXB 1Y0LA 3DO7B 2QKIB 3WNLA 5L2JA 3QIWA 3EYQC 1U9KA 1YEDB 4UT9H 2OS7A 3NABH 5GS2H 2YD9A 4I77H 3WFCH 3L3KB 5I8CB 1PZ5A 2F54D 3P4MB 5DZLA 4EI5C 2VQ1B 1CLZH 2YD4A 1MWAB 5AEAA 2GUOB 5HYEA 4EVNA 2FLBT 3LRHA 5CJ8A 1GZQB 1BGXL 1KIQA 5GSVA 3GMNA 2BK8A 5EUOF 3MLXL 3WUWB 1MIML 1QBLL 3Q6GL 4PJ5E 4AEIL 1AHWC 1EHNA 4QRRA 5I2IB 4YBLC 1Q94B 3LV3A 1A4JB 4D3CH 3ECBA 2DWEA 4PGDB 2K7PA 5FYJH 3SBWC 2X41A 3QJHA 3TV3H 4MXQD 3T0EC 5DJCA 2A77H 4RAUB 4YE4L 2ITDA 4MGXA 1HI6A 2Y06L 3BI9X 4EXPX 2RCSL 1INQB 4HT1L 5H2BA 2NLJA 3HG1B 4Z7UE 3CX2A 4UINH 1J05A 3UYPA 1OP5H 3N85H 4HCRL 3CUPA 3D48R 2NY2C 1JGUL 9CGTA 2FHFA 4K9EL 5IBTL 2Z91A 3QIBD 3D0VA 4B50A 3TIDB 5EZIH 1VACA 3JWOC 3QDHA 3VFUA 3A6BH 1H9VA 4ONOA 4F7PB 4FZEH 3IYLW 1E4WH 5GZND 4QRPE 5IMMB 4YUEL 3LCYA 4U7KA 4L5FH 3PP3H 4P3DB 4LHUD 3BISA 4Q6IC 4XMLH 3QEQE 4BELD 2DS4A 4YGVB 5FKAB 1MCFA 4PR5A 2UWEE 4TUKL 1Q72L 1ZK9A 1EJOH 4KUZH 4S1RH 4Y4KC 4WI3A 4JFFB 1KGCE 1P4LB 4TSAL 1T5WA 4HUWA 4PRHD 4JKPH 3MXWH 4XCYA 1PFCA 3MO1B 4YH6A 4DW2H 3LB6D 4MDJA 2E7LC 3GSXA 4YHOL 4Z7UF 2XNAA 3HC3H 4NUJA 5FA4B 3UJJH 3WO4B 4NQCA 4U1IA 2ZG1A 4JO2H 3LIZL 1K5NB 3S7GA 4N8VB 3MRJA 1H3VA 3T77A 3NMEA 4PRIE 2LAAA 1I8MA 4QRTB 2ARWA 5CEXB 3KPRD 1JI2A 4MB3A 1CBVL 2X42A 3DV4B 1J5OL 1MJ7H 1KSRA 2Z31B 4Y1AB 3BDXA 2XTLA 3LAFA 1GVIA 3OXSA 1RZKH 1M4KA 4KKAD 3DVNB 3NIDE 1NFDE 3PABA 1T3FB 5DRWB 1BZ9B 2UWEF 1TVBA 1WAAA 2X4PA 1CXHA 4ZD3H 1TZGL 4YJZL 3SGJA 3BZ4A 1T04A 1C5DA 3IGAB 3QDJA 3DI3B 2ZZUT 3BT2H 3E2HC 4JVPA 1U8KB 1OT2A 2OJZH 1XGTA 4HH8A 1J11A 5ID1B 2R15A 4GMSL 2EDOA 1U8JB 3ARFD 4FQPA 4IDJL 1EV2E 3SDCD 5IWLA 3OGCA 4KWUA 4JDVB 4PJ5D 3RZCA 5T5FL 4MAYB 3WIFA 2NXZD 2A6IB 2R0KL 3SGDI 2HKFH 1S9XA 4WY7L 3ARBD 3Q5OA 4OM1H 3F7VB 1F6FB 1RHFA 3V6FA 3MJ7B 1C7TA 4NRZB 2X9XA 1WC7A 2NZIA 3VD3A 1RURL 5FXCH 5IFJA 5FGRA 2BVOA 4OZ4B 2CD0A 3AXLA 2L4OA 4R7DA 3HMXL 5C6TL 3NIDF 1NFDF 4ZO7A 2QL1A 3S34L 4LRIA 3KPSB 4LLWB 3VGBA 1H5BB 1MOEA 4Q58C 3VRLE 1FE8L 3A6CL 3VW3H 4JDTL 2VXSL 5C8JA 2BMKA 3S35L 4R96B 3BP7A 3O45B 4MQ7A 4CVUA 1I7TB 5C92A 4FNLH 3PGCB 2XRAL 1F6AA 1IKFH 1NAMA 4W6XB 4NO3A 1Z9SA 5IOPB 5KANI 1QSEB 4AY0A 3TYGL 3MOBL 4HWBL 4CMMB 1FNEB 1OSPH 2BSED 4QRPD 3UO1L 4RRPG 5C9JB 1B9ZA 2IF7A 3RY6C 5B3NA 4IOSD 3QZWB 3T4AB 5E00B 2EYSB 2E7BA 5DDHA 3EJYD 1FVCA 1A0QH 3ULVC 5DRXB 1KGCD 5MENE 1JPGA 3BP5B 2AEQH 1HOCA 3RWCA 1WCBA 2VSCA 5HHNB 5JR1H 3D9AL 2NY0D 4WHTA 4BKLB 3W2DL 3VRLF 2IQ9L 3DURB 4U6VL 4N9GB 2RHEA 1EDQA 3DETC 4CNIB 1CGWA 4FTVB 1MELA 3FOLA 3WFHB 4MNQB 1NBVH 2IANE 4S0SD 1WT5A 3LQZB 5LGJB 4G8EB 3CVHL 3O2DL 3MLTB 4F80A 4EI6A 1X5IA 4FABH 1LHZA 1T66D 4ZDHB 5DJ8B 1Y6NR 5BXFB 1I1FB 4X6DB 1JGVL 1MHCB 1A6WH 4X4YB 2FJHA 3S98A 4LCCA 4QHNB 3CU1A 2VR5A 3F7YB 1U91B 4NYLB 3QHTC 4M93C 3KGRA 5HHOA 3QWOA 4S1QL 2ED8A 1YJDC 5GGQH 4LKCA 5DJ2B 3KS0J 3F62A 3KYNA 4DEPC 2NY6C 5JPMA 4HWZB 3HR5A 1LP9B 5DD1L 4K8RL 4XPGL 5IK3B 1BZ7B 1RK1A 1X5JA 5GJSH 1QBML 1XGPB 5EZLA 1VSCA 2F15A 1EERB 4M4PA 3KR3L 3NA9L 4NO2A 3O3DA 4DFHA 2I60L 2IMNA 1F13A 2HVJA 3OKNB 1AGDB 3REVA 1A6ZA 1RIVH 2Y23A 1ZGLP 5CJBA 3WXWL 2H3NA 5D9SB 2RAMA 1PX3A 4OB5L 2GQHA 1JVKA 4PD4J 3IFNL 3D69B 4G5ZL 3MXVH 4OZIE 1CQYA 4Z77B 2QHLA 1MCKA 3MLRL 2HN7B 3MBXH 4FQ1L 3KPQB 2EXYD 4QWWC 5AUMB 3SKJH 5IB5A 1L9NA 3QXWA 2DMKA 1S7TA 2L7JA 4DKAA 3DYPA 2D31B 2YD5A 3TBTA 4N0CC 1M71A 3C5ZD 4XNZC 1Y18B 1BPVA 3HNVL 1IL1B 1WISA 1I9EA 3B3IB 5DMIH 4DGIL 1WIUA 5BO1L 2AXFA 5T1LA 3JUZA 3FT2A 2VUOA 3MRBA 5ILTL 2XPGA 4MJ5A 1DN0A 4P2QE 5CMAB 2GCYA 5DJDB 5MEND 4F2MB 1G6VK 3MV7A 2NY4D 3FB7A 4MWFB 1J87A 1MFEH 4OZIF 4HIHB 4DVRL 2I07B 4ALAH 5D72L 1GGCH 2VLME 5CJOL 5ICYB 3W82A 1EHLL 4DKEH 2ARJA 5AG9A 2IPUK 4OZHB 2IAND 4FQIH 2NR6D 5ESQB 4HBQA 1I7RA 3TA3C 1I3RA 1U2HA 4JREB 4F58L 3WFEL 1NAKH 4RMSA 4UDUA 4M5YH 4QHUB 3P4NA 1FZMA 4XAWL 1YEJH 4W4NA 1U8MB 3P9MA 4OCXH 4GW5A 4HPOL 1EMTL 3MREB 1TIUA 4K7PY 5TDNA 3U46B 5BV7L 4DKFH 1HKFA 5HYQA 5EBLA 4ODUA 3ZE1E 2PW2A 5C0FA 1FAIL 4OV6F 3TPUB 1HQRA 1QO3A 3KYAA 1CFSA 2OR7A 1E28B 1FIEA 4KVCL 4D94A 5E1HB 1TTUA 1YZZA 3TFKD 1CGTA 4RDQG 3I9GL 3TM6A 5J11C 4RIRA 5E5MA 4NPYB 2XT1B 5I1EH 4P5MA 4YDIL 4JZJC 3ETBF 2DLFL 2EO9A 2G5BA 3PIQA 3NCYP 3G6JA 4GRWH 1G7IB 4M48L 5HHME 1MPAL 1S7RB 4O2FA 2GSIB 2ZUQB 4JM2B 5CD5D 3QBTB 1WWAX 3PWPA 5IMOB 2HTKC 2BSSA 3BJLA 3FRPA 2X09A 4J3TA 3BQUD 1HCVA 4FXKA 5BOPA 5B39A 3UXFA 5E08H 3R8QA 3CU7A 4RQQA 2H32H 3PDDA 4YHIA 4AQ1B 3U2SA 1DLHB 1LO2H 3LKSB 5DD6A 3RBSA 3ZE1F 4MCYA 5JW3H 4GSDH 1HNFA 4F7EB 5D1XD 2IH1A 2OYPA 4ZNCD 4M1GH 4X9FA 5EU5B 2BFVL 4YFDB 5IB3A 4R0LC 3VXQB 1HHGB 1PW3A 3VGAC 4U6YB 5I1LA 1SBSL 1WUNT 1RMFH 2EIZB 1MNUL 1AY1H 2XN9A 1UADC 5EOTB 3QUYB 1VCAA 4G8IA 3C5SA 4PB9H 3PL6D 3S36X 1A3RH 2Y5TB 5FYLH 1JRHL 1T21A 4CVXA 4F57H 5CJXA 4P2QD 3QG6B 5D2NA 1FORL 3CFEA 3I84A 1LD9B 1A64A 3MV7E 5F96H 1A9BB 1NC2B 5C6PB 4ZFZB 1B6UA 2XACC 4G6KH 3QO1A 1IEBB 3BGMB 5DMKA 5C0IA 4PJDE 4LCYA 1TJIL 2HJKB 4K07A 2QADC 3OX8A 2I9TB 2VLMD 3HZKA 3FQWA 4OGYH 2H1PL 3N0PB 2VLRE 1KPRA 1RU9L 2DQGL 1UM6L 3DUUB 3IJYA 2EXWC 4EN3C 1MH5A 4GQ9H 3TO4D 4QGYA 4YDLB 4NJAL 4M1CC 3TVMA 1IJ9A 5D70L 4QRQB 3X3GL 1U8IA 43CAA 4M61B 4PBVC 4YXHH 2CPCA 4Z6AT 5DUPH 2EKSB 4GJTB 5KG9A 3QDMA 4GMTH 4NC1C 1ODAA 2F5AH 4JFPA 5DRZB 4LVNB 2YK1H 4Y5XA 4HUVB 2WWKO 5ACLA 3QAZB 1JZ8A 1U3HC 1LGVA 2R4RH 1UYWL 4NQDA 4PRBB 2A83B 4IJ3B 2VXUH 4PJDF 2JJUA 2DQUL 2RGSA 1FGVL 1DQML 2ICEA 3WNPA 3P73B 1K2DB 1N64H 3RHWK 1FIGL 4GXVL 2HMID 5IM7B 5FCUH 4HXBH 2OL3H 1UZ6E 2Q86A 5IBUB 2C1OA 4PJEA 4ZAKB 3HLAA 4F9PC 3S36H 1I8LA 5ANMB 3HNSH 4WO4A 1A4KB 3FKUS 4HKXA 3NCYS 1ZLUK 3REWB 5HHMD 3HC0B 3QNYB 5HYFA 4LLUB 5FCSH 3UZEA 3PWPE 4HJJL 1X7QA 2JELH 3CJJA 4WUKH 5JW5A 2X1XR 2CDEB 1LK3L 1KEGL 2V5MA 3HB3C 4NZRH 5TE6H 4P99A 2I25N 1IILE 2QQKH 1DVFB 2YPLB 4M7JL 2R56L 1FBIL 3VXSA 3K0WA 1B90A 2EDKA 4YHLH 1T2QL 5HI5C 5K9JL 3QFJE 1FNFA 3GMQA 3U0WL 4HCRA 5BZWB 3EYSL 4OKDA 1DQJB 1NGPL 1UZ6F 1P7QB 2XN9E 3QEHA 4U0QB 3KLDA 3RTQB 1AR1C 5JXAL 4Y2DA 4JZNB 5CIPH 4LSVL 1G0DA 3H0TA 4L8CA 4KJQC 3MACH 5D7LD 5D7SH 5I1GH 4ZFFB 5JHDE 4BSJA 4NOFA 3OF6A 4RGOL 4BQCA 2EKJA 3SDAA 2W1NA 4PRAB 1KJVB 5C0DB 5GRWA 1WWBX 1A6TB 2X89D 5MEOA 1MHEA 2VLRD 4WUUB 1RFDL 3AB0B 1S7WB 3K80A 5FM5O 4LP5A 4LCIL 1ZGLM 1S9WB 4TPRL 4DWHA 3LRSA 3ARGD 3QUXB 2ESVD 3OKDB 4H20H 3A67H 1ES0B 1I3UA 4X9HA 2C26A 2ICCA 3DX8B 3T3PE 5DMGC 1H8SA 4UU9A 1N6UA 2PXYB 2P8LB 4HFWB 3L95A 4DGYL 4ZTOL 2P7TA 3VXUA 1PAMA 3QDGE 1LK2B 5L0QB 1HSAB 4QXTB 2V2XB 2H9GB 1KXQE 3UC0L 3IU4H 1NCNA 3KYOB 3RDTA 4K7PL 4U6TA 3KPNA 4QHLB 3JV4B 1CDYA 3PWVA 5DHYB 5D1ZA 5E24E 4J6RH 3B9KB 5T3ZL 5DMJB 3VXMB 5C2UB 4OZFH 3B8SA 3B5GA 3MRRB 4XZUB 4ORGA 4YHNB 3QIUC 4ZUWA 1IAIL 5BW7A 4NZDA 4L4VB 4OLUH 2F19L 3JTTB 5GZOD 3FQRB 3CZFB 5IUSA 4HS8L 2W07A 3T3PF 1HILA 5GQBA 1XIWD 4PJIE 4WWKB 2C3VB 3L1OL 1JK8B 2C5DC 3BKYL 5HGAB 5HGGS 2UUDH 4CN6A 3GRWH 3SGEI 4PTTA 4NBYB 4JN1L 4RMQA 3S97C 3NPZB 5FM8A 3QIWC 2FJGB 4R4NC 3UJIL 3DRQA 3EDKA 3VXSE 2H6PA 4NT6B 15C8L 3IDMA 1ZEAL 3O6FB 1AFVH 3HMXA 3WBDA 4CW1A 3FT4B 5J6HB 4JFDB 1KNOA 3QFJD 1A1NA 3IT8D 3TT1H 2AABL 2D7TL 4P2RA 2P8MA 5H94A 3SJVB 3H42L 3HZYB 3WKML 4ODTL 3WYRA 3SDDA 1B0RA 4DZ8B 4DOHB 4KGLA 2X7LA 5ERWB 1W0VA 3FO1B 4HWBA 3FQTA 4PJIF 1WICA 2IADB 5JO5A 2Y4SA 1VGEH 5IHBA 3TO2A 4PB0H 1ACZA 2FEEL 1EHAA 5DFVC 3FRPG 1T6VN 1LE5B 5B39G 4PJHE 1SBBA 3WHE0 2FGWL 5DI8B 4LPTA 4JR9H 4M6NH 4H8WL 1JHTB 1YEIL 4P5TD 4NQED 4HIJA 4I18A 1WGOA 4U3CA 2VXTL 4L3EA 2WUBH 1JPTH 3FFCE 4TSCL 3ROLA 1A1MA 4QYOB 1NFIB 1YMMB 1OLZA 4AIZA 1LNUB 4GUPA 3QH3B 4ZFOB 5ETUB 5DD5L 3STLB 3C8KA 4F3FB 5F89B 2XTJE 3O3UN 3AU1A 2DLGA 1QA9B 1R5VB 4OJFH 2E27L 3CVHA 2J1KA 1G6RL 3GSRB 2BNQB 3QDGD 3MOAH 1WBZB 2OR9H 2AW2A 32C2A 5E94A 1CE1H 2EIBA 4XWOD 5GGTH 3L9RB 3VWKD 3CFJA 1MJJB 1RUAL 2FX9H 2R29H 2EDYA 1T1XB 4CDHA 3T09A 3P4LA 2VLLA 2CJUH 4PJHF 1KCKA 1VPOL 5FO8A 1FN4A 3GKZA 4ENEC 2HFFA 5TDPA 4LAJH 3RI5F 3QJFB 2EDDA 3NFNA 4FFVD 2IG2H 4NKMA 4RGNC 3KNBA 5TDOB 1JGDA 3QXAA 2GFBB 5TFSL 5BMFH 3RNKB 4N0YL 3N9GL 4EIZC 1NPUA 3KJ4C 2G9HB 3D18B 3MGOB 2EDWA 5IV2A 3X11A 5GS0C 4PLJD 1KN4H 2P42B 4R2GB 3VFVA 2CLZA 2ZNWA 4NKDB 1NCWH 4RFEB 1S3KL 1TETH 1X5AA 1SYSA 3VG9C 1CT8A 4F8TA 3A0OA 3O8XD 3SGJC 3TN0B 3QHZL 2HLAB 1FFNA 1AO7A 2ZNXA 3CDGA 2VDML 5IB2B 2DQJH 4X6CE 3LEYH 5EIVA 4HJGB 1BFOA 5IWLC 3U4EA 3C60D 2BSRA 3RZCC 3BN3B 4KKCD 3JWDL 4DVBA 3ARQA 2KKQA 1OTTC 1XCTA 3D0LA 1UENA 5E9DE 4HKBA 1GL4B 2OMNA 4N0FA 4G6AD 1BQLL 1K8DB 3K1DA 2Z92A 2IFGA 4JHAL 1HSBB 2NXYD 3UAJD 2C1PA 3BKJL 2EYRA 5EDXA 3QP3A 4NUGL 1LO0L 4EKXA 4D0CB 1L7TH 1NCDL 3CD4A 4HIEA 4GAYA 3MMEA 4PJXA 4JCLA 1MLCB 1PKQB 1BHGA 2EIEA 5DZOA 1ED3A 5FUOH 3RGVB 1IMHC 4LRIC 4HW6A 3U82B 3FB5B 1ZHNA 5J13B 5EBGA 2XKUA 3O81A 4LCWA 4C83A 2EC8A 3ARDA 2DI8A 3BPNC 5C0CA 4XBEL 1AQDA 1Q1JL 4XMKL 3EYUH 5BRZB 3OQ3B 4X6CF 4YAQB 4BFIB 4OKVA 1AE6L 2N4IA 4V2BA 1DEDA 3GJFA 3FFCD 3ULUL 4U1JB 4MXWL 2CIIB 4Q9RL 3SQOH 5EULV 3P0YH 4M3KB 1CF8H 3W9DA 2XTJD 1AQKL 1WFOA 3HE6B 4AMKL 1BOGA 3O0RL 1OP3K 5JZ7D 3HMWL 2ORBL 4UV4H 3MBEA 3J7HA 3OKMA 4MX7A 3UTSA 1HHJA 4EOWH 5I76B 4Q6IB 3BIKA 4YXLL 5DTFA 3GHBH 3IJHA 3JV6B 5IVZA 4U49A 1MREL 3UPRB 5D7JD 3SE9H 1ZLSL 2F5BL 4U31A 1BQHB 1F8TL 4Y4KB 4XPAL 4XXCA 3SO3B 2DJ4A 2FDBP 3V0VB 3MCLL 1JWMA 5K9QI 1EXUA 4F33A 3ARBA 2PYFA 5KSVB 3WLWD 4I4WA 1WT5C 3EFDH 1XR9A 2CLVA 3KXFB 1DBJH 3RNQB 3OHXA 3RWFB 5LBSL 3D6GA 5HPOA 1I85A 3QUML 5FYKH 4QRSB 1HHKB 4JFXA 3UZVB 3LKPB 1RHHA 1S7UA 4LCCC 4HK0A 4PG9A 4RA0C 3LQAC 5I15H 3H9HA 3MODL 5IMKA 2FBJL 4DQOL 3QO0A 5ABDE 4ZUTA 1BP3B 1TCMA 4N0UB 4PLKC 5J57B 3ET9F 1E6OH 5GSRA 4ODVH 4PJBB 4R3SA 5DJYB 4OT1H 3ZDZE 2YWYA 4HS6A 3DUSB 1JF1B 3LEVL 2Z0BA 4ZNEE 1T22A 1IEHA 1QFWL 4Z0XA 3U30B 1LEIB 4MD0B 3HFMH 4LP4A 4F15C 4YQXH 1FL3B 3VI3E 3OR7A 1E27A 5ISZA 5E9DD 1BVLB 2A6DB 2DQHH 5ESVB 1FNHA 3AROA 3CFIC 3MYJB 5HYJA 4Z95H 5T1KD 5HGDB 2NX5A 4G3YL 3WHXA 3RWDB 1KB5L 2DYPD 4Z76B 3RPIB 4BFBD 3ZE0E 4K23H 1B4JH 4G6ML 3OJDB 3X13A 3NZ8A 2CRMA 4MAUH 4AG4H 2AXJA 4H1LH 4MS8D 4J2XA 1YYLL 1RUKL 1ZV5A 4GKNB 3SKMA 5I30H 5GRUL 3L5HA 3QUZC 5IMLB 4ERSL 4LGRB 3X3FH 1CZ8L 5FYJE 4FQHA 3ZDZF 3QPQC 4LMQE 3FHQA 3MV8E 2HTLD 2C9AA 5EU4A 2VZSA 1YECL 3M1BA 3VFTB 5KVDL 4HEME 5I1AA 3UBXA 3GKWH 3VFMA 1OF2B 3OKOA 4R7NA 4LCUB 5AWNL 4KRNA 1KIPA 2V2WA 3VI3F 4M6MH 1CLYL 4ONFL 2X4TA 4AL8H 3Q3GA 3RWIB 2FX8H 1YPZB 1JTOA 4PJGB 2DLIA 1LO3H 1S7VA 1SJEA 3ARXA 3EO1A 2GTWA 1NGWB 5LWYL 2ZOLB 1KTLA 3UTSE 3T3ME 2PF6A 3DARA 3ZE0F 3HUJF 4ZUVB 3RVUD 43C9B 3TPKA 3WSQH 2AJSL 2CUHA 2HRLA 2QQLH 3SKNA 4QGTA 1OP9A 3MLVL 4CVWA 4AEHH 3QEGH 4TOYH 1BD2B 4HZLB 4P46D 2J6EL 2D03H 3C6LD 3TZVA 4FQJL 3WFBH 3AMKA 3MC0A 4GLRH 1AXSB 3H9SA 5GS1A 4YC2C 4GAGL 1RJYA 3RX7A 3VGFA 3RUGA 1BOYA 3IETA 2XA8H 5EZOH 5CGMA 3PQYE 5HHVH 1KPUB 3LS4L 3VWJB 1T4KA 4FOMA 5BS0A 4NRYA 1GPOH 4ZYKA 5KSAB 4OF8A 4O58L 4NKIH 1CVRA 5DURB 1GHFH 4PJ9D 3T3MF 3F58L 5IJKA 3QCVH 3OL2A 3QWRA 4IS6A 3FB8A 1TPXC 4U1GC 1FC2D 1JNLL 5GGRB 3ES6B 3FRUB 2GK0B 1QZ1A 5IW1B 2NY5L 3WE6A 4GG6A 3GBMH 2BNRE 3MFGB 3U4AA 4Q2ZB 1T7WA 4G7VL 4PGBB 1HINH 3MPCA 4N1EA 3WXVH 1HXMA 4DEPB 4WEBL 4BQBA 4JFYA 3SGKA 2NY1C 1EPFA 2YRZA 4KC3B 4JRYB 1MAKA 4JAMB 4UUJA 3IS1X 1MRCH 1JV5A 2VLKB 2Q6WA 3U48A 4URTB 3CFDA 5EU3A 3V6OE 2BXYA 4LPVA 3JWOH 1YEFH 1JYWA 1KCUH 1V7NH 3L3GB 1E4XL 3ZHKA 3JV0A 2X1PA 1EVUA 1KT2B 1AGCA 1RI8A 5DUBB 3PWNA 4LSPL 1WIOA 1T7ZA 1KB9K 1ONQA 3CC5A 5FYJD 3SKOB 2AJ3B 4OLXH 2F58H 1TCRA 3MV8D 1CFTA 3VXPA 4U1MA 2VABA 1S7SA 4FFYL 1HHIA 4MSWA 1F4XL 2W38A 4J4PA 2X4OA 4X4XA 2VZUA 1LVEA 4NQVA 3OSKA 1YEGH 5MEPB 2VLJB 5D7IA 1RPQA 4IRSB 5J06A 1KCVL 5HXMA 3WLBA 1K3ZA 5CJ5A 3PWJB 2XZAH 2Y72A 2X5PA 1CDIA 5HHQA 1FH5L 3SOBH 5CJXC 4MNHA 1ZGLA 1NCAL 4ODWA 5D2NC 5LCVL 3W11C 6FABH 5DD3L 3LH2L 3I3EA 4KJWD 3RIAF 3BXNB 2OK0L 1PYWB 3TF7C 4KZDL 5JDSA 3LHPH 3TYFB 5FGSA 1CVSC 4OD2A 2OBGA 4KJPC 3SCMB 5D1QA 1GC1L 5DHVH 3H9SE 1OAYL 3P3YA 3TVMC 3FONB 4QKXB 4U1LA 1J0JA 5B22A 1IGML 5B4MC 2GY5A 3CLFL 4JPKL 4G9FE 4NFBA 3ZT5A 3PQYD 1CK0L 5C86A 5FKPA 2V9QA 4BSWB 5BS0E 4OLYH 3OKEA 3MUJA 5C0GA 2QSVA 3K7UA 3TA3B 1CD0A 4YDVA 3I75B 3W39A 2AXHA 3EYFA 3ZL4L 4Y5XC 4OUUB 4QF1A 4RAHA 3PGFL 1UH3A 5IESH 1VENA 5AG8A 2MOVA 5C08A 3RA7H 3MJ8A 1YDPA 1UXWB 4LBEA 3GMPA 3B9EA 4GW1B 4XXDB 2BNRD 2W0PA 1EAPB 1T7XA 2X4SB 2J8UA 3PL6A 3SHSA 1G7HB 3FL7A 4NZTH 2W60A 5IP4A 4TUOB 5F9AC 5L88L 1I8LC 4JRXE 4HKJA 4PJ7A 1WVZA 3SKUD 4MA3A 3BRFA 3RL2B 1PG7W 1FL6B 2OP4H 1KACB 3T0BA 4MDIB 1ORQB 4BH7A 2E5EA