3G04A

Crystal structure of the tsh receptor in complex with a thyroid-stimulating autoantibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
212
Chain Sequence
LTVLTQPPSVSGAPRQRVTISCSGNSSNIGNNAVNWYQQLPGKAPKLLIYYDDQLPSGVSDRFSGSRSGTSASLAIRGLQSEDEADYYCTSWDDSLDSQLFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HUMAN THYROID STIMULATING AUTOANTIBODY M22 LIGHT CHAIN
publication title Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2009-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04A01
5HGAA 1SJXA 4MLSA 4FG6C 1AO7A 1IGTB 3L9RB 3JUZA 2ERJC 3R0NA 1M71B 4G9FD 4G9FA 4MLIA 3B9VA 5JA8B 5AYUH 1F4HA 3QUKB 5D7KD 1EEYB 5DURD 5KTEH 3QXAB 2DIAA 2VAJA 2FECI 1FO0L 4TTGA 3DUSB 5LWYL 3MV8B 3BEVB 1I3UA 3NMEA 3ARFB 2V2WA 4ELKA 1DANU 2VL4A 3PDOA 4C56E 3FQTA 5F44A 2ED8A 2OZ4L 5FECA 4I0PB 1UCBL 2GYSA 2VLMD 5DMKA 5E95B 3OGOE 2I26N 2E9WA 3E2HC 1KELL 4D9LL 4M48H 4FQXD 4FQXA 4FQPA 5C7XL 2EEDA 1IM3B 4UDUA 2X1OA 1VEOA 4KUZL 1LNUB 2N56A 3HI1A 5C07D 1IBGH 4UDTA 4WEUD 2D7OA 1I4FA 4KRPD 1A4KA 4FMKA 3T4AB 3KLHC 4BUHA 3DECA 5CUSL 4U1MA 5JQHC 1EH9A 5BZDA 3X3GH 1A4JB 5FXCH 1D5ZA 4NZRH 4U1SB 4FMFA 1KPRA 3ARZA 3GGWB 1Z9LA 3G6JF 3ET9F 1NPUA 5IW6B 2Z92B 2DWDA 4GAYA 3F58H 4MQXD 3FT4B 1CXIA 1VFAB 3H42L 4ZD3H 2ATPB 4OZFG 1I8LA 2DM2A 4WDIB 1ZS8A 4L3ED 5BS0B 5I0DA 3W5MA 3V0WL 3OZ9H 5IQ9B 4GRWB 2GUOA 3MRPA 1OAZL 3CUPA 4CAGA 1ZLWK 2J7LA 3MROA 1S78C 2BNQE 1A6AB 1EJ6A 2XZQL 1PZ5B 2HG5A 4O58L 1J1OL 3QFJA 2JELL 4PJBF 1UC6A 1ZGLP 4P23B 2XICA 5IUSA 1D5IH 4P9HH 1TZHA 5DDHA 4ZFOB 3QXDA 5FYJU 5BV7H 1FJ1A 1X5GA 2COQA 1UVQB 3WS6A 3U30C 2XN9B 2VLLB 5ICYA 3DO7A 3L5XL 4MSWA 3GIVB 1BQUA 1RURL 4NBXB 2OZ4A 5H2BA 4N90D 1TPXB 1NGQH 3RNQA 1FO0H 3VXMD 3MSPA 5I8EB 3VXMA 3ILQD 3DV6A 5FB8B 4A6YH 4JFDB 3CFBA 3H3PL 4M61A 2C3XA 3OPZH 1EFXD 4I18C 3G5VB 3RY6A 3HI6L 1XF2A 4CMMA 2HRPL 1YEFH 4X6CF 3OSKA 1F4WL 4JG0L 1UCBH 4PP1C 4QRPA 4QRPD 3VXUE 1UXSB 4MXQD 2X4RA 2GSIA 1KELH 3NCFB 1B9ZA 4HHAA 4QT5A 1TETL 2EZ0D 1BVZA 2H2SC 5DUML 1J88A 3KXFB 1SY6L 4OF7A 5HHME 3PF2A 2A74B 1U8MA 4PBVC 5FKPB 2DDQL 2PO6D 2PO6A 2JK5B 4O2CB 1IGTA 3RVXD 4G9DB 1I8KB 4MB4A 2Q87A 2CPCA 3SE8L 2NLJA 1G1YA 4JDTH 5KW9L 4HPYL 5TH2B 1J87A 2QADB 1OPGH 2Z91B 1P84J 3WIFA 2YD3A 3O6LL 5B22A 1MY5A 4GRLD 4ZYKA 1R3IH 1CLYL 3Q1SH 4NQSB 5E7FA 4TNVK 3WFDL 3DUSA 5HDQH 2DLFH 3DBXA 3MV8A 3JSSA 3R4DA 4RQQB 2QBWA 3MRDB 5CSZB 1X5HA 4Z7OE 1HCFX 4CU8A 1B0RB 1FZJB 1QPXA 1A6UH 3RVWD 3UAJC 3T4YB 4I0PA 2WWMD 3S35L 4JPKH 4NP4L 4NCDA 1OAZH 1DR9A 4Z76A 1IEBB 1ORSA 4NWUH 2YRLA 4X8JA 2B0SL 5ENWA 2XRAH 4ZTOL 1J1OH 1BQHB 4GRWF 5HYSG 3D85D 3D85A 1H15A 4X5XB 3VH8A 3UTSD 3UTSA 1FCCA 1XIWC 1ZHNB 2EYSB 5BXFB 3PGCB 4OF3A 3X12B 1KLUA 1JFQL 1KG0A 3L5WB 1QYGL 3T4AA 4F33B 1QR1A 1U93B 4GMSH 4PGBA 5I1KL 4ZUWB 5E2TH 2ICWI 3L5XH 4KDWA 1QLEL 3OBAA 2NNAB 5DO2C 3PWPE 2Z8VC 3B9KD 3B9KA 4U1SA 1JRHI 3ES6B 4XCEB 1O0VA 5CZXD 3GGWA 4NSKA 2HTKC 5IW6A 5K9KA 1NGXA 2VL5B 3H3PH 3A67H 4LRIC 5F7FA 4LDLB 4XNZC 4NKOA 4LIQE 2HN7A 4LAQH 4AH2B 3W0WE 1N3NA 3LD8B 4JG0H 1F4WH 1LD9A 5F88B 3BOVA 2NY6C 5I1AB 3N1FC 1DVFB 2EE6A 5C08D 3QQ3B 5DZLA 1HSBB 2VDRL 1BEYL 4LKXB 1A6AA 2VDNL 4W68A 4WRLA 1SY6H 1U8QB 3CX2A 4H0GA 4P23A 1WFNA 3WNOA 3BIBX 1Q72L 4PJ7B 4QOKE 3V5DB 1I9RL 3MLVL 4ZFOA 3HMWH 4JQXA 3TPUB 1E4XL 3SE8H 2HJKA 1AP2B 4UTAL 2ICCA 4KMTL 4HT1L 1T1XB 3P9MB 2R29L 5EO9B 4OIIH 4NQTA 2VLLA 5CD5C 5T3ZL 3ZKND 1KCLA 3BDYH 3KR3H 2JIXB 1V7NH 2PYFB 3OKLB 3SDXB 5MERA 3MRBB 3O6LH 4L9LB 4X98B 1HH9B 1CLYH 3L7EB 4S2SA 4CN4A 4WW1B 4Y16B 5FB8A 4YX2L 3QDJD 3QDJA 3MACH 4JFDA 4KK6D 3ZYIA 4L8CA 2FO1A 1YEJL 1CGVA 1ZVYA 3PQYA 3HE7C 4G7VH 4LPYA 4Y4FC 3PWVB 1LQSR 3Q6GL 5C6TH 1INEL 2V5SA 1AJ7H 2VSDA 3LB6D 3RIAF 4HZLA 1UXSA 2A6DA 4EN3D 3SGDI 2B0SH 3S96A 2NY2B 4RMQA 2CDFB 4ZOCA 2X1WL 4P5KB 3N1MC 4DTGH 3V0VA 1QFHA 4M93C 4LHUB 3WHE0 3VFOB 3O0RL 1QO3B 1U3HC 2A74A 1G9MC 1D6VL 4NHCL 1QYGH 2BJML 5SV4A 2JK5A 1EEQA 3X11B 4O2CA 4FNLH 1CFTB 3MRFA 1FH5L 1QOKA 1KIRA 3GHBL 1QLEH 1QSVA 1ED3B 3CDGB 1S7QB 5IWLA 4MNGE 4PJEB 3GKZA 4NHUB 4X99B 1IAKA 3TZVC 2BOBB 4TUKL 2X40A 1K9TA 3TBWB 5I1IH 1JTTA 5IHBA 4NQSA 3C5JB 5CSZA 5T1MB 4YDJB 1FZJA 4G42B 3ARBD 4OLWL 4L8BA 2R4SL 2NY3B 3WFCL 3TT3H 5F9WB 2BVPB 5I1EH 3B6SB 1IEBA 1AGBA 1EMTH 3TPKA 4OM1L 1BQHA 3Q6FB 4C55A 1DQQA 1E6JL 4X5XA 4DFHA 5I8OH 2W91A 4KPHH 5T3ZD 3MJ6A 5IVXA 3FB8B 1ZHNA 3EHBD 3PGCA 3MLVH 2MSPA 3B8SA 3O4OC 1E4XH 1WSST 4Z7NF 3L5WA 5E6IB 4J6RL 3HR6A 1BX2B 4FQIH 3WEXA 4PYHA 4HT1H 3O45B 2VDOH 4ZUWA 4ODXB 1K3ZA 1MCOH 2X4SB 2FHBA 4Y5XA 4YPGB 1QSEB 4P4KC 2AK4E 5D2LB 4XCEA 3UYRL 3RU8L 3EO1B 5B4MD 1RUMH 3VW3L 4P2OB 4U1NA 2NXYC 5DRWB 5L7XL 3LDBC 3SDXF 1K4DB 5DA0B 2E27L 3IKCB 5TE4L 4L8SC 3E0GA 2V2TB 2ZCKL 3SKOB 4P2YA 1OF2B 2EDQA 5AD0A 4AH2A 4S1QL 2F5BH 4RZCB 4HH9A 1KCVH 1FYHB 3QDGE 3TESA 4XAWL 3LKRB 2WBKA 4OCLC 1X3DA 1OL0A 1MCLA 1DVFA 3FQWB 4IMLB 1CDBA 4LASH 4ODHH 1GC1H 2X7LA 4PLNC 1UM5L 4UOW0 4BZYA 2XA8L 1U8QA 4PJGF 2YEZA 3UTTE 4W6YB 2BVQA 3TYFA 1D6VH 2IPTL 4PJ7A 1MJ8L 3OXRB 4OCMC 3V5DA 2P8MA 1RZKC 1WGOA 5CSGA 3TPUA 3NN8B 4KDTA 5JIHA 1AP2A 3LV3B 4UV4H 12E8L 1T1XA 3P9MA 3F5WA 1NGZB 5EO9A 5DMGD 1T3FB 4RISL 4PUBL 2JIXA 2XY1A 1X5AA 1CK0H 3OKLA 3SDXA 5KSAB 3QJFA 4L9LA 3NTCL 4X98A 1HH9A 4HBQA 3OF6D 3OF6A 4JR9L 4LGPB 3L7EA 5EWIL 4PJEF 1G6RB 2G60L 4NQUA 4NZDA 5D4QA 1YDPB 4WW1A 4Y16A 4HX1B 1FL6B 3GSWA 5I30L 1BLNB 1OLLA 4R4FL 3CCHA 3VRLE 4OLWH 2IBGA 3PWVA 2R4SH 5DR5L 4Z7QF 1G9NC 3VMNA 1N8ZB 3OKNB 1UH2A 3GMNA 4X4ZA 4Z77B 4LVNB 4LVEA 4MNQD 4X7SL 2BX5A 4F9PA 1B4JL 4ODBD 4KK8D 1P4BL 3UPRB 5CAYB 4DGIH 2X4OB 3DVGB 4R4ND 4OM1H 4EI5B 2WINA 4PGEA 2BXZA 1E6JH 5EA0L 4L8DA 4KJWC 5C09B 3EDJA 4FABL 4LHUA 1UEMA 3O9WD 3VFOA 5D7LD 5EBWB 5T1KB 4FRWA 3T1WA 4DVRL 1FNFA 1PKQB 4WTZG 3CVIL 4LSQH 1CFTA 4UILH 4W4NA 3DRQB 5E5RB 3T3ME 1EXUB 1E6OH 4RFNB 1ED3A 5JUEL 3SOBH 4BH7B 3C8KA 3NIFF 4PJEA 1T89C 3FRUB 5GS1A 1F11A 2XNAA 3TBWA 4AENA 4JANA 3U46A 2E27H 1FNEB 1FZOB 2ZUTA 2ZCKH 3JWDC 1OGAD 1OGAA 2MWCA 3HR5A 3L3HB 3MV9B 3QI9B 5EOTB 1QFPA 5ISZB 3M17A 4S1QH 3BZDA 1QSFB 3HLAB 2DYPB 4ZAKD 5ACLA 1MRFH 2OSLB 5HPMA 5TE7L 3QCUL 3QWQB 2BVPA 4N0UB 3B6SA 4IRSC 4R3SA 3LRHA 4Z7VB 5MEQA 1UM5H 3Q6FA 3AC0A 2W0FB 1AE6H 1B88A 1TVDA 3MNWB 3SE9L 5J3HD 3HI5L 4Q7DA 4UU9B 1MJ8H 4J4PA 3QIUA 4Y4HC 3ZE0F 3JTSB 1BX2A 3SEPA 1WFUA 5TDOB 4ODXA 1A2YB 3ULVL 2X4SA 2WBJC 4RISH 1HDMB 3IDGB 4YPGA 1UJTA 1GOHA 3NFPB 3RX7A 5D2LA 1JNNH 4Y5YC 4HKZB 1H3GA 1URLA 4MXVF 1BWMA 1IAIM 4BELD 1YN7A 3U36A 1K4DA 4OZIE 4YUEL 5I30H 1I1RA 3SKOA 5E56A 1OF2A 1NLBL 2XKNA 3N9GH 4RZCA 3BPLB 5E99H 3LKRA 4G5ZL 4NOBA 1BMGA 4WI5A 3FQWA 5F6IC 1P4BH 5IHZB 5IB3A 3THMH 5T3XH 4GXUN 1DBKL 5E5MA 5EA0H 4UINH 2MQCA 4QGYA 4PD4K 3SDCC 4NBYB 1BBJA 5MENB 1ADQL 5HGHB 1HXMA 4GW1B 1V3LA 3HKFA 3CVIH 5J7CC 1S9VA 5DFTA 3RHWK 2Y36H 1AGCA 4HCRH 4OM0L 2IMNA 3LV3A 5ID1A 1NGZA 1XGYH 4DN4L 4MVBC 3KPSE 2WBWB 2CDGB 2H2PC 5BVJA 2EYTB 1NJ9B 2UUDH 4PRIE 1TJGH 4LU5H 4P4RB 1IC7H 3MR9A 1G7MB 1YDPA 3QYCA 4LDEB 1NCWH 3SDAC 3WXVL 3MFFB 4DQOL 4OQ1A 4M7LT 1FL6A 3L1OH 1HWHB 4EJ1C 1BLNA 4HUVB 2MHAB 1FBIH 4Z0XB 2QQKL 5FDYA 3GSVB 1N8ZA 3OKNA 6CGTA 4OFVA 3IFPB 3U0PA 3HZYB 2AJZB 1KXQE 1RZ7L 4PRNB 5L8LB 4WUUB 3UPRA 4B5EA 1LP9A 3KPMA 3GSUB 4PJAB 3FN9A 1KJ2L 4Z7VF 4PGJA 4QRRD 5T1KA 2B2XH 3P4MB 4U1LB 1CD8A 1B0GB 4D8PA 5KZCD 1AGEB 1QTYT 4XNXL 1BQLH 2KPNA 2BNUA 3VFPB 2F8VA 1EXUA 4KKLC 1IILE 3VGHA 2DQJH 2F54B 3ALPA 3SJVB 1J86A 3HNTL 3MOBL 3KJ6L 2P5WD 3P4OB 1FNEA 3LRGA 1CI5A 3ZTJG 3S9DB 1LE9A 3MV9A 5EOTA 4NC1E 4Y2DD 3HLAA 3RVUD 1VB9A 1T0NB 3FAWA 3TYGH 3CC5A 1D7FA 2EDXA 4G5ZH 1MEXH 3QO1B 3K2UL 4I1NB 1UJ3B 2PYEB 4WFEE 4O2FB 3BP6B 4N0UA 4J3XA 1NBYB 1RK1A 4JDVB 3QAZC 4LLMB 5DHVH 2R69H 1SJHB 2B4CC 3T0EB 3MNWA 1JI1A 4JRYE 1ADQH 2YZ1A 4UOJA 3L3JB 1KC5H 4PJ8D 1JGLL 4JM2D 2AJSL 3VFUB 1WZ1L 3D2UD 5TDOA 4NFDA 3X3FL 5D1XA 4HD9A 4JREC 1HDMA 4YDKL 2OL3L 2PXYC 3GJFH 4PV8B 4P9MH 7FABH 3T0BA 1IKFH 1EAPB 3MQIA 1FFQA 1UB5B 1DL7H 4XNYH 4F7PA 3I02B 3MBEC 2ICEA 4G6AC 1UGNA 1CF8L 2H32B 1DQDL 3VG0L 3AS0A 4AEEA 3LVEA 4P3WA 4U7KA 2QQKH 3BHBA 4JY4B 4X7DC 4P57B 3WCYA 4L4VD 4OGYH 4XGZB 1RZ7H 5DFVD 2V2XB 1FVDA 2Y72A 5DD5L 2B1HH 1IGCH 3ZDZE 5GRYA 5FCSH 4ZODA 1S7SB 3CU1A 1YZZA 3OHXB 3UTQB 1MHCA 1KJ2H 5D6CB 4YHZL 4TULH 1IAOA 2F74B 5B8CA 1P5UA 1MHEB 1MCEA 5TF1L 3WDJA 4HV8A 4PJAF 1IE5A 1PYWA 1CLZH 3OAYH 4XNXH 2VUYA 1WTLA 2IANA 2CDEA 3MRRB 3DVNB 1XCTB 5MI0C 3U48A 1LO2L 2R1XA 1N6VA 2ARJB 5F7DB 2CKBL 2HLFC 3VXRE 3E1F1 2GTWB 4M7JL 2P8LA 4GW5B 1PSKL 1Y6NR 1WFTA 2YMXH 3MOBH 4BQCA 5F7HA 4YLQT 2E9IA 5EU5B 4P4RA 5DRZB 3SN6N 5D71L 3I3BA 3B43A 5E2JA 3BD3A 4HUVA 4BSWB 4OCNC 1N64L 5TJWK 4NQCE 4Z0XA 1VKXB 3UJJL 3GSVA 4JO2H 4F8TA 5K9OA 5B3JE 3RP1A 3E8UH 3IFPA 1ACYL 2NY7H 4PRAB 3HZYA 2AJZA 2C7UB 4R8WL 3VXOA 3WD5L 1KLGA 1YY8A 4Z7UB 3GSUA 4OLUH 2XIDA 3U2SA 4U6TA 4AEHL 3RGVC 3EOTL 1FYTA 2ESVA 3O6FB 1B0GA 4GAJH 2AJSH 3ARUA 1WZ1H 1NBQA 3C60B 3KPRD 1PBYA 2ID5A 4ISVB 5K9QG 2NZ9D 2DQDH 3TLRA 4OAWA 1CLCA 2F54A 4PJDA 2OL3H 4Z7OF 4APQD 3EFDH 1PG7H 3MLWL 1DLHB 1QBML 1EX0A 3PDGA 3N06B 3V9FA 1H3VA 4IOSD 3LN4B 4JFEB 4XAKD 2BNRB 3PWJA 1ZT1A 3BWUC 2DQGL 4AL8H 3QZWB 1UYWL 4HIIA 1NCAL 1BFSA 4XZUB 4LCCC 4HW6A 3RWDB 4Z7WE 5C0BE 4IMKC 1A6PA 1T0NA 1DBAL 3MLSL 5DQ9A 3TM6A 2OQJB 4AIXA 3QO1A 4DK3A 5I0ZA 1RIUL 3MLRL 3BP6A 3C5ZD 4NGHH 4KZEL 1YPZB 4MJIE 4M9OA 1I1AC 2UVEA 1X4YA 1IGYB 4LLMA 1MRDL 2CKBA 4ENED 2FJGB 1D5XB 1SJHA 3QNYB 1I7TB 4ZFZA 3T0EA 1GGTA 1HSAA 1G7QB 3K1DA 5LXGL 3WNKA 3NFSH 3L3JA 1P6AB 1LO2H 4DVBA 2MJWA 3VFUA 2I07A 3FO9B 3BSZL 5EN2B 4HJJL 4HJ0D 1PSKH 3STLB 1ES0A 2FCBA 5LQBH 2HP4A 3FFCB 4HF5L 5IBLC 4POUB 3VFWA 4Y1AB 2A6KA 3VWKB 1CXEA 4L4TE 2ZZUT 2NY0B 2ZCLL 1A7OL 3ZHKA 4BFGA 1HHGB 5E94A 1QRNE 3EJYC 2NYYC 1MRCH 3L7FA 4NUGL 4HPOH 3OX8B 2AERT 2BY1A 4Y4KC 5A2FA 3RUGA 4X4YA 4JY4A 2DRUA 3GI8L 5A1AA 4MA1B 1T5XB 2P5ED 4XGZA 2O5XL 3WD5H 1XR8B 5INCB 2WUCL 5DT1H 3KVQA 4F7MA 1QD0A 2BC4B 4FN0A 1MAJA 2R1YA 3OHXA 3SQOH 5HGGS 1S9YA 1AKJB 4AEHH 1KPUB 4P49A 2F74A 1L6ZA 1U8JB 4OCSH 4Z7UF 3PJSB 3EO9L 4JVUA 1CGYA 4YHIB 2GIYA 3BIKB 3O2WH 4JFZH 5F1OB 3MRRA 1NDMA 2BFVL 3ARVA 4PTTA 4XB7A 3VFMB 4I13B 3QT2A 3QO0B 5E6ZA 2F53E 3ZYZA 5C07E 1FFNB 4GW5A 3SKJH 1WBXA 5E8DL 3S36X 3C8HA 4IRZL 1QBMH 4DUVA 1ZVSA 3R1GL 1MFDL 1R3HB 4FZ8H 3OAUH 2FZ3B 4W4OC 1DE4B 3VGAB 5I1GL 2WIIB 4UAOB 4XBGA 2F58L 5F7UA 4Q0XL 1DBAH 3EIFA 3MLSH 1V3JA 5KVEL 3CFDB 3O3AB 1SBBA 4G6ML 3MLRH 4PRAA 1J8HD 4NZJA 3BH9A 1MRDH 4Z7UA 5FYJE 5IROA 2E7HA 5DLMH 5F7EH 1XCQB 2ATKB 4X5WB 5HDOA 5C71A 5MHSD 3PHOB 4X6FB 1R0AL 5ACMA 3VG9B 3AXLB 1UACH 4GXVL 2C4FU 1RUKH 4K23L 1NGYA 3BSZH 4HJJH 2UY6A 1EUTA 1F90H 1S5HB 3EYOB 4K9EL 5EZJA 5INDA 5CCKH 3ZKXC 4KRLB 3DX9A 1A7OH 1MJUH 1WLHA 5KVFL 3LN4A 5CLTA 5MEOB 2XXMB 3A6OA 3RWDA 2BK8A 2HMID 4NO3B 4YXLL 5IMKB 1GPOL 4R97B 1DBMH 1MWAH 4K3HA 2K3TA 1T66D 1DCLA 2NY1D 4H25A 1KIPB 3RNKB 5DC9B 3DGGB 2XZAL 2AEPH 1YPZA 2FIRT 4BFBD 3RZCC 1W72L 4ZUSB 1IGYA 1YY9C 2FJGA 1A5FL 1U8HB 5CJQL 1T04A 3EO9H 3PL6B 3QNYA 4XP9H 1I7UB 1A7PH 2HT3C 1BZ7B 3PP4H 3D6GA 3LEXA 1CU4L 2DM7A 1G7QA 3V79C 4JVPA 5J12B 2BFVH 4IJ3C 1ND0B 2Z31C 4FFWC 2X70B 3AM8C 2YPVH 3S3JA 1G6VK 3FO9A 2Z0BA 3HC4L 5EN2A 4XVJL 3RAJH 3KYOB 3CIQA 2OXGA 4ZTPH 5BRZB 1Y6MR 4F15C 3FFCA 4GS7B 2QQNL 4IRZH 4WV1C 4PRHB 3JVGC 1NUNB 1FAIL 3R1GH 3GO1H 4J2XA 1CXFA 4P5MB 3FONA 3WFHB 4OZGE 5EOQL 3C6LB 4GBXB 1HHGA 2VB5A 1R5VB 2Y23A 3KLAB 4RBPK 8CGTA 2F58H 4G7YH 4HS8H 4ZS6D 3U1SH 2FH8A 3UJIL 4Q0XH 4IRJC 2BY0A 3TVMD 9CGTA 4F7TB 2IH1B 4NM8L 1T5XA 2I5YL 2APFA 2VXQL 1XR8A 3RX5A 4ODTL 2R9HD 1RK0B 4JY6B 5IKCB 1AKJA 1KPUA 2Z9TA 4R0LB 1NEUA 4TQEL 3EOAB 1R0AH 1YJDC 3PJSA 3VH8G 2GQHA 1UQSB 4WI7A 5DJXA 4ALAL 1XR9A 1VCAA 5KS9A 4U1GC 2CRZA 1S7RB 3BIKA 4K23H 3BPNC 4LCWB 2AJVH 1GZQB 1KACB 5C92A 3WE6B 3QHZL 3QO0A 5EOCL 1QLRB 3GFUA 4K9EH 5EPMB 2QEJA 1FFNA 3MCKA 3KYNA 3BD4A 4OLYH 3GSNH 3UJTH 1AD0B 2DTML 1GZPB 4G6JH 1JGUH 1DE4A 1W72A 4HKJA 1TLKA 3C5SB 3P77B 1OP3K 5F9AC 3L95B 3CFDA 3O3AA 4PRPD 1A22B 5C9KA 3QSKB 5DQDL 4Y88A 1C7SA 4PJ5B 1QFWL 4J1UA 2G5BA 5K93A 4XVUC 3T3MF 4X5WA 1QZ1A 2NW3A 1JHKL 5C08E 4JKPH 4NQDD 1JZ4A 5EZOL 4O9HL 4XCCL 4D94A 2VABB 1KN2L 3ARDC 3AXLA 4M9PA 4OQTL 4U6YB 2FBOJ 5D5ME 4ODSH 3CLEL 3NIDE 4LNRA 4P5TD 4XVJH 2C1OA 4NN7C 4LLQA 2JE8A 3MX0A 5C70A 1S5HA 3CSGA 3EYOA 2ZOLB 3DX7B 2XWJB 1OAUH 1FAIH 3O3DB 2IAMA 5IV2B 3FB5B 2FR4A 1F58H 4ELMA 5DFWH 2R8SH 3QXTA 3RFZC 1A7BA 3ZYJA 2H9GA 1HE7A 4PGZA 3BPOC 1Y6KR 5GZND 2FJHB 4WW2B 4YHOL 4PREA 4ZQKB 1TQCC 3L3OB 1TVHA 4NO3A 3VFRA 1W8OA 2NY5L 5TE6L 4PRDB 4HQQL 4NM8H 3RPIA 2I5YH 2VXQH 3W11C 2FEDC 5I18L 2DM4A 3DGGA 2J4WH 5FAAA 3UBXB 3HN3A 4WO4B 4GKSB 3RWEA 3OKMA 4ZUSA 1NFDB 1UM4L 5EU3A 3UTZB 1B90A 1U8HA 4KI5D 3PL6A 5FUZH 2CK0L 1I7UA 2VXUL 1ZWIB 1QBBA 3ARYA 4PS4L 5HHVH 5F9OL 3T77B 5C2BL 4RA0C 5E2UH 2VO5A 4MDJA 4PJCA 5EOCH 4XBEH 4M6NH 1GGCH 3QEQB 4OZIF 2QHRL 4HWUA 3KYOA 1S9WB 1M05B 1N5YL 5DK0B 3GSOB 1H0DA 1R6VA 4J12A 4P5MA 1IC5L 1EUUA 5C0CA 5C0CD 1GVIA 4N0YH 2R4RL 4JQVC 4X9IA 2KZWA 1Z9OA 3FKUS 4YNYB 3IFOA 4OQTA 4KGLA 5DQDH 4RAHA 5GJSL 2R1WB 1A9EB 4JHAL 4MGXA 1RK0A 3O8XD 1QFWH 3O8XA 3WUZA 4JY6A 5HDLA 1A1MB 5IKCA 2ERJB 4HG4K 2HLAA 3EOAA 4KRPC 3T8XB 5ERWA 2ADIA 1UQSA 4KY1H 1ZA6B 2XQBL 4Z8FL 4LNVA 1RFDH 4ONGL 2CIKA 3QUXB 4LCWA 3HUJA 4QXWA 3WE6A 4FTVE 3QPQD 1WBZB 1N0XH 3U0WH 4UBDD 4AIOA 3I3DA 1SVZA 1VHPA 1MLBB 2BZDA 4MQXC 4DKEL 1JPTL 5L88L 2VN4A 4TNWK 3IRPX 4QHKJ 5ANME 1J0YA 5I15H 1GZPA 1I8LC 2I60L 4HEME 2R56L 3E2HB 5D2NC 4O4YL 4JRXD 1ITBB 1M7DA 2C1PB 3P77A 3V6OA 5SWQB 4P9HC 4WW2F 1JWMB 1CD1B 4F3FA 5BV7C 3MV7B 5IMMB 2W60A 5I18H 1B4RA 3LCYA 4FQJL 2NX5B 4RX4D 2UVFA 4GRWH 3B5GA 3RI5F 3TN0B 1A21A 1FG2A 4HUWB 4PJ5A 5HYQB 1HEZA 2E9BA 4MNHB 4C4KT 1CT8B 4PS4H 1ONQB 2UZIL 2X1PA 2XZZA 5C2BH 1HIML 5L2KD 5KVDL 4XPHL 1KUMA 2QHRH 1F2XK 3IDJA 4CMHC 4OCYH 2PETA 2FX7L 2ZOLA 4S1SL 1LO0L 2DM3A 3O3DA 1JF5A 3QUZD 3QUZA 3QNXA 3IU4L 4MCYB 1IC5H 3K81A 1S8DA 3JV5A 5FYLL 5A2JH 1FVCB 1ZT7A 5SX5K 4U1JB 4ZQKA 2UWEB 3VD3A 3L3OA 1NCBL 4MXQC 4PRDA 1P69B 2YD8A 3MPCA 3F65A 3MLXL 4LSSL 2EZ0C 1FFRA 1T2XA 3MRMB 4HGKC 2M8XA 2VH5L 4CVZB 3BZ4B 5EZIH 4GKSA 3SQBA 1NFDA 1MH5A 2VQ1A 3GSXB 1LHZA 3ZLQC 1S7TA 3U30B 4MNQE 2PO6C 4LHUG 1CDHA 3MLZH 4OGXH 2P24A 2XQBH 4MX7B 4ONGH 1F4YH 1A7QL 3BUYA 3GNML 3I3EA 3H7LA 1YEGH 4X9HA 5IJKA 4YHNB 3X14B 4DKAA 1FNHA 4EVNA 4NM4H 4M43H 3ZHDA 3BT2H 1YECH 5GS0D 4POZD 4GRLC 5AG8A 1U58B 5DK0A 4I18B 1BFTA 3KJ4C 3VXSE 5CMAB 1KTDA 5DJYB 3G9AB 4V1DD 4V1DA 4LVHB 1NC2B 5IFHL 3FT2A 3MUGA 1EBPA 4O4YH 5GS0H 5K9QI 4OD2B 4KXZI 4UT6H 1FIGH 5GSRA 4Q6YA 5CP3H 3QWRD 4NQEB 3N1PC 3MRKB 3RVTD 1N7ML 1KENL 4AM0A 4LSPH 3CJJA 4FQJH 4GSDL 2EDHA 4JN2B 3UP1A 1KT2B 2R1WA 1A9EA 2DQIL 4WFFD 5F96L 1T2JA 1CFVL 3GMRB 1P4LB 5L8KB 3AAZB 2BSSB 4NQXB 3LPWA 3T8XA 4Z5RB 1YC8A 1DEDA 1VGKA 3S34L 4XPHH 4I48A 3EOBB 3DETD 3CFKA 5CS7A 1DLFH 2APTA 5FYLD 2Y06L 5CZXC 3VFSA 3ARWA 3GBMH 2IGFL 3MMEB 1Q9KB 1MLBA 2HVJA 2HJLB 4N9GB 1OQOA 1JWSB 4LLAA 5I75C 3O3EA 2MCPL 5B3JF 3GUTA 2FATH 35C8L 2XTJE 1YNLL 2EH8L 3MRCB 5CEZL 5IVOA 1FFOA 4R96A 1J05A 5CBEB 4GLRI 4IS6B 5F6HJ 1NCBH 1FAKT 4HFWA 2Q7YB 2C1PA 4OFYA 5FO7B 3ABZA 1JWMA 1PD6A 2UWEF 4CN6A 2A77L 1XIWB 1KJ3H 4AEIL 3CVHL 4UV7L 5C0IB 2VH5H 5T3XE 5J13C 3DROA 4LGRB 1KEML 2ARWA 4XPGL 2ED7A 1BOGA 4HUWA 4F2MB 3G5ZB 3GMPB 5HYQA 4HWZA 4WWKB 5ETUB 3OQ3B 4OT1L 3U0TB 4MNHA 3S8WA 1CT8A 4JQXC 5EU6B 1FC1A 3GNMH 4JHWL 2YPLE 5TDPB 1RU9L 2EDJA 3U6RB 3RL1B 3ZKNC 1ZKAA 1ETZA 1FG9C 5DZNA 4OGZA 1J9CT 2YBRB 4NKIL 4XNZB 1A7NH 3KWWB 4HIHB 4POYA 1AQKL 2VR4A 2DB8A 4OCXL 3ARPA 4KK6C 5IR1B 5IFHH 2IPKB 2NY6B 5SX4H 2AK1H 3K46A 1NCCH 2JCCB 3QJHB 2AEQL 3LB6C 3U82B 2DQUL 4S1DD 4EN3C 4P2RE 1P1ZB 4XC3L 2QV2A 4CU7A 2P48B 5AZEL 1A9BA 4ONFL 4UNTA 4DGVL 3CDFA 3CD4A 5HY9B 5FUCE 5JLZB 4LL9A 3VGEA 2HKFL 5F96H 5H37H 3BZ4A 5JW4M 1CFVH 4ETYA 1W2KT 4LLWB 2CR3A 2Y9RT 3GSXA 2EH7H 4ZNEA 2DD8L 4DWHA 3S37L 2R0LL 2ADGA 1EHLL 3S34H 1JHLL 4MCZB 5FO8B 4KQ4L 4HUNB 4PB9H 4YHNA 4DN3L 4E41B 1R3LA 1OT1A 4UI2A 5T1LD 4RMRA 2D31A 2ZUYA 5SWZB 5CEZD 3LQAL 5JHDD 5JHDA 4QRRE 4HIJA 3DYOA 4QHNB 1RUPL 5HGBA 5IB5A 1U3JA 2ARJQ 1GHFH 5EOCJ 2PW1B 5CMAA 5DGRA 3P2TA 3O41A 3CVHA 3KDMB 35C8H 1RZJH 5C86A 1YNLH 5CEZH 1HK6A 5FYKH 1TVBB 3ARBC 1YEDB 1AD9A 3H3KA 4LF3B 2OMNA 4OD2A 1HH6B 3H0TA 5KVGL 3SPVB 5T5NG 4JFHD 5D1QD 5D1QA 1MFAH 2H6PB 5FYKU 4ORZC 4UV7H 1AGDB 2VDQL 3GSQB 5HHXL 4XPGH 5SWSD 5CD3B 1VEPA 3PV7A 4PJIA 3VDCA 5I74C 3T1FA 3E6HB 3GMRA 2W9DH 2GT9B 5GRUL 1P4LA 2VRAA 3EHBC 1WWCA 2BSSA 4NQXA 2YUXA 2D7TL 1O7VA 4FQHA 2NMSA 1T03L 3PWUA 5DI8A 3VD4A 3IAQA 1I7RB 1N0LA 5EU4A 2VLRE 1SBSL 5F1IA 4N0FB 4WTXA 3TZVB 2VXSL 3WYRA 5DQJB 2E6QA 3D39D 3D39A 4OFKA 4Y5XC 1CICD 3M1BA 3VDAA 4RWHA 4NKIH 5FK9A 2J1KA 5JW4Q 5B4MC 1TNMA 4HWEL 1AQKH 4OCXH 1Q9KA 4LBEB 2YHGA 1VADA 5H35A 2HJLA 4F9LA 4X8XA 5I76A 1JWSA 4YHPA 4EOWH 1GC1C 5C6WH 1NFKA 1OVZA 3EDDA 2AEQH 5GHWH 4KKCD 5E7BA 5EBLA 2KBGA 2Y07L 4IS6A 5EIIB 4MA3A 1AH1A 3D69B 3W82A 5TQ2L 1T6VN 4R4BA 5AZEH 2JCCF 4ONFH 2FNBA 4G6KL 4DJMA 1T0PB 4E5XB 4KDVA 1LO3L 5EO1B 1XIWA 1FHGA 3JV4A 1BGXH 2JJSC 4N9OB 4XMLH 3MJGX 1BFVH 2HKFH 3RWFB 2KQMA 4HS6A 5KG9B 3T2QA 1QHOA 1BF8A 1KOAA 1A7RL 5BZWA 4TUOB 4F2MA 3GMPA 2Z8WC 2NR6D 3OB8A 3HA0A 4QHUA 5ETUA 3VFVA 3U0TA 5KANI 1EHLH 4YXHH 5EU6A 3PE9A 4KDTC 5TDPA 4P4KB 2GJZA 3HAEB 2YD4A 3VFNB 4DN3H 3HG1A 4QO1A 2V17L 1LEIB 2NXYB 4OZFB 3LDBB 3T08A 4LRIA 3RBGA 1GRWA 2YBRA 4YIQB 5F7LB 4L8SB 4NN6B 1MAKA 1F45A 1ZMYA 3KWWA 3B9AA 3T65A 2HFFB 3BFOA 2BRRL 5M7QA 1JIBA 4XH2B 3NCJH 2XV6B 1G6RH 4HDIA 4HGWA 4FZEH 1MCCA 3W9DB 1OGTB 3QJHA 5KVGH 2RFXB 3BE1L 1C1EH 4NO0D 4NO0A 4F9PC 4Y19D 4X6DE 2JTDA 1P1ZA 4KK8C 4JAMA 3UC0H 1G7HB 3MNVB 4O51A 4R4NC 3EYFA 5J1AB 1YC7A 4XNUL 1NGPH 4XVTL 3EDFA 3F6LA 4LLYB 1TTGA 4XTRD 3O9WC 5TF0A 5DS8A 3P0YL 1UKSA 1MREL 1DUZB 2D7TH 3RY4A 4MJ5A 4ZFFB 1T03H 2RJMA 5A43C 1SBSH 1JNHA 1A1NA 3OJDB 2VXSH 2GJ6B 4MCZA 4U0RC 5MP6L 5FO8A 5JR1L 2CUMA 2EE2A 5GGVH 2YSSB 3QH3B 5GS1C 3NZ8B 4QHNA 1CTOA 3HE7A 1UWGH 1A0QL 1K85A 4Y4FD 4Y4FA 3B2UD 2PW1A 3N85L 4JFYA 3PWLA 3F12B 3L6FB 3KDMA 1OM3H 3VXTB 2AJXL 4ZAKC 4EDWL 5ELIA 5EIVA 1FV1A 5JORB 3SPVA 4G6KH 2GI7A 2FYYB 5A2KH 2ZG3A 4GQ9L 4RMVA 2H6PA 1Z3GL 3INUL 2VLKB 3RZWA 1U3HD 1U3HA 2IG2H 5HGDA 1LEKB 3QISA 3QUYD 5IIEA 1FNAA 1A3RL 4BJLA 5J3HC 4H8WH 3ORJA 4YXKL 3A0OA 2CJUL 3TJHD 2GT9A 4MD0B 3DV4A 5AAWA 4PB0L 4UIKL 4C56D 4C56A 1K5NA 4N0FA 5F7NC 3TZVA 4MB5A 3H9SB 3IXTB 1RZKL 1EO8H 4BQ9A 3P4LA 1VSCA 2BSRA 3W2DL 5KOVC 1QFWM 3S88L 3VI3E 1DTUA 1ZGLA 1T7VA 4TVSa 4NJ9L 1TMCB 3BP5B 4NO5A 3MJ7A 1IT9H 4QCIB 1TCRA 3BMWA 1ZLSL 4NNYB 2VKWA 5I1LB 4LPVA 1OARH 2VLJE 4XNUH 3WMSA 1G9NL 1G7IB 4FXGB 3BYYA 1NLDL 4Q58C 3RWFA 5HI3D 2YZ8A 4Q9RL 5HVFB 1BWWA 4MQSB 4Y4HB 4MZ3A 2R2BB 4G8IB 2QR0A 5HHNA 2RGSA 3GSRB 2BVTA 1JBJA 3BDBA 4K8RL 3NIDF 5T1DL 1JV5B 1LEGB 4XNQA 1JNLL 1O7SA 2P5EE 4HUXB 1QR4A 4JPIA 1S9XB 1P7QB 2WBJB 3SCMB 1I9IL 1BVLB 2AJYL 4P4KA 3BVNB 3HAEA 3CSYA 1MFEH 3VFNA 3BO8B 4TPRH 4Y5YB 3ME0A 4AQOA 4D3CH 1LEIA 3LQZB 3QIBC 3VCLA 1RZIB 1AC6A 2BNQD 2BNQA 4YIQA 4Q9BA 3HMXL 5J56B 3I2CL 4WEBH 3TBYB 2UZYB 2XG5A 4RDQG 3ROOB 1JZ7A 2EKSA 1BJMA 43CAA 3VJ6B 5FUCC 3VFGL 1PG7W 2GK2A 4XH2A 3CMOL 4EDWH 5F6IB 1GJIA 4HFUH 3JWDL 2BDNL 3TO2B 4GQ9H 3MYJB 4D9QE 3QQ4A 1Z3GH 1Z0MA 1JZ2A 1A64A 1EPFA 3QPXH 3NFNB 4NZTL 1OSZB 4FQ1L 1ZTXH 4OZHB 4XNMB 3U9PH 3QDMB 1IQWL 1Z0NA 3ULUE 2H26B 3Q48A 2IQAB 5GS2D 1RV6X 4YZFF 4PB0H 1DUZA 4XMKL 4QY8A 4UTBL 1NUDA 1HHKB 2GJ6A 2NQCA 1OAQL 3LH2H 3VXUD 3ZKMD 3HCVB 4YDLC 5GS2H 2YSSA 3PXHA 3QH3A 3SKNA 3D3VE 2FX9H 5EUOB 3SDAB 4QXTB 4LIQL 4MAUL 4BKLA 3GJEB 4OI9A 3MLPA 1PLGH 3LS4H 4JFXB 4KI1A 3BZEB 3K3QA 3L6FA 5DJZA 2ITDB 4Y2DC 4KV5E 1XH3B 4YQXL 2I9LA 3RVUC 3VMPA 2ADJB 2PYED 5HVWA 1GL4B 5IW3A 1EK3A 2VC2L 1NC4B 1ZLUK 4U1HA 5JORA 1G1CA 4WHYG 2VXTL 2XWTA 4K8RD 1J10A 5ALBH 1D9KD 5TPWL 1IGFL 5E8EB 2FYYA 5I1CH 4TSCH 4UIMB 4JPWH 3BPCA 4C83A 5SX4I 1NLDH 4GJTB 5C3LD 1WAAE 4ETQB 3HC0A 5C0JB 4P2QE 3VXNB 4Q9RH 4P99A 4YK4C 3AY4C 3I50H 4JCLA 5JXAH 4K8RH 2FH6A 3O4LE 1JNLH 3WFZA 3KHOA 4NCC2 1HILB 5IFAH 3HMXA 5DMIL 4X7EC 5CJ8A 5DJ2A 5I19L 2B1AH 2OTUA 4PJ8C 1WCBA 3IJSB 4JM2C 1YNKL 1T89A 4QXUH 3H9SA 5DK3A 1AO7E 3VI4E 2IADB 5C0AB 1RJYB 3EDKA 4NWTL 5HHOB 2EXWD 3MO1B 3HHRB 3WJJC 1IM9D 1IM9A 2V9QA 1T2QL 5IM7A 2HRLA 5ICZA 2XKSA 3I2CH 1UWEL 1V7MH 4ZUVB 4XCNB 3R8QA 5D70H 2YPKA 3FN0H 1Q0XL 5IP4A 3BP5A 4JFOB 4XC1L 1I3VA 4KJPD 4QCIA 4P3DB 4MYWB 4IRSA 1CDCA 1G0XA 1IZKA 3CZJA 1HOCB 2B20A 2Q3AA 4HS3A 5DFVC 4F57L 1K8DB 5I1LA 3VA6A 3PWPD 3PWPA 4XP4H 3BWAA 1UM6H 2ITCB 4LEXL 5D8JL 1NCNA 4FXGA 2MKLC 4X80L 1CZ8L 4RAUA 3CX5J 5TFSH 1R3JB 5I71C 3WNNA 2M2DA 2R2BA 3SDDC 1CFNB 5GPRA 4Q2ZA 5DRXA 1JV5A 1LEGA 1RHHB 4BQ6A 3W0WD 4HUXA 2FB4L 1RUQL 1P7QA 4JREB 1OAQH 3V6FB 1PQZA 4EI6B 3BVNA 4KROB 2PXYB 4WFHE 3LEVL 4XWGL 4Y5YA 3F7VB 4KWUA 1G7JB 3V4VH 3LQZA 3QG7L 5ADOL 3KYMB 2A38A 4JFFB 3DXAE 1AXTL 3TBYA 1GXEA 5EUOF 4X4ME 3SE4A 5DJCB 1WEJH 4PG2C 3ROOA 3QXUA 4QOKA 3VJ6A 4YQXH 4JGJA 5FFLA 4MDIB 1XF5B 5FHAL 2G2RB 2PTTA 4G6FB 3OJMB 3T04D 1RZFL 1FIEA 2VXTH 2L7JA 1VGEL 4K7FA 4TSAL 1KFAL 1OAYH 2E8YA 1NAML 5F1KC 2WUBH 4M5YH 3SDCA 2BSTB 4MJ2A 1OSZA 4OZHA 4MQTB 3O6FD 3GMOB 2FEEL 4DOHE 5CINL 2H26A 5MI0B 2IQAA 3EZJB 3C60D 5I19H 5L0QC 3TV3H 5DD0L 4PRPE 2B4CL 4N0RA 5GGRY 1YNKH 3L3DA 5E8NA 1HHKA 4RFOH 3MRNA 1HWGB 5HSFA 1FSKC 2NZ9C 1OWWA 5GGRA 3HCVA 4J3VA 1NMAH 4APQC 4NOFA 3G6JE 3SDAA 4PV9B 3GJEA 2FD6L 3S4SB 3BZEA 1Q0XH 1XGTB 5JO5B 2X4TA 2ITDA 3BKYL 3VXQB 3PP3K 3NABH 3MRHB 2XZCL 2VITA 1P7KB 1NC4A 2AV1A 5C0DA 2KH2B 3MGTB 1XGQA 2APWA 2HH0H 3C5ZC 1BP3B 4MNGA 5HYJB 3CDCA 5D8JH 1KEGL 4UIMA 4YGVB 5FCUH 3O2DH 4HC1L 3I75B 3PWNB 2PTVA 1INDL 3D25A 1CZ8H 4X80H 3RIFK 2F8OA 2VSCA 2A0LD 4BZ1L 4ENEC 2VDKH 2LAAA 5JMOC 1SYVA 4BSVB 4MAYD 4MAYA 3TF7C 3GRWA 2CO6B 2X42A 4M6OL 1HILA 5LAXB 1Q1JL 2AXFB 1MIEL 4CKVX 5A16A 3IJSA 4H20H 5DMYA 3D48R 3IDNA 2ZSVA 4HJ0C 4OLVL 1U41A 3VWKD 5KN5A 2IADA 1RJYA 3GB7B 2DKUA 3QG7H 5DJ6A 5ADOH 5HHOA 4U2YA 3FQNB 3QHTC 4TN9A 1ERNA 4HMCA 3QCVH 1OTTC 4LCCB 2A1WL 2XI9A 5E1AB 4JN1H 1NAMA 1V3KA 3P30L 5J6HA 4BFEA 2C4XA 3FOLA 5C0FB 4FP8L 3N50A 3M8OH 4JLRB 3IAGC 4GG6B 4YBQD 4F37F 3MV8E 4QHLB 4FFYL 3CNKA 1OTSC 4WI2A 1VGEH 4P3DA 1GOFA 1OAXL 5HDBF 2HTLD 3ARGD 4Z95L 2OJZL 2R39A 3IRZA 4XX1G 2AK4D 2AK4A 1C5BH 4MA8H 5DC4B 3PGFH 2FECL 1LMKA 32C2A 5FKAB 3LEYL 3F7YA 1W0WB 4O2EB 3CSPA 4RMSA 2ZUVA 5HHPB 2RQ8A 2LVEA 5CINH 1U8LB 1R3JA 3O3BB 1CFNA 2R0ZL 1T7ZA 1VFBB 2ORBH 4RWYL 3QDGD 3GKWL 3MFGB 1JPSH 2PXYA 4GKZB 3F7VA 1FZMA 2E3VA 3VE0A 3P11H 5MEPB 3MBEA 1S7XB 3V4UH 3TA3D 3TA3A 1CDUA 1XZ0A 3PNWA 3CFEB 4M5ZL 3LRSB 1U0QA 4Y4KB 3UTTA 4ZXBB 2AABL 3UTTD 5DJCA 2GEEA 5FA4B 4HC1A 4OIAA 5EBMA 3BKYH 4D2NA 1XF5A 5B38B 5L2JA 2G2RA 1Y0LB 2XZCH 3D9AL 5IW1A 1MFBH 3K7UA 3OR7B 4IDJL 5GGSB 4F7EB 3TEUA 2A73A 2DMKA 3EYQC 4RGOL 5BS0E 1X7QB 2HT2D 4XBPA 2BSTA 1YQVL 2H8PB 3OKDB 5IB1A 4GRWE 1WBYA 2XWBA 5IEHA 1UT9A 1S7VB 4M6OH 2FIKB 2OYPA 1Q1JH 1MIEH 1U8OB 1U3YA 2AJUH 3GMQA 3OAZK 3WFEH 1UB6B 1EZVY 1KCUL 1NBVL 3P9LA 2A6JA 4HUUB 3IJYA 4ESKA 1HCVA 2XN9E 1KCKA 4S1RL 5DHXB 4XP1L 3ZSTA 1KCRH 1E27B 4WENB 3C2AH 4YWGH 4AJ0A 5E9DB 1BFOB 3S4SA 1HINL 5IB2B 4E0RB 1XGTA 3NAAL 1IGMH 2HMIC 4JFDE 1OB1A 4ORGA 3LMJL 1AFVL 1T66C 2NY1C 4JFQB 4GG6F 3U4BH 1CBVL 3MGTA 3DX8B 2OJZH 5HYJA 2HFTA 3VRIA 4WTZA 3RGVD 3RGVA 1Q9WB 2D03L 4H1LH 3I75A 4YC2C 1KXVC 2L0DA 2V7HB 4XP6L 1JL8A 4X7CC 4H88L 4BSVA 1NFIB 3MOQA 2ENYA 1HZHL 1ZT4B 2EDBA 3KXFE 1N59B 3DO3A 4PJHB 5EFIB 3STZB 2O93L 4LRNL 2EIZA 4PRHD 4MQ7A 1W0VA 2LVCA 3QULB 3FQNA 2DBLL 4R9HA 5E8OB 5J9PA 3S3PA 5E1AA 2LE9A 4TUJB 2AABH 1T1WA 2ZPKL 4JLRA 4ZS6C 4QHLA 4IDJH 5C3TA 4XXDB 2W65B 3TVMC 5KSBB 1KIUA 1KULA 2FDBP 3RZCB 3S3SA 1I1AD 1I1AA 5CHNA 4RGOH 3KAAA 5I73C 5D1ZD 1YQVH 2R9HC 5D1ZA 2A2QT 3AROA 4WHTB 4TSBL 3NCEB 4DUXA 4HKXA 4K9EC 5CLWA 5GSVA 4L9DA 4TNVF 1MAMH 4KK5C 2BRQA 1E4WH 2EDRA 3S98A 1JGEA 4NN5B 1JK8B 4U6HA 4QRTB 1KCUH 4WV1B 1ZGLM 4GKZA 3SE3C 4LOUD 1WF5A 2AP2A 4JY5L 4P46B 2VISB 3X13A 4S1RH 4NFBA 4ZNCD 1P7HL 3WJLA 4DAGL 3EJYD 4ONOA 1KTLB 3CFEA 4NRZB 2OR8A 4IRJB 1RMFH 1PZUB 4KGJA 1BBDH 5B38A 2HFGL 4XWOC 4I3GA 1DQTA 3IGAB 2FBJL 2WP3T 3KPSD 3QR2A 4OCWL 1JRHL 3RDTD 3RDTA 1X7QA 2XYCA 4UT7L 1UENA 3NBNA 1SEQH 2H8PA 5EUKB 4PRID 4PRIA 15C8L 1FFPB 1JGVH 5CILL 3FO2B 4PPTA 4H88H 2P45B 1HZHH 3BPNB 5DUBB 1BF2A 1JN6B 2G9HB 3S35X 3BKCH 1AHWB 5JIPA 1S7VA 2A6IB 4OGAD 1MI5B 3CPLA 4LRNH 3SO3C 2LTQC 1DFBL 3JTTA 2VDLH 2EDDA 2W59A 2CIIB 4PJ7E 4I8DA 4P5TC 4PJHF 4G8GB 3WHXB 1QKZH 4YFDB 4DZBA 3P40A 1REIA 2VZ1A 4X9FA 2DBLH 4FA8A 4OFDA 5EULV 3WIHA 5F89B 3EYVB 2J6EL 4W4OA 3SDXE 3D0LA 2ZPKH 3LN9A 5B39B 5E9DA 5GZNC 1BFOA 1FL3B 1FNGB 5I1HL 5IB2A 4JGMA 1GYAA 4M8QB 3N1GC 3ZYOA 3IYLW 1DSFL 4K55A 1IGIH 4FXKA 1YEKH 1IQDB 4MJ6A 4WO4D 5CWSA 5KSBF 5DTFA 1XF1A 3V5HA 4R2GB 1P4IL 4TSBH 1F97A 4FQLL 4KI5C 2YA2A 4HLZG 4FOMA 3U7WH 3IF1A 1NFIA 4LQFL 4U49A 3EFFB 3QA3B 1ZT4A 3SBWA 5K59E 4NN7B 1S3KL 4P0DA 4TRPL 5EFIA 4EBQL 1I75A 1I8MB 2XFXB 1WT5C 3VI3F 1I1YB 1QACA 4GUPA 1A8JH 2IEPA 3ARFC 2V7NB 4NDMB 5TGBB 1U8IA 2HKHH 4PJEE 1TQCB 3H2WA 4AEFA 4WCYL 8FABB 4JRYD 4JRYA 3QWOB 1UKQA 4PJFB 4WU7A 1I8IB 5FYKE 2CXKA 2H1PL 3EDEA 1JZ3A 1F8TL 2Y25A 1CL7H 3BQUD 3S36L 3DI3B 3NPSB 4QRUB 4Z7QE 4OTXL 3RZCA 2FBJH 2V6HA 1JRHH 2CLVA 4GAGH 2JJUA 4Z6AT 1U95B 3C09C 3O8XC 5CILH 4KC3B 5DJAB 4AMKL 4WHTA 1N4XH 2EYRA 3QUXD 4G9FB 1A14H 4XPAH 3ARQA 5IEKB 2YUVA 2Z31A 4LSUH 3WNPA 5GIRB 4O5LH 3AM8A 1DFBH 4OFPA 3AVEA 2Q8AL 5BW7C 5DURB 2DOCA 2NZIA 4L3CA 4JKMA 1JK8A 1MJJB 3LY6A 4U31A 3QPQC 1FN4B 2AI0L 3HC3L 4C54A 1NMCC 3DIFA 3SO5A 2V2WB 2VISA 2RAMA 2NY5C 3NIFE 5HVHC 3OKKA 4UBDC 5CSBA 2J6EH 3PDOB 4IOFD 1SM3L 3HNSL 5IHLB 1KTRL 1QSEE 1KTLA 4NRZA 5D2LE 3RWJA 1KBGH 4DKDC 3MV7D 4FQXB 5TQ0H 1XAUA 3BKMH 1DSFH 2DI8A 1A1OB 1KCSL 3WLWD 2RB8A 4UDUB 5C8JA 2NX5D 4E9LA 2JB5L 3HI1B 3CH1A 3VXRD 4UDTB 3ZL4L 4XI5D 2O61A 1MUJB 1I4FB 1A4KB 3IFNH 2VZOA 5HJ3A 4U1MB 3JZ7A 4C58B 3U83A 5BZDB 2YD9A 1D5ZB 2J88L 2XTLA 3IU3A 4YR6A 4D0CB 4XPBL 1QLFA 1NANH 2A6IA 1S3KH 1KPRB 1MI5A 1QNZL 5DVNA 1TPXC 1EFQA 5AUMA 3CLFL 1Q38A 4NQCA 4M7KH 4NQCD 3ZE0E 2CIIA 5KTEL 1LDSA 4G8GA 5HHQB 1FPTH 2W0PA 3GMMB 3SGDH 4LCUA 5GRXG 3VXPB 4KV5F 4ZOAA 5F89A 1UZ8A 4MXVE 1B6DA 1ZS8B 4L3EB 5D2NB 3JXAA 3T2OA 5I9QC 5B39A 2GKIA 1FNGA 3CUPB 2J8HA 3MROB 3CZFB 2H1PH 6FABH 1F8TH 3S36H 4MXWH 3QIWD 3CU7A 4OCRH 3QFJB 2ZKHH 5DDHB 3QXDB 1FO0B 1F4XH 1FJ1B 4AMKH 4ONHB 3ARDD 3ARDA 5ICYB 3X3GL 4K07A 4Y19E 3EFFA 3QA3A 3RL2B 5C09E 2Q8AH 2V5TA 1JMZA 5H2BB 4CMHB 4Z7WA 4O02H 5C0BD 3LHPH 5CIPH 4ZUTA 5C0BA 4J3UA 3RNQB 3VXMB 2OJEA 1I8MA 1WJ3A 3DV6B 3F7PC 1AC0A 2AI0H 2DQTH 3HC3H 1PKQE 3HE6D 4OFIA 5GS0C 3F58L 4BFIA 4POZC 4F7CA 5GRWA 1NC2D 1EFXB 2DICA 4ZD3L 1XF2B 4MJID 4CMMB 2V7NA 2K9UA 4NUJA 4YHYB 2RR3A 4QRPB 5A2IH 2VZTA 4LFHG 3OZ9L 4BZ2H 2X4RB 1T7YA 3QWOA 4PJFA 4IDLA 4QT5B 4YHLL 1OAKH 5BQ7A 3MA9H 2FEDD 4ZFGH 3MV9E 3E3QE 5I66B 4KVNL 5FYJL 1CE1H 5ISZE 2F19L 1QSFE 3VGFA 4Q74A 3Q2CA 3SY0A 1U8MB 5F3HB 2C3WA 2PO6B 5BV7L 5DJAA 4N0UE 4L4TD 1JE6A 4L4TA 3L3GA 5I8CA 2J88H 2NLJB 2EXYD 3HFMH 4FHBD 4Z7VE 4E42A 4XPBH 4WWID 2M26A 5IEKA 4NKDB 4WY7H 1QNZH 1QRND 1QRNA 1UWXK 4F58L 5GIRA 5D96C 3CLFH 3WIFB 1NGQL 4GRLB 4ZYKB 3NGBC 3DETC 1MJJA 1RJLB 3DBXB 3KJ4B 1FN4A 2W38A 4FQQB 4A6YL 1TCMA 3K80A 4AG4H 4QXGL 3OPZL 1GAFH 1MLCB 3HZVB 2R0WH 3ARXA 4JQIL 1YEFL 3T0VA 1IL1B 1KYOJ 4H5SB 3DUHA 1UCTA 3LKSA 4Z76B 3O6KL 4JQVA 1ORSB 2GSGA 1FQ9C 4NKMB 4X8JB 1ZLVH 5ENWB 5FDWA 1F6AB 3NIGE 3U7AA 2YUZA 3D85B 1A1OA 1H15B 3HRPA 3VH8B 3UTSB 2F53D 3T3PF 5C07A 1F3JA 3BP4A 5D7IB 4WWKD 1MUJA 1KLUB 1EA9C 2CSPA 1KG0B 4ODWB 5JQ6H 1QR1B 4PGBB 5FM5O 3LSOA 4JDTL 4D0CA 1OLZA 4CNIA 3B9KB 1OPGL 5MENE 3NACL 3T0WA 4NSKB 2DQEH 3BKJH 5JW4N 5K9KB 4EKXA 1R3IL 3Q1SL 1NGXB 5HHQA 3C87A 4LGSB 3HAEG 3GMMA 5HDQL 2DLFL 4EUPH 2Y4SA 4NKOB 4JJ5A 3VXPA 2HN7B 5I75B 2OI9C 1N3NB 3F7QA 5FYJD 1D5BA 1LD9B 1A6UL 4L3EA 5D2NA 2JKXA 3ZDYF 5C08B 4JPKL 3WXWH 4YHLH 2W07A 4NWUL 3UTPE 3CZFA 4S1DC 5CKGA 2XRAL 4KVNH 1GGYA 2R2HB 5FYJH 5J13B 3HB3D 2F19H 2VOTA 1K3IA 1LDPH 1VDGA 3RHWF 5HTSA 3WLBB 4GQPH 3G5XA 3RY5A 2L7UA 1FO0A 4PY8J 1XMWA 2C5DC 4BK4A 3W5NA 4ONHA 4HMDA 2HJKB 1CS6A 4GMSL 4WUUE 4A6YA 1U8NA 5E2TL 4F58H 4PJAE 3RL2A 1BZ9A 5MERB 5SWZD 3T2NH 4S2SB 1WK0A 1L0XA 1RZJC 3QDJB 4Z0BH 4L8CB 2SEBB 3A67L 3PQYB 4PLOB 4QXGH 1OSPL 1EFXA 4HKBA 4LAQL 3B2VH 4JQIH 2F54E 1HHIA 1K2DB 5CJOH 3SJVE 4QKXB 1F00I 3LKPA 4HZLB 2A6DB 3O6KH 5F9WC 4EN3B 3MRLB 3S96B 4YAQA 2RIKA 2ZP0T 5D1QC 1A3LL 3V0VB 5I66A 2Q6WA 5ACZB 1BECA 5FGRA 2I27N 5DD1H 2DS4A 5F3HA 3WL9A 2ICWJ 2PYEE 2R23A 3HMWL 5E6IC 5JW5B 4ZPTB 3MRFB 1NCTA 1KIRB 4OZGA 4PY8I 4NKDA 4OIIL 1EV2E 4K71C 1IAKB 3NACH 3BDYL 3KR3L 3T0EE 1V7NL 1X6LA 2QSVA 1WIOA 2DKSA 4P2OC 4GRLA 5JDSA 1CICC 1RJLA 4HIXH 4FQQA 3UBXI 4FS0A 3MACL 5IMLA 1TJIH 1YEHL 3ELAT 4G7VL 1MLCA 3I9GH 3HZVA 4F9LC 3ARBB 1K4CB 4L8BB 3WIIL 3A6CL 5C6TL 2ZNXA 1IL1A 1AJ7L 5C2UB 4H5SA 1DQJB 3MA7A 3K4AA 4KKCC 1AGBB 4NKMA 5ITBH 1F6AA 3TWCL 1DQQB 4DTGL 1Q0YH 1F4AA 4NPYA 5I74B 3TNNA 5IVXB 3DMMD 3QUML 1A3QA 4PFEA 3NH7H 1Y18A 5D7IA 1LO5A 3DTXA 4ODWA 3LQAC 3WEXB 2DI9A 4FNLL 2NR6C 4XCYA 1CL7I 5D7SL 1F6LL 4Y5XB 3BZFB 3CAFA 5KSAC 2CMRH 1VPOH 4U1NB 3P0VL 3IAPA 5I1IL 3ECBB 2AJ3B 5IESH 4I3RH 3TP4A 1OSPH 4D9RE 3OKYA 3ZE1F 4LLVB 5F21B 4OZFH 5AD0B 4GO6B 4HH9B 4IM8A 1SY6A 2BHUA 3V6BR 3O2VH 2EIBA 4MHHG 5C08A 2HA1A 3TT3L 4WHDA 1EGJH 2ZNWA 5I1EL 2NTFB 1EMTL 4X7FC 1A3LH 4EI5C 2X7LB 5LGKA 5FO9A 2R2HA 2HWZH 5I8OL 2YEZB 4KPHL 1HYSD 2BVQB 3TYFB 3RJDA 3WLBA 1L6XA 4U6VH 1NGWB 4XTRC 2P8MB 2W9EH 5E03A 4JM4H 1P84K 3KPQA 4FQIL 2VDOL 3F5WB 4MWFB 4Z7UE 3OWEA 1MCOL 1RJZB 4F80A 3QJFB 5DD6A 2AKRB 1RUML 3MUJA 2SEBA 1T6WA 1YEHH 3QI9C 3GSWB 3CCHB 1NANI 4HXBL 3B2UC 1BVKA 1IMHC 2Y5TA 1C12B 1WWWX 3WIIH 1K2DA 2F5BL 2F5AH 2EIEA 3A6CH 1KCVL 3GMNB 1NQBA 1ULVA 1JPGB 3WSQH 3QB7C 2CKNA 4EN3A 3MRLA 3TBVB 4LASL 5I1DA 4ODHL 2OR7A 2VLKD 4H8WC 4JFEE 2WINB 4ZDHB 2BNRE 4PGEB 3TWCH 2QJDA 2DIJA 1GC1L 4L8DB 1MCHA 5CGYD 5GGTL 5ACZA 3TJEH 2CH8A 1KB9J 3TH4T 4PJXB 4PGDB 5D7LB 3QUMH 5FV2A 3QUYC 4PY7B 4QHMB 2XT1B 4M7LH 3C8DA 4KJQD 5IVXF 2QLVB 2DLIA 5JW5A 3TJHC 4ZPTA 4OD1H 1YPZE 5D7SH 4U0RB 3EGSA 4UV4L 3C8KB 2GTZA 2D7QA 5GS1B 1F11B 1CK0L 3P0VH 4YBLC 1CE6B 3BW9B 2XNAB 5B3NA 4AENB 4NNPH 4JANB 3U46B 4LSRL 3JBG7 2PF6A 3HR5B 1OGAB 5EZLA 3M17B 1DN2A 4QTHA 4ZAKB 4DEPB 4EQ3A 5DXWA 1MHHA 5FF6B 3ARBA 1K4CA 5HPMB 3BPLC 3FFCE 5LBSH 4Y1AE 1T22A 3VGGA 1DQJA 2J8UB 4R3SB 5KAQG 1Z2KA 2IBZY 5ADPH 4XPFH 5MEQB 3CXHJ 4DGIL 3AU1A 4DUWA 4FTVD 4FTVA 5IOPA 3MODH 3WKML 4RNRA 4LVOB 3Q5OA 4GW4B 4MZ2A 5BOPA 2VIRA 1ZSDB 5HI3C 3QIUB 4PJ7F 1IC4L 4NC2B 4LSQL 5ANMA 3NZHH 1YEIL 4UILL 1E6OL 4FQ2H 4GT7A 3BZFA 3SOBL 1J18A 3OB0H 1E4JA 2N1KA 3FQXA 1BIHA 2X2YA 3J8F7 4YE4H 1M6OA 5CP7B 3ECBA 1YN7B 2Z8SA 3U36B 1IVLA 2AJ3A 1T5WB 5GRJL 1AQDB 4RGND 5IBTH 1P9MC 4HXBH 4LLVA 2OTWB 5B21A 5GGTA 2XKNB 3EYUH 4KRNA 1EBAA 3I85A 4LLUB 1MRFL 4DKFL 1OW0C 1CFQA 1RZGA 5IB3B 2EO9A 3NVQA 2NTFA 1BPVA 2BXYA 2P49B 5DEFA 5CEXA 5HYFA 5E5MB 5LG1A 5JOPE 3WO3B 5GGTH 2JJSA 4U7SA 4M3JA 4WUKL 5E2WL 3QDMD 5FGCB 1BBJB 3MZTA 1AE6L 4H26A 5JNYA 1HXMB 1NGWA 5K59F 4NYLA 4OLXH 3UROR 2HT4D 1YYMH 1S9VB 1RZ8A 1AGCB 2C3GA 1TXKA 1MHPL 2OS7A 5ID1B 4MWFA 3KPOB 1FL5B 1RJZA 5BVJB 3UEZA 2EKJA 4XHJD 3ZKMC 3WDIA 1JNNL 3BN9D 4KHXH 1A6ZA 2AKRA 4LSRH 4NO2A 3GI9L 3MR9B 5BVPL 1NMBL 3SGKC 4LCIH 2QSCH 2KZ1B 2CUIA 1I3GL 3QCTH 1QEWB 1C12A 3TCLB 3N9GL 3CXHK 4EIZC 5E99L 1UJ3C 4MNQA 1JPGA 2AAVA 2QQLL 3U0PB 3VWJD 1IFHL 3TBVA 3S4SG 1LP9B 1MSPA 3KPMB 43C9A 3THML 5T3XL 1M7IA 4K8RC 4ZDHA 1EERB 1D9KC 4ODVH 4UINL 1GGIH 3WKMH 3O9WA 4PJXA 4PGDA 5D7LA 4QRRB 5F7KC 3MUHL 3RBSA 2FHFA 4PY7A 4QHMA 2H41A 4D8PB 5KZCB 2C26A 3VXSD 1MQKL 1IC4H 2BNUB 1YEIH 3OMZA 5CZKA 2Y36L 2P1YA 4HCRL 4HH8A 4XMPL 1I1FA 4KZDH 1XGYL 4YDLB 1CE6A 2P5WB 3BW9A 3BRDA 1C8PA 1TJGL 2EXWC 5D2LF 5GRJH 4LU5L 1IC7L 3EYSH 1LE9B 1NCWL 5D9SB 1OCWH 5T33H 4Y2DB 4K3DH 1MFCL 3L1OL 4ZAKA 3CC5B 4I5BB 3UO1L 5BRZE 1FBIL 4DKFH 5FF6A 3S97C 4PRHE 4KJPC 2J8UA 4Y89A 3UYPA 1RK1B 4PRBB 3T0XA 4WUKH 5E2WH 2IFFL 1N26A 3TBSA 5BO1L 4GW4A 4HIEA 1JF6A 2B2XL 1ZSDA 3NPZB 2ENSA 4PJ8B 4PJ9D 1BQLL 5L9DH 1MHPH 4JM2B 3D2UB 4KROD 3O6MH 1OP5H 5D1XB 4PLJD 1TITA 2XTJD 4GFTB 1OD9A 1JPFA 2DQJL 4RCAA 4YDVA 3MLUH 1F3DH 1DP0A 3DHJA 3GI9H 1LGVA 4F7PB 3FCTA 4KHTH 5BVPH 3OGCA 5CP7A 4OV6F 2ICEB 1NMBH 1T5WA 5CJBA 4LCWE 1AQDA 5T3XD 3OR6B 2R0KL 3V6ZA 1I3GH 1KJ2B 2OTWA 3BHBB 3SE4C 3TYGL 4LLUA 3IDXH 4L4VB 1MEXL 2QQLH 3ZSSA 4KQ3H 1IFHH 1FVDB 3IJHB 3BX7C 2YPLD 2YPLA 2MQ3A 1FGNL 3QRFM 1MHCB 5B38G 4HCRA 1IAOB 1LP9F 5B8CB 2R69L 4WI4A 2J5LC 1FRGH 4J3TA 3BUTA 1QVOA 4OB5H 4HV8B 4LKCA 3V6OE 5I71B 3ULVF 1PYWB 1JVKA 2Y6SD 1MNUL 4JKKA 3O6FC 2IANB 1MQKH 5DRNB 2CDEB 4K3EH 4H0IA 2PR4H 4RMWA 3MJ9H 1KC5L 2R1XB 3C60C 4XMPH 4PJ5E 3KPOA 5A2LH 1FL5A 2P8LB 5J57B 3U4AA 1MCFA 3QIBD 3QIBA 5JPMA 1T0MB 1J1XH 4P2RD 4P9ML 7FABL 3G9VA 4ZUUB 1IKFL 4XNYL 1DL7L 2ZSWA 5EC2B 4J8RA 1CQYA 3RKPA 3G04B 1MFCH 3UO1H 3EO0A 4X7TB 1QEWA 1PY4A 3TCLA 1GGUA 3FT3B 5T5NF 2KL6A 1S9KC 2WSKA 4HWBH 5K9OB 4OGYL 3V8CA 3VXOB 1KLGB 1VFUA 1P53A 1BIIA 2B1HL 1IGCL 1YY8B 1U6AL 1PKOA 2IFFH 3K8LA 2YRPA 4KKBD 3RTQD 3RTQA 1EIBA 1UA6H 5GISL 3U2SB 1KGCD 4TULL 1FYTB 5KSVA 2ESVB 5BO1H 4QRRA 2OL3B 1V05A 5EBGA 2A0LC 1Q9LA 5L0QB 1PEZA 1CLZL 4MAYC 2AGJH 4OF0A 1KB5L 3PV6A 3KPRB 2V5MA 1I9JL 4KTEH 4G43A 4OAWB 1NFDE 2ZJSH 4PJDB 4ZO9A 4APQB 1LO4H 3VFTA 1HN1A 2YMXL 4I4WA 3V7AG 4N0CD 3VWKC 1C5CH 2P5WA 4NC0B 1VESA 4WI6A 2EDWA 2FL5A 3PWJB 1ZT1B 1LK3L 4HIIB 2R0KH 1G7LB 3WKNA 1N6QL 3W39A 5D9SA 4Y2DA 1ZLWH 3QEQE 5DHVA 3NIGF 4I5BA 3I6GB 1ZEAH 4IHOA 4S0SD 3QQ9D 5DQ9B 4YBQC 4JO2L 4R6UA 1ADQA 4M02A 1FGNH 3E8UL 2VLRD 2NY7L 1CDIA 5IHUH 2HTLC 4PRBA 3ARGC 3LIZL 5KVMC 2CKBB 4OLUL 3AY4A 4ZFZB 2CR6A 3H8NA 1HSAB 1MNUH 3QHFL 1FZKA 3WNLA 3GJFA 2AEIT 2DJSA 4GG8A 4GAJL 4PJ8A 4DVBB 4M62L 3M07A 4JM2A 1JI2A 2I07B 3D2UA 4LHQB 3IVKB 2NPLX 2LU4A 4UMGA 3KYKL 1ES0B 4X0KB 4OKDA 2DQDL 3MLTB 4J7RA 4NKQB 3VFWB 3WJJA 4HWNA 2A6KB 4UQ3B 4P48A 3GMLA 3EFDL 1PG7L 4DW2L 4HK3N 4OLZL 1NCDL 5D6DA 1MPAH 3KNBA 5E94B 4ZXBD 3TA3C 4WIQA 4AL8L 3L7FB 2QQQA 3OR6A 3RGHA 3TBTB 1KJ2A 3RPKA 3RUGB 4X4YB 2J8OA 1ZOXA 3IFLH 4L4VA 2BVUA 4X6BA 4JZOB 2EDEA 2X05A 3IJHA 1A6TA 4NRYA 4F7MB 4NGHL 4ODUB 1U6AH 2R1YB 5I2IB 5GISH 4JZJC 1S9YB 2Q86B 3DVIA 1R5WB 2YKLL 2HT2C 3QNZB 4BYHA 4RSVA 2DLHA 3SDDA 3SDDD 3VG9C 5DRNA 3UZVB 3MV7E 3NFSL 1NDMB 3ZTNL 1D6EB 1KB5H 2Z93B 4PTTB 4PLKD 3V5KA 5C0EB 1I9JH 2NX5E 1OY3B 3PHSA 4M7ZB 4TNWF 5D7JD 5D7JA 5JW3L 2X4UA 5LQBL 5C1MB 3ARSA 2V9RA 1WBXB 4CU6A 1ZVSB 5DK2B 1T0MA 4PJDF 2VDMH 3GDBA 4X6DA 1RI8A 4ZUUA 1LK3H 1CR9H 5EC2A 1N6QH 4PG2A 3G04A 4LARL 4XBGB 1MRCL 1L9MA 4TOYL 4HPOL 3G6AB 4X7TA 1QFUL 2UZXB 2IH3B 3FT3A 2CUHA 3TH2T 4JZNA 3ZKQD 5B39G 4L1HA 2X6MA 1VFMA 1J8HB 5DT1L 3BH9B 3LIZH 1T7WA 2MKWA 1J0KA 4M1CC 3SQOL 4B7IA 1JWUB 2UWEE 4ZOBA 3QHFH 1WWBX 3AS1A 3QEGL 4OCSL 1WISA 2OL3A 1T1ZB 4MHHI 3VD7A 3D18A 1DBJL 4BQ8A 5J12C 2WW8A 3O2WL 4JFZL 4M62H 1P2CA 1WZLA 3KHQA 1NGYB 3NCYS 1HHJA 5FV1L 1UEYA 3KPRA 3KYKH 1CLOL 4UT9L 5EZJB 5FOBA 4ZNEE 5INDB 4GS7C 4APQA 3SKJL 2GCYB 4RMUA 4DW2H 3DX9B 4OLZH 1NCDH 2AV7A 2AXJA 3TC9A 3C6LC 4FZ8L 3OAUL 4N8VB 1G7LA 1N5AB 2B7DT 2FSEB 3I6GA 4H25B 2B8OT 4HK0A 3RUGF 4PGCB 2WANA 4I2XB 3C5ZA 3BEWA 1RY7B 4YC2B 2O5YL 2YKLH 5GRVL 5DLML 5F7EL 3ULUL 4R0LC 1T04B 5D1ZC 2I24N 3EZ8A 4NQEE 3LEXB 1NCUA 4TVPE 2F9BT 1Q8MA 1B3JA 3ZTNH 3TO4D 1UACL 5DD3L 1RUKL 3QBTB 5LCVH 1F2QA 5FM8A 3IVKA 3VMOA 5JW3H 4X0KA 1F90L 3MLTA 1E28B 3B3IA 3MJ8B 3JWNC 4UQ3A 3HPLB 4LOUC 1NSNL 1OTTD 1YUHA 5CCKL 3FONB 3GM8A 1PJ9A 5F3BB 1OTUD 1MJUL 2VLJD 4RDQF 4X83A 4CVWA 1NKRA 4LARH 3WJLC 5J11B 3FHQA 1F3DJ 4TOYH 1DDHA 5F7YC 3W9EB 5LGJB 3TBTA 2XY2A 1F5WA 4QTIH 1CXLA 1QFUH 4XT1C 1OTSD 3TVMB 1DBML 1MWAL 3AUVA 5L6YH 4YPJA 2P5EA 4JZOA 4KJYB 1IAMA 5I73B 3DURA 1WZMA 2AEPL 2ZCHL 4HBCL 4ODUA 3V7MA 2RCSL 5I2IA 4LK4A 2Q86A 1ACZA 1R5WA 3RDTC 3FQRA 2PCPA 3QNZA 3QEGH 4XP9L 3DUUA 2VUOA 1DBJH 1A7PL 4XVSL 5DJXB 1XR9B 5KS9B 1UH3A 3PP4L 3GSNB 3B5TA 1D6EA 2Z93A 1YJDH 4J3WA 5C0EA 1AGFB 4OGAC 3OKOA 1CLOH 2YPVL 4UT9H 4QF1A 3RAJL 3MCKB 3B83A 1XGPA 4M4PA 4ZTPL 3KYNB 5EU6E 3BP7B 5DJDB 3NCYP 5DK2A 4XP5L 4D9QD 3GO1L 3WFBH 5L8JB 3DWTA 1AIFA 3LKOA 3MUZ1 4HKJB 1W72B 5DWUH 2IFGA 4G7YL 4HS8L 3U1SL 3ULUD 3G6AA 5JXED 2IH3A 3IS0X 3V8OA 3LKNA 2OP4L 4LEOA 2YS4A 1CGWA 2VDPL 3EYQD 4XXCA 1R5IA 5GJTH 4M1DH 5JIKA 1J8HA 3DYPA 1J11A 2O5YH 2WAHA 2AQ1A 2YN5A 4WO4C 4GRMB 1I3RA 4J1UB 3ULUH 2G5BB 1YPZF 2JCCE 5HYIA 1JWUA 2NW3B 2VN7A 3D3VD 3AMLA 3D3VA 5ID0A 4NQDB 1T1ZA 4K3GA 1PAMA 5ITFA 3LN5A 1NAKL 3SO3B 2ZUSA 3BGMA 5DD3H 1G7PA 2DQCH 1U9KA 5HD8D 1SVCP 2AJVL 1YMMD 3SBWC 4LNRB 4OZ4B 4N1CA 4P5TB 2C1OB 4NC1C 3QFDA 4LLQB 2HYMA 4HUMB 4KXZH 2P46B 2GK0B 1FGVH 3D5OF 2IAMB 2FR4B 2GCYA 1MWAA 1NSNH 1EHXA 4ELMB 1GIGH 4OLYL 3GSNL 3REWA 3EJZD 2YD7A 3UJTL 1WQVT 2P47B 2PW2B 2H9GB 2FWOA 4DZ8B 4JO4L 4LQ1A 4G6JL 4L5FL 1KPVA 2MCG1 4E41E 3H9HB 1WAAA 4N8VA 3UXFA 4P2QD 1JGUL 1N5AA 4WU5A 1EVUA 3FRPG 4PREB 2FSEA 3BJLA 4PJBB 5SWZE 1KJMA 1TVHB 2ADFL 1EJOH 2APBA 2BOCB 4UB0H 3VFRB 1BD2D 2E9JA 3O4LD 1MCDA 3O4LA 3MOAH 3RPIB 5D72L 5DHYA 4PGCA 5JPNA 3QRGH 1L0YA 5DJ8A 3UZQA 4I2XA 3BQUC 4HBCH 2BHZA 2ZCHH 3D0VA 2RCSH 1U36A 2X4QA 1CG9A 3RWEB 3OKMB 5F9JB 1AO7D 5EU3B 5EU7E 5AEAA 3FMGH 3ARED 3AREA 4XVSH 4JHBA 4JKPL 3GK8H 4EQ2A 2DIBA 3QUXC 4MDJB 4PJCB 5KS9F 3HS0B 4GKNB 4ODSL 2WWKO 4K94L 3L5IA 3QG6B 4U1IA 4R26H 3MXWL 4GLRH 4X6CB 4OF6A 1E28A 2EC9T 1H0DB 3MJ8A 1OAUL 25C8H 4XP5H 3HPLA 4LSTH 1MCNA 2UUDK 2IALB 1F58L 1ZHBA 4JO3H 2R8SL 5F3BA 2NCMA 5E70A 3GM0A 3IB4A 4IOFC 3S37X 2EO1A 5C0CB 3W9EA 5LGJA 1FNLA 3FO1A 3TVMA 3QEHA 2OP4H 3IDIA 4U3CA 2VDPH 1IAIH 1EEZA 3IFOB 3WLWC 4M6MH 4KJYA 1VACA 2J4WL 3C09B 5HI5D 4WFHD 3MRIB 3O8XB 3FJTA 1FORH 5ALCH 3TN0C 4XI5C 2E7BA 2LV4A 2BHYA 3FB7B 1WZKA 2HLAB 2P7TA 4RGMC 5ERWB 3WUWA 2ADIB 3DXAD 3DXAA 1IGJB 3PGDB 5FUZL 4KK5D 1NAKH 3GSNA 2CIKB 2HFEB 5HHVL 1HQ4B 2ZG1A 5GGQH 4X4MA 5A3ID 4XCFH 3V95A 3HUJB 1RPQA 5E2UL 1AGFA 1NL0L 4XBEL 4M6NL 4AT6A 1GGCL 3SE3A 1AI1H 2KKQA 3AS2A 1NMCB 4YFEA 4Q6IC 5HVHB 1J1PH 3BP7A 5DJDA 3WBDA 2C3HA 4FQCH 4JO4H 4L5FH 3NA9L 4ELMF 4KKAD 3FB6B 1JJUA 2ADFH 5ILTL 2WK2A 2K7PA 4JRXB 1M7DB 3DARA 4N0YL 4XWOD 3WNMA 4F3FB 3QFJD 5D72H 3HZMA 2W60B 4PRPA 5CBAA 1Q94B 1DQMH 2DWEA 1MCJA 3QIWC 2A9MH 2BMKA 1FG2B 3QDHA 4GRMA 3UDWC 1HEZB 1UXWB 4LPWA 2LU3A 2NY4D 5LKNA 3G6JA 4LCYA 4NQDA 2C9AA 4KY1L 4KI5F 2Z35B 5L2KB 2GFBA 2ZUQC 1RFDL 2NXZD 2BY2A 2BP3A 4PBXA 1CD0A 4K94H 5LWYH 4OZ4A 4P5TA 3IDJB 3MXWH 2MQ0A 4OIBA 5IT2L 2HVKB 4M00A 4MD5B 4PJCF 5I16A 1XFPA 4M1GL 2GK0A 3EW3B 1N0XL 3U0WL 3GJFK 3HE6C 3N1QC 3QUZB 4YGAB 2D7MA 2OZ4H 3QNXB 4LVHC 4TTDD 2GJ6E 2PW2A 4PR5B 5I9QB 5DVKA 4DZ8A 2XPGB 1S8DB 5I15L 5BMFL 4QLRA 2AQ3A 3H9HA 5EC1B 1ZT7B 4D9LH 4PJBA 2DQFB 5C7XH 2BOCA 3MV11 4PG9B 1RULL 4KUZH 3MYZA 4B7LA 3CXDL 3L3IB 3U9UB 2DL9A 5F9JA 2P8PB 4S10A 1MH5B 2VQ1B 2DLGA 3L9RA 4R90L 5CUSH 1S7TB 1HKFA 1SHMA 1M71A 5C0ND 1JYWA 2P24B 3N0PB 3BUYB 3OAYK 3QUKA 2EXYC 2VLKE 1EEYA 3QXAA 4EVNB 1NL0H 4ZFOL 4YZFE 3HS0A 4GKNA 2DJ4A 1WT5A 1LWRA 3MGAA 3MV8D 4S11A 3QG6A 3BEVA 3H42H 3HUJF 2D7NA 4LHJB 4OCYL 4X6CA 3ARFD 3ARFA 4LLDB 4WEMB 1KTDB 4V1DB 1GH7A 2IALA 3V0WH 4I0PD 3NA9H 4YHKL 1IARB 3H9SE 3FT2B 3K4ZA 3MUGB 4WVRA 1JGDB 1PX3A 4DCQB 5ILTH 3DVFA 4MMZC 1BZQK 2XZQH 5GSRB 4O58H 2JELH 1IM3A 3UMTA 1JTOA 1LNUA 4AM0B 1X4ZA 4KFZC 1HNGA 4ZSOB 3MRIA 1EAJA 2VJXA 2NW2B 5EZIL 3FB7A 5FOJA 4WWKC 2LFGA 5DZOA 3KLDA 1I9EA 1A4JA 3PGDA 1RURH 1IGJA 3MLZL 4OGXL 1VGKB 5D96B 3CSBA 1F4YL 2HFEA 5BW7A 1HQ4A 4I48B 5JZ7D 1WVZA 1YEGL 7CGTA 5BCAA 3NGBB 2Z92A 3CFKB 1OQXA 5IT2H 1X5IA 4NM4L 3VFSB 4B50A 4M43L 2YOCA 4M1GH 3FT4A 2EECA 3BT2L 1VFAA 1YECL 3HI6H 2HRPH 2ATPA 2HVJB 1BJ8A 1VA9A 4P59L 4WDIA 1TENA 5BS0D 5BS0A 3O3EB 5BMFH 1RIHL 3GUTB 1FFOB 2Q20A 3FB6A 5IQ9A 4R96B 1J05B 1TETH 5GS0L 5DUMH 1H8SA 4HFWB 4UT6L 4NNXB 4JRXA 1RULH 1SQ2N 1FIGL 4Y8DC 2DJUA 1PZ5A 5DJ0B 1TFHA 4IEFB 5AYQA 4B53A 4P23D 3CXDH 1Q94A 4RGNE 3DROB 4LSPL 3HB3C 2CRMA 2DDQH 4RX4A 4R90H 1BOGB 1UVQA 2Z4QB 4HWZB 1UXWA 5KW9H 1YA5A 2XN9D 2XN9A 4HPYH 4AZ8A 1NFDF 2YUWA 4G3YL 5FGBC 3GIVA 3PHQB 4QRSB 3BI9X 2YN3A 2Z35A 5L2KA 4OZHE 4QWWD 5I8EA 2J12B 3WFDH 1ETZB 3QDME 2CGRL 2FGZA 1DLFL 3ISWA 4JFDD 2HVKA 4MD5A 3PQYD 1QRKA 3GBML 1RUAL 2MOVA 1X9QA 2OXHA 2OI9B 3G5VA 3FO0L 4YHKH 1B6UA 1JYXA 3S35H 4NP4H 4PR5A 2XPGA 2FATL 5EC1A 3WO4C 4WFGE 1HYRC 4ZTOH 2OMBA 5EU7C 3TIEB 4AIZB 1NDGB 4PJGB 2DQFA 2UYLB 5EUOE 2YXFA 1DANT 4PG9A 2DMBA 3RWIB 3KXFD 1II4E 3KXFA 4JEGB 4Y5VC 4I9WE 1A9BB 1EEUA 1MY7A 3OJVC 1KJ3L 1PEWA 2YWYA 3IT8D 5FKPA 1JFQH 3L3IA 4OJFL 3U9UA 3LZFL 2VKXA 2P8PA 5I1KH 5F8RC 4YH6A 1TDQA 4G9DA 1I8KA 3CK0L 5DA4A 1SJVA 2ADGB 4O00A 5TH2A 2QADD 2Z91A 4QYOB 1H3PL 4F8QA 1R3LB 5T1LB 3VRJB 2D31B 3UX9B 2Y5EA 1CXHA 4ERSL 5JHDB 1GSMA 5CEYB 4HIJB 4RQQA 5HGBB 5IB5B 3MRDA 1A7NL 5FA3B 4LLDA 4P59H 5CP3A 1B0RA 2W0KA 2YD5A 3O41B 3CVHB 4Q97A 1RIHH 3T4YA 5EO0B 2AK1L 1H3UA 1NCCL 1JGDA 5C0AE 1AD9B 4DCQA 2VDRH 5HHOE 1BEYH 1C16B 3H0TB 2VDNH 5D1QB 4U05A 3QWRA 2E8ZA 3JUYA 1I7ZB 3GEWB 5H94B 2IQ9L 1Q72H 2FLRT 2EYSA 5BXFA 1I9RH 2D0HA 4XHQA 4ZSOA 5SWSB 3X12A 4Q9QL 4PJIB