3G04A

Crystal structure of the tsh receptor in complex with a thyroid-stimulating autoantibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
212
structure length
212
Chain Sequence
b'LTVLTQPPSVSGAPRQRVTISCSGNSSNIGNNAVNWYQQLPGKAPKLLIYYDDQLPSGVSDRFSGSRSGTSASLAIRGLQSEDEADYYCTSWDDSLDSQLFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN THYROID STIMULATING AUTOANTIBODY M22 LIGHT CHAIN
publication title Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2009-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g04A01
1T04A 1LD9A 2AK4D 1UCBH 2Q8BH 4NHUB 8FABB 1HZHL 3EDJA 4MLIA 4N9OB 3WIFB 3B9VA 4F2MB 4HX1B 4LPVA 3RHWF 4WNQB 1PEWA 3OGCB 3G6AB 1DE4B 2N7AA 3P9LB 3PP4H 5CFHA 3PWUA 5KSVA 4WU5B 4XP5L 3BGFB 4JFEA 4LVNB 2V2WA 5E8PB 4O9HH 1IGMH 3DROA 4FP8H 4QWWC 3OXRA 4KHTL 3UJJH 3LKPB 2IAND 2KZ1B 4H0HB 4Y16C 2BXYA 4P99A 1EO8H 4Y4HB 1JZ8A 1IC7L 3T2OA 3KPSE 5CSZA 1NBVH 3DX8A 5CEYA 3WNNA 5FYLH 1G6RH 5KSUA 3V6FA 1QSVA 5D5MB 5I1GL 4MXVF 1R5WB 4U1JA 4UV7H 1NMBL 1UYWL 1U6AL 3QWQB 1RUAL 4GSDH 3CLEH 3T3MF 4IIQC 4J7RA 4GUPA 1OP9A 5D7LB 4U1GC 4PTUA 4X6EB 5DLMH 1CGUA 2F19L 4NRYB 3DSFH 1MQKL 5E6IB 3D9AH 1A3LH 1HWGB 3MRBA 2ZKHH 3ARBD 3LH2H 5DS8A 3VXSA 3QCTL 4OZIB 4OBRA 3TO4D 1XGYL 4D0CA 5HPMB 1KT2B 1T83A 3NA9L 5E8EA 1FE8L 2X70B 3TVMD 3VFRB 5IB4B 4DK6A 1BX2B 3HI5H 4XRCA 1A1OB 3BN3B 4P59L 1MFCH 4PJGF 4DFHA 3HC3L 4HC1L 4ORGA 4G8GE 3RUGA 1KLGA 1WBZA 4XBEH 2ILLA 4MA3A 3NFSH 4LSRH 4NFCA 3DIFB 3INUH 3CFDB 4QHNA 1OOAA 4P46A 3AY4C 5GISH 1BF2A 3SDXA 4HH9A 1PG7X 1C1EH 2QEJA 4FZ8L 3NABH 1KXTB 5F1KC 4QT5A 4LCCB 1AD0B 4KAQL 1TZGH 1UVQB 4WI3A 1YEDA 3RWGA 1IAIL 5GGSY 1ED3B 3P9MB 5B8CC 1GH7A 3U46A 3GO1H 4QOKA 43C9B 4JKMA 4HBCH 5FK9B 5FM5M 3LKRA 4YPJA 2XFXA 3RNQA 5GJTL 1YECH 1JPTL 1FVDB 4TUKL 4HGKC 3MRHA 5BZWB 2AK4E 5JOFA 3GM8A 3OPZH 3TT3L 1DANU 5SX4H 2ADIB 3L3OB 1HE7A 5E8DL 1E4KC 1NDMB 5DZLA 3JXAA 4NJAH 3X3GL 3MNVA 3QFDB 2HFFB 1QO3A 3W2DL 4HIJA 3BDBA 2K7PA 3P11L 3VXRD 2NW2A 5IV2A 5B38B 5DDHB 2AJZB 2IANE 3TLRA 5I75C 3BKML 1L7IL 2F58L 1NAMB 5F7NC 1KCVL 2X4OB 1QR1A 5JMRA 4K9EH 1PX4A 3L9RA 3QEHB 1FGNL 3LRGA 4MNGE 1K2DB 4GRWB 2EH8H 4NNYB 1EH9A 2LU7A 3LEVH 1IKFH 3REVB 2ZG3A 4AEIH 2R9HC 4FQQB 4LOUD 5BVJB 4FFWC 4Z7NF 1T66D 2ZJSL 2XKNA 4N0UA 3AU1A 4AEHH 4RGNC 4QXUH 5A2JH 4OLVH 3BX7C 3FB5A 4OQTL 3NAAH 4TNVK 1U0QA 2VDRL 3UYRH 5C07E 3WEXB 4LLMA 5C0FA 4EQ3A 4C56D 5HHVH 4PJ8D 3MBED 4IOFD 3QULB 4YQXH 1FFPA 1LO3L 3DVIA 3SGEH 1Q72L 2OL3H 5I9QC 3O3BB 3MA7A 4H20L 2ICEA 3HG1D 4TUJB 4O58H 5HVFB 1X5FA 5HGBB 1QP1A 2B2XH 3SKOA 4HUMB 3V6OE 1U3HD 5F97E 5LXGL 3GJEB 4FNLL 1HKLL 3KLDA 3K4DA 2AABH 2YD5A 2RR3A 4H1LB 2R2CA 5DJAA 3ZHDA 5D7IA 3PL6D 4YAQA 4JGMA 4OF0A 3TNMA 1R5VB 4WHYG 4ONFL 1G9ML 2FL5B 4OLXL 1P9MA 5JXEA 1SQ2N 3EFFA 4NQDA 4W4OC 1EFXA 4QTHB 5EBLB 4P57A 3KYOB 1S7RA 1YY9C 3BP6A 5C0GA 5EORL 2C3XA 3MLXH 3MZGB 2EO9A 4LASH 1J86A 3S3JA 3U0PB 3NPZB 2VC2H 1IAII 3Q5TA 3DRQA 2F53B 4LP5A 2JJWA 4MWFB 1SYVB 3DHMA 4CW1B 1EEYA 1FO0L 5KS9A 3T0EA 5HGHB 4MXQD 4WO4B 2EIZA 25C8H 4JPKL 4U7MA 3VXQB 5GZOC 1BQHA 3V52L 5F8RC 1K8IA 3VFMB 5IHZA 3BPOB 5C0IB 3OKEA 5FKPB 3V5HB 4RSVA 4U1KA 2WBJD 1NFDB 3BZFB 3IKCA 4MAYC 5EO1B 1MCEA 4N1EA 1YEGL 4Y5YB 4Z5RA 1I7UB 4L4TA 4PLJC 3QHZH 4Q58C 5DQ9B 4I48A 4Y2DD 3FO2A 4JM2B 4XI5D 2DD8H 3VXRE 5TQ0H 4C4KO 1DQJB 3DX6B 1MREL 3X13B 1J88A 4HIIB 4DN3H 3RGHA 1G7JA 4JCMA 2MHAA 5F9OH 4AIXA 1RK0A 5EU4A 1AIFB 4I1NB 3TH3T 3ZSTA 3UBXB 1Z3GH 5L6YL 5KTEH 1UH3A 3GMOB 3DYOA 3LD8B 5LVEA 3X11B 3IAGC 4XVUD 5DMGD 4PJAE 4JFDB 4OM1L 5EC1B 4HJ0C 4GXUM 4GBXA 1OQOA 4JE4B 5C6PB 1FNFA 1NGPH 4JFYB 1R3KB 2OTWB 3GSNA 5HDOA 4Z0XA 3BGFC 4XXCA 4LVNC 5FUOH 2V2TB 3U36B 3TO2B 5T1LA 1F4YL 3BP4A 3K8LA 5FOJA 4XPHL 1NCCL 4OI8A 1ND0A 5GZNC 5EO9A 3I75B 3PWJA 1UWEH 4C56E 4AEEA 4Y4HC 2WUBH 3CDCA 1M7IB 4MDJB 4QHMB 3ILQD 2HJLA 2H45A 4KRPB 4MCYB 3HG1E 4DGIH 1KJMB 2HKFL 2R8SL 2EDWA 1A22B 3IFPA 1FGVL 3L3IA 1FZMA 1NFIA 3BRDA 1N0LA 5EZLA 3GRWL 4X8JB 3DETD 1I9IH 3ISWA 3MODL 5DEFB 1UZ8A 4N0YL 1ZHKB 3L7FA 1YA5A 3RWFB 5L2JB 4WHTB 1X5GA 2W38A 1T5WB 2EE2A 3MJ7B 4GG6E 2OQJA 1NCAL 1EXUB 2AJSH 3QUYA 5E6IC 2VR5A 5HGGS 1UEYA 2FYYB 3QH3B 3DXAA 1X5ZA 1M71A 1U8QA 2CIIB 1RU9L 3C60D 1ZT4B 2EDQA 4JZNB 1A5FL 3JV5A 4QRSA 3U4BL 5DEGA 3UTZA 5JIIA 3EYUL 2J88H 3KLSA 1YNLL 1MJ7L 2APTA 3VRJB 3BH8B 1NEZB 3G5XB 1P4BH 4MNQB 3TA3D 1PY4A 4PJDE 2G60L 3CGTA 1A6WL 2YZ8A 4D3CH 1UA6H 2GSGA 2BHZA 2VAJA 4QNPE 4U33A 1MWAL 5J89A 1EDQA 1VFBB 1RURH 2VB5A 1IBGL 1ZA3A 1CFTB 4KI1A 1AP2B 3VH8G 2ICWJ 4OIBA 2J8HA 3ZDXE 3MNZA 4Z7UE 2D7MA 3IDNB 1QBAA 2J3SA 1QRNB 4J3WA 5T33H 2BVTA 3GJFH 2Y72A 4NFDA 5KJRH 3DVNB 3SJVB 1FYTB 3PDOB 1A6AA 3X3FH 3QEUA 4M43L 4L9DA 4LCCC 3BI9X 5DJ6A 1FNGA 4HEPG 4ZFFB 5KVFL 5T3ZH 1KJVA 2EECA 2XPGB 4NM8H 1B0GA 2CDGB 1TIUA 3MLRL 5I30H 1Q9LA 1A8JH 5IW6B 4TRPH 2YN5A 3S96B 5IFJA 4YH6A 3C5ZB 2A6JB 4FQIL 1KPVA 2A77L 1P7KA 4P2QA 4UB0L 4HZLA 4EI5A 5IB3B 5JIPA 2N56A 4B53A 1D5ZA 5C8JA 5HI5D 1DLFL 4YBLB 2NLJA 2AI0H 4JPVL 5FYJL 3ULVF 3T0XA 4Z77A 1TPXB 1KB5B 1FVEA 2JJTA 3ALPA 2CGRL 4XCCH 2DQTL 4GMSL 3RWEA 3THMH 1FIEA 5SX5H 3WUWA 1XGUB 2D4DA 1ZGLB 4NDMB 3MRLB 1S7WA 1ZSDA 4PTTB 1YMMB 4DGYH 1MNUH 4XVJH 1FYHB 3LN4B 4IRSA 3C8KB 5HY9A 2M8XA 5DUML 4N0FB 4KKBD 4I0PA 3GSXB 4JFXB 4LLWA 5IIEA 3S34H 3TH2T 4YHNB 3GMRB 5EZJA 1I1FB 2YPLA 3ES6B 1OVZA 5MERB 1KGCD 1KBGH 4NKMA 1R3JA 4JO1H 3H9SA 3RGVD 3M8OL 3V0WH 1MCLA 1A9EB 4MD5A 3MCLL 5BS0A 4ODTH 1Q9WB 2C3WA 43CAA 1FLTX 3AUVA 4AIOA 3N50A 5F7EH 1U8NA 5D7JB 4N0RA 5C7XH 3HMXH 4WW2B 5IB5A 4ZFZB 1MFDL 3ORJA 2J4WH 2HKHL 2J8UF 3M17A 1F3DH 4G7YL 2VKXA 5HXMA 3JV0A 4APQB 1R3HB 3KS0J 1EEZB 4LSVL 1A6UL 4RMUA 1D6VH 4MHHI 2M2DA 3WLBA 1NBZB 4U6XB 5DMKB 1OSPH 4QYOA 4CU8A 5F96H 1F6AB 2E27H 5ICYB 1YEIH 3UPRA 4NBYB 3ULSB 3MRQA 1I1AB 3SDAD 1PGRB 5I1EL 3VI3F 4EUPG 3TESA 2ZSWB 3KNBA 3OZ9L 5HJ3A 2Z8VC 5LGJA 1XAUA 1QBLL 2V7NA 3B8SA 2DIBA 4JDVA 5A3ID 1T0PB 1ZS8B 1FG2B 5EPMB 2ZOLB 3P4NA 2FHBA 1S9XA 4UILL 4DAGL 1F3DJ 2EEDA 1IEHA 1YEFH 3ARGD 1HWHB 5DRNB 5AD0B 4HC1A 3ALXA 3R0NA 4XMKL 5E99L 3RAJL 4QLRA 3NTCH 3JWNC 5EIVA 4F33B 1QYGH 3QHFH 1D5XA 1NAML 1B0RA 4J3TA 2P5EE 3T1WA 1GC1C 3P77A 4CUCA 1CZ8L 4OLYL 4RZCB 4WO4C 1FRGH 4XC3H 5J9PB 4MB3A 3O4LA 3BPOC 1I7RB 4XCYB 1ZA6A 4IRJD 1CDBA 2AERT 1OGAD 3SE9H 3TNNB 3S9DB 5DEZA 2DQIH 4MSWA 4Y16A 4Y5YC 2VQ1A 5AUMA 3MMEA 5AZ2H 5HI3C 5F9JA 5CBEA 15C8H 4L8BB 4JM2C 1EA9C 3P4OB 1GHFL 1NLDL 1MIEL 4YHIB 1CXIA 4KTEL 1OSZA 2MCG1 3X12A 3FRPA 3P3YA 2EE3A 4PGBB 1U2HA 1XCTA 1F42A 4PJIA 5JW5A 2YKLL 4H8WL 4P2OB 3KPRD 2H1PH 2BY0A 5GSRA 3LD8C 2FDBP 1ZANL 4CKVX 4KPHH 1GPOL 1KGCE 3KYKH 3MOAL 3Q48A 1IGJB 3NH7L 5IFAH 2A83A 1H0DB 2YHGA 5IQ9B 5TPWH 3V5DB 1KTDB 5MEOA 4LQFL 4J4PC 4NO0B 2I9LB 4OGXL 4YHOL 1URLA 4NYLB 4YXLL 1EHLL 2X05A 4YHPA 3O41A 3TBWA 5KANG 3GKZA 1X7QB 4CVZA 1S5IH 4JHBA 4P3DA 3B5GA 2HFGH 4XNMA 5DGRA 3ROLB 5SWZD 4KRPC 3MXWH 1ORQB 5I19H 4ETQB 3KPPB 3SGDH 5JHDA 4NC1E 4L8SA 3FO1B 4NC2B 5GRWA 2XKSA 2H9GB 3TGXA 2MPAH 4JQVC 4DN4L 3DO7B 4O2FB 4ZYKA 4OQTA 1V5JA 1RIVH 3S4SA 1RUML 1PDKA 2CRZA 1IM9A 2RFXB 5MEND 3IXAA 2Y07H 1DEEA 3VA6A 3TN0B 4XP9L 2IPUK 3E8UL 1JGEB 2DMKA 2JLLA 3DGCR 1KF9B 5B8CA 1N59B 5I1DB 3PGDB 1EGJL 2B0SL 2HH0H 4JHAH 3DGGA 2IALB 4M8QB 2VR4A 3MZTA 1F58L 1T0MB 3S3PA 1EUUA 1T21A 4RFNB 5EDXA 1IC1A 2X4SB 4X80H 1BGXL 4G7VL 1WZ1L 4RFOH 2YK1H 5L0QB 4X5WB 1CFBA 5D2NB 5D7SL 4JG1L 3KWWA 3P0YH 3GMNA 4MZ3A 1KACB 2AJXL 1E4KA 2P8LA 4RWHA 2VR9A 4K3HA 5F72S 3TZVD 2X2YA 4M5ZH 1OGAE 2AV1A 1AC0A 1NKOA 5EZOL 4HAFA 4P0DA 3H42H 2NY7H 2APXA 2X4RA 1JWSA 5FA3B 1KFAH 1BIHA 1J1PL 5I71B 5DA0B 4HKBA 3VD9A 1H9VA 3W9EA 3NFPB 1FO0A 4ELMA 2Q7YA 1LO2H 2DBLL 2PXYD 2X5PA 1BBJB 2VLRD 2WINB 3AXLA 4XB8A 2AKRB 2Z35A 4FG6C 4M62L 2FGWL 3MRJB 2GCYA 1WBXA 3RY5A 5IR1A 3P9WB 1Y6KR 4IOIA 1MF2H 3C5ZC 1F8TH 2A6DA 3GB7A 3OL2A 4G8FB 4IJ3B 3LB6D 4R26H 3HKFA 4OFVA 1KCUH 9CGTA 4JY5L 1LEIA 5JNYB 4U3XA 3TV3H 3FN0H 4JFFD 3UTQA 1WTLA 2AQ1A 4PJXF 4YBLC 1H3PL 3FHQA 3B6SA 4M6NL 3GIVB 1TPXC 4XNUH 1CICD 1NMCB 4LU5L 2UWEA 2EDDA 1I8IB 1J5OL 1MCJA 4YJZL 2QV2A 3I02A 1J8HD 1UM6H 1FDLL 3K3QA 4WI2A 5SWZE 1JGVL 3QFJD 1JPGB 3SGJA 3RY4A 2OR9H 5FB8B 2W9DL 5HGDB 5M94B 1C08B 2GYSA 4Q6IB 2VL5B 3KPSB 5AZEH 3OKKA 3VG0H 2H6PB 4L9LB 4I3SH 4OQ1A 5EA0H 3DURB 5DQDH 5DD6B 2EEBA 4Z8FL 4ZD3L 4YE4H 1CGVA 5DQJB 3HE6D 2G9HB 3NZHH 1A7NH 2YEZA 3QNZB 5D7JC 5MENE 2BNUB 1UJTA 1XF2B 1V3MA 4WW2C 5BV7L 4NJ9H 1OP5H 2ZUUA 3C9NB 3DUHA 1LK2A 2DIAA 1GVIA 1GXEA 1SBSL 2R29L 5I1IH 3O2WL 2X9XA 3AREA 3S36H 5CZXD 3GRWA 3WJLC 3OX8A 4APQC 2A0LC 3HHRB 3IS0X 3V6BR 4JDTL 3CPLA 4ZUSB 2R0KH 3E6FA 2CUIA 4X0KA 3HCVA 4PJBF 4K2UH 5CJOL 1IGCH 1WWBX 4ONHB 3FQWB 1CDYA 4UI2A 4B0MM 4RWYL 4MAYA 1S7VA 1FL5B 3CFCL 4HUUA 1LE5A 3STZB 1RZGB 1I1AC 4WDIA 3HC0B 1R5IA 5CD5C 3G08B 3UC0L 2MSPA 4G8GB 4NNXA 3C09B 5ID1A 1KTKE 3WFEL 5EIIA 32C2B 2FWOB 1RJZA 3ARDB 1S9YB 2ZG1A 4RA0C 1ZKAA 1W0WB 2XNAB 3MV7D 4JO4H 1I1YB 3QO1B 4UOW0 3S7GA 1WCBB 1F4WH 3U7YL 3HPJA 1WQVT 4ZUWB 3GBLA 3CVHL 4GRLB 1MWAA 4BKLA 2OBGA 5FYLD 4OM0H 1BWMA 3LEXB 3CFBB 1G7PA 1N2RA 1W0YT 2YS4A 1MCWM 4HS8L 5EZIL 2X41A 1BQSA 8FABA 4HS3A 4C57C 5LG1A 5I1JL 2HFTA 4HX1A 5DMIH 5T1MB 1OAZH 4ZFGH 2IPTL 4GO6B 4WNQA 3OGCA 3OV6A 2QSCH 3O6LH 4YGVA 1IZJA 5D72H 3P9LA 3QP3A 4WU5A 4KC3B 1HHHB 3MLSL 5E8PA 4QRPB 2O5YL 5CGMA 2VXUL 4JFFE 4FQXB 1TVHB 3K1DA 1WWWX 2V5MA 3EKCA 4YUEH 3MV9A 4R3SB 2AK4B 3QDJE 4NP4L 3CIQA 5KSAA 2EKJA 4NSKB 1G7MB 5FOBA 1RJYB 1SYSB 2VNCA 1Y18B 2Z9TA 4EVNA 4Z7OE 3VFTB 5J57B 2C9AA 1E4XH 2UZYB 4LCIL 3QIUD 4EQ2A 3RWJB 2ITDB 3BMWA 1VGEL 5IMLB 3QIBA 3VJ6B 1DBBH 5K59F 2IANB 4J3SA 2COQA 1UZ6E 4P2OC 2BNQE 3WFZA 2FO4A 5BRZA 5D7LA 3ZYJA 3CU1A 1AKJD 3WN5B 2X4TA 5IQ7L 1FNEA 4FFVC 4CAGA 5IWLC 3SGKA 5DD5H 4MNGB 1BIIA 2EEAA 4X5LA 1OAYL 3BXNA 5F1SA 4OZIA 1XT5A 3VWKD 3MUGA 5DJ0A 4PJ7E 2NPLX 4XCFL 1GIGH 1JHLL 3O6FD 3WNOA 5IB4A 4YDJB 5EU7E 1KEGL 4BH8A 1BX2A 4GQPH 3KJ6H 3VW3L 4YLQT 1CGXA 1PYWA 1QNZH 3CXDL 3ARBB 5C07B 4U1IB 3TO4B 4DTGH 1MRCL 1E4WL 3BWUC 4U2YA 1DTUA 4Y88A 3RVXD 3SE3A 3WFBH 5J3HD 3IFLL 4U1SB 3TVMB 1YYML 2UUDK 5DUPL 5EWIL 1MCRA 2J12B 3V2AR 3LKOB 3HC4H 3MBXH 4ZDHA 3MLYH 1HEZB 2Y6SD 5CP3H 3IDMB 5IMOA 3R4DA 3FT3B 2IAMA 4C55A 3DUUA 4LLVB 4PP1D 1JWUA 1D5BA 2C3VA 4Z95H 4HV8B 3UJIH 1DQTA 3TN0C 3QZWG 5GGVL 3V0VB 4XTRD 4Y89A 4MS8D 3MV7E 3S8WA 1M6OA 4GXVH 43C9A 1MHHB 1TXKA 4TUOB 5FK9A 1IGTB 3RDTD 1EO7A 1AGBB 4RFNC 1I9JL 2V5SA 1IFHH 2QQKL 5FYLE 4QHLB 4BSVB 1AC6A 4M00A 1JNNH 4TTDD 2AXFB 3QJFA 5DFWH 5L0QC 1L9MA 3RVWC 5D2NC 2FX7L 3QDGA 1Z0MA 4ZNEA 4OB5H 2PTVA 1CG9B 4DW2L 4DVRH 1VFAB 3DMMA 3JTSB 5JPMA 3QFDA 2HFFA 4EBQH 4TTGA 3Q6GL 3QXDB 3EYFA 3RKDC 2FZ3B 4E41D 4Y1AA 3NCJL 1LDSA 4Z7WA 5I71C 5IBUG 1NAMA 4ZSOA 3HFML 3T3ME 2HFEB 3MRKB 1ZK9A 1A7QH 4NQED 2A9MH 2XWTB 3QEHA 3RIFK 1EPFA 3N9GL 1I3VA 3VXRB 5I18L 3FT2B 5JDSA 5I1LB 4CVXB 3LS5L 2DQFA 2DQDH 5DTFA 4YEFA 3M45A 3NZ8B 3MRGA 1IL1B 1MCFA 4OLUL 1CFVH 4FQQA 5BVJA 4IJ3C 5ID0B 4S1SH 4Y4FA 1R0AL 3PHQB 3BISA 3GKWH 3G5VB 1OTSD 5HVGB 4XNQB 4NRZA 4XGZB 2R1WA 2YUVA 2VE6A 5BXFA 3GSUB 4LSSH 4KI5F 3V5KB 4PJAB 4YPGA 1N6QL 3OJMB 4IEFB 3MYJA 1NMCC 3EJYD 2QSTA 1BAFH 3FFCA 3QULA 4E42B 4MYWB 5HDBF 4AK1A 1XGRB 3O3BA 4JKKA 3QRFM 4IDJH 4PRID 3WUZA 5D1ZB 1OQXA 3BP7B 2HN7B 4LIQH 2VDML 4C56B 4K3JH 3H9HB 1T2JA 2R4SL 5IKCA 2Y7QB 3BQUA 3MBEB 2IADA 3TBTA 4Q6IC 3EYVA 3L3HB 1R5VA 3HG1B 4OAWB 2JKXA 4L9LC 1FAIL 4NHCH 2FL5A 3FOLB 4WFHE 4WUUD 3ULUH 4V2CB 5EUOE 3W9DA 4DCQB 1PG7H 2IG2L 2XQBH 2JB6A 4X4XB 4FRWA 3PWNA 5HDQL 3NCMA 1T2XA 1ULVA 2ZP0T 2DICA 4WU7B 4GG6B 3PL6B 1B3JA 1A6VL 3QEGH 4F7MB 5KSBF 3QNYB 3WNKA 3W82A 4OTXL 4M61A 1EIBA 4DKEH 1OW0A 3VXQA 3S88H 3ZYZA 2CLRB 4PJDB 3QRGH 3Q3GB 2LU4A 5EO1A 1U92B 4ZUVB 4IRZH 2P7TB 3C2AH 2LQRA 4NO3B 4P49A 5F7LB 3C09C 4JGJA 1EGJA 4Y5XA 4Q9RL 4PRHD 4FQJL 5IEHB 3GSRA 3DX6A 1DQDH 3ARDC 2BZDA 5I2IA 5JR1L 4Z7UB 4XCEB 3WDIA 1FZJB 2CO6B 2WBJB 2VDOH 4MCZA 4G6JH 4BZ2H 5H2BA 4WTZG 4U31A 4GG8A 4GRLC 4L3ED 3VI4E 1IE5A 4Z7NE 1RPQA 3ARYA 4JPIB 4Y2DB 5K9JH 5CINH 1NGXA 3RU8L 4NO2A 4KJPC 5CUSL 4JFDA 5D2LA 2QSQA 1HIML 1IQDB 4NQSB 4Z76B 4PV8B 4JFYA 4XVSL 2OTWA 4J4PA 3U36A 3TO2A 4Z78A 1OD9A 4FQXC 4R4FL 2IPKB 2ATKA 3D39D 5C09D 1WFNA 4ZOCA 2GY5A 4NQCA 3I75A 3BH9B 2APWA 1IAIM 4MDJA 4YHMH 3DWTA 4QHMA 5DK2B 1YQVH 2E7CA 3ALWA 2HMIC 4MCYA 1TVBA 3OXSB 1KJMA 5FDWB 3MPCA 5L7XH 5HHPB 1BD2E 1CFNB 3ZLQC 4XHJD 4PRPD 2Y4SA 4FFZH 4PB9L 1KJ3H 3JWDC 2D7QA 2P5WD 2R0WH 1ZHKA 3QSKB 2J7LA 3RWFA 1OY3B 4F3FB 2AJ3B 3L7EB 3IF1B 1VADB 3WN5C 1I85A 1I8KB 5E70A 1EXUA 3ARFD 3FQUB 1QA9B 3AMLA 3FN3A 1P7QD 4LKCB 4UIKH 3WHE1 4J2XA 2FYYA 1DVFD 1AJ7L 2HG5B 3H8NA 4M1CD 2CLVA 3RUGF 2IBZY 3BW9B 3I6KB 3V4PH 3TIEB 2SEBA 3KHOA 2HT4D 1MJUL 2JB5L 3G5XA 5T3ZD 3SDXF 3AS1A 3ARBC 3NIGF 1KCRH 1D5MB 2P8MB 5ALBL 1LP9A 3C60B 3TO4C 2VXQH 2J5LB 3GEWB 3UTTA 3A6CL 3GK8H 3KYAA 3R8BB 5J1SC 3TVMC 4P5TD 3TYGH 1VGKA 1BOGB 3DLQR 1EMTL 3TA3B 4U6VL 3O11A 5KOVC 4J3UA 2CKBB 1KENH 4POZD 1WFUA 3V6OC 2MQCA 4RMRA 4EDXB 1CDGA 1ETZA 4PJFA 3DSNA 3SJVA 1FYTA 4Z7QF 3PGFL 4ZUUA 4ZFFA 5IHLB 4KUCF 1T1ZA 4HJJL 5IROC 3P4MB 3HUJF 2Q6WB 3QIWB 3EFDH 3QUKA 3NPSB 5FYJU 4JR9L 2ED8A 3OKLA 4M7LL 2FR4B 4IMKA 4L3EE 4G42B 5C86A 5IW6A 1KC5H 5F71A 2FSEB 3S96A 1JPSL 3C5SB 3C5ZA 4HWBL 1RUPL 1MCHA 5DC4B 1L7TH 4J3VA 1Q9OB 2XA3A 3JWDL 1VPOL 2H32B 1WFTA 3BZEB 5IOPB 2NZ9D 4TSAL 2P5EB 3V6ZB 3KPLB 1KLUA 1IC5L 3D39E 5C09E 3CVHA 1J05B 2DF3A 1CU4L 1ZE3C 2XY1A 1XGUA 3UTOA 2Y9RT 1M1SA 3MRLA 2YSSB 3WFHA 3T1FA 1YMMA 7CGTA 4KQ3H 2I60L 2K7QA 3CZFB 3C8KA 1JF5A 4DGVL 4M1GL 4YC2B 4LDLB 3H3PL 5L8LB 4JFXA 5IFHH 3LOWA 4FQCL 3N1PC 2GTZB 4YHNA 4XPBH 3IGAB 1WSST 1EJOH 5MERA 4PRPE 4OFIA 2FRGP 3OB0K 5LCVL 5FF6B 1FCGA 2P5WE 2H3NB 5EUKA 1OHQA 4DQOL 4AL8L 3DPBA 1EAPA 2P24B 4L8DB 2FD6H 3HR5B 1YDPB 3WD5L 1A9BA 1UKSA 1G9EA 1YPZE 2B7DT 4AIZB 3GBMH 4BFIA 4UIMB 1MCWW 4MX7B 35C8H 1CXKA 3G5YB 4TNWF 4Q0XL 4WW2A 2FIKA 4YFEA 2IGFH 3TJHD 3UDWC 2ZPKL 4HSQA 1AY1L 4QF1A 2ZUXA 4LOUC 5D7IF 1T66C 1F2XK 1JZ2A 5T3ZE 5D1ZC 4QTIH 3IS1X 1OTTD 3RY6A 1F6AA 1ORSA 1HHKA 3F7YB 5ICYA 2IC2A 3ZSSA 5ACZB 4PJ9A 4TOYH 3MBEC 4OCSH 1MVFA 2DL2A 2DTSA 4WEBL 1E27A 1BM3H 2ZSWA 4ZO9A 4JM4L 4XC1H 5BMFH 3KPMB 4RRPG 5EPMA 4HUWA 1RV6X 1RZKH 1UJ3A 1IEBB 2AJYL 2LFGA 2YMXH 5HDLA 2CPCA 1A47A 3LKSB 1P4LB 1FZOB 3TPUA 4HWEH 1QSED 2BOBA 3PL6C 4Q9QL 1NPUA 5HYSB 4U1MA 3BRGC 4RISL 2I07B 5C08E 1OGTB 1RIHH 4GFTB 4RZCA 2NXYD 4E5XB 1XZ0B 1NANH 1AGCB 4J1UB 5J9PA 4OZFG 1I7RA 3I6LD 3OF6D 4XCYA 4ZPVB 1KG0B 1MVUB 4C83B 4LRIC 5J6HB 4BQCA 1MCNA 5E5MB 4KZDL 1JP5A 3FN9A 3HNSL 1CIUA 2VXVL 1MAML 4V1DD 1A4KA 4S1RL 1G7LB 4HUXB 2VITB 4WHDA 1SVCP 4EOWL 1QPXA 2DQHH 1A3RH 3HNTL 3P4OA 4LVEA 5TFSL 4D8PB 2BMKB 4YHIA 5T1DL 4IRJB 2WBJC 1OGAB 2VABA 3K1KC 3QG7H 1KIPA 3LQAC 4LSPL 3QWOA 2NY5H 1C5CL 4KHXL 3CCHB 4WTWA 4PV9B 5EOCL 3KPNB 3BWAB 3PQYD 2F5BH 3R0MA 4Y2DC 5HD8D 1MFBH 1RQ5A 3HAEB 3FMGH 3KDMB 5IWLA 2A9NL 5IQ9A 1NGQH 4GRMB 4HLJA 2GJ6D 4IBLT 2H2SD 4PB0L 3GSNH 3E6HB 3OKNB 4IOSD 1F13A 3R06A 2I9LA 2HVKB 3VRIA 1DDHB 3KPRB 5C0CA 4LAJH 1LDPH 2CMRL 3L5WA 4XPTH 5DMGC 1YN6A 3JSSA 1X7QA 2CH8A 4YHZL 3IFNL 3I50H 1A4JB 3ARQA 4PIRF 4M7ZB 1YEHH 1MRDH 2PR4H 3RTQD 4JRXD 1JNJA 5DD1H 2V2XB 4F37K 1U8LA 4D9QE 4F80A 2E8YA 3I2CL 5B39A 3QJHA 5CWSB 3PV6B 5F21B 4JKPL 4I0KA 3DO7A 2GSIB 1KNOB 3ULVL 2BNRA 3S37H 1SVZA 4M5YH 2R39A 3ILQC 4LSTL 4LCWD 5SWZB 1NGWB 3LMJH 4NN7B 2G2RB 2IQ9L 1P4IL 4LRNL 3E2HB 5EU6A 2AEQL 5E2TH 3ZE2F 3DETC 2VAAA 2FJFA 4F57L 5C1MB 5GRJH 4LHUD 4S2SB 5FO7B 2AEIT 4UT6L 2BSSB 2A1WH 4LKXA 2IALA 4M93B 5TH2B 5IGXL 1QSEE 3UZVB 4EUPA 4HIHA 5IMKB 2W9EH 4P2CG 1Y0LA 3U9UA 5IG7A 3UXFA 3U2SA 1T1XA 5DJDB 3FKUS 3JV4B 5MENB 3WDJA 5IT2L 3OR7A 2UZIL 1W0VB 3C60C 3UROR 1S9VB 2J5LC 5D2NA 2HP4A 1U41A 1C7TA 1T2QH 4G5ZL 2PN5A 1FNHA 4HEME 4H5SA 4K07A 3MFFA 4XVTH 2CDEA 3DRTA 3TA3C 4XMLL 3D69A 2P1YA 3SBWC 2UY6A 3RJQB 2R1YB 3CUPA 1YEJL 2C3HA 3EYSH 3QQ4A 4JVPA 4NUJB 1CTNA 4X6DE 4FTVA 1V8HA 3L3DB 3U6RB 1CK0L 3TEUA 2DKSA 2AJUH 4HMEA 1IJ9A 4N0CC 4V1DE 2NW3B 2Q86A 5C6TH 5JORB 4JN1H 1I9RH 4Y7MA 3U4EA 3T4YA 3L3KB 5TQ2L 1CBVL 3O6KH 1FN4B 3VGFA 5FYKU 3MUJA 3T0VA 4UDUB 2DLGA 3SCMD 3QIWC 3TZVB 2AKRA 3NPSC 1TETL 4I5BB 3D2UA 1NMAL 3VFWB 1YC7A 1HDMA 4LCYA 2BJMH 3DYPA 4K71B 3PQYE 4G8FA 1ZHBB 3DV6A 4HS6A 5DD3H 4RBPK 3FCTB 2VLRB 3IXTA 1YNKH 1B9ZA 2GJ6E 3PWPA 4MA8H 1TCRB 4PJGA 5MEPA 5F1NA 5JW3L 5EB9A 1LK3L 1CWVA 2QHLA 3PWVB 2PYFB 4BUGA 1JN6B 3GBNH 4I18B 4OKVB 1T3FA 4JFFB 4CADA 3ROOA 5DUBB 5HI5C 5BVPL 5JDJA 1Z9SA 2Z8WC 3BD4A 2P48B 1I4FA 4R90L 1HZHH 4YC2C 4JRXE 2F54D 1RZJC 1CICB 2X9WA 2EXYD 2J2ZA 1N5AA 3Q6FB 1XIWD 1C08A 4LLYB 4XP5H 2Q20A 3DTXA 1XH3A 1U58B 5DD6A 3I9GL 4KHTH 4PJ5A 5EG6C 4PREB 4LCWE 2ITCB 5C0AD 4KKBC 3VGDA 3IJHB 1IC7H 2BNQB 2DM3A 2BNUA 5J6GB 1CT8B 1HQRB 2BRQA 4N68A 4LL9A 5MEQB 2V9RA 4AYFA 1V7NL 4F9PC 5I1GH 1H8OA 4M4PA 2KQNA 1XGTB 4JRYE 4WEUD 3PGCB 1NMBH 1UYWH 1U6AH 5DJYB 1CF8L 4QRRE 3WKNA 1RUAH 1F97A 2NY2D 4HQQL 3EOTL 4PJ7B 3HE6B 3ILPB 2LVEA 3WLWC 2O26U 5E8OB 5E95B 3V7MA 1HI6A 2F19H 4ONHA 3FQWA 2EYSB 1T1YA 1MQKH 3KHQA 2DWEB 3PHOB 3T04D 1IT9L 3DBXB 2VISB 2RBLA 3D0LB 3G5ZA 3STZA 2O61B 3REWA 3K7UA 4YDIL 3QCTH 3RZCA 2A6IA 1XGYH 3G08A 5JLZA 2DLFL 5H94A 3NA9H 1FE8H 1LO4L 3LSOB 4NC1C 32C2A 2FWOA 2RCSL 5IJKA 1W0WA 2EYRB 4AENB 3LKQA 4NQUA 3BIKB 3DVFA 4MVBD 4P59H 4ZUWA 4KDTA 1ZWIB 2EDLA 4NQXB 2NTFB 1N8ZB 2PO6A 3HC3H 4HC1H 1AXSA 3W11D 4DKFL 3RBGA 3RHWK 1FFOA 5A3IC 3QUZD 1II4E 3S5LG 3TFKD 3X14A 1YJDL 4KJWD 2QKIB 3MV7B 4BH7B 4LK4A 5C0ND 1CLYL 1GZPA 4RQQA 2BX5A 2P4AB 3VWJD 3MLWL 2NY3D 4FZ8H 4QRPA 1G6RB 4PJEF 1TVHA 1O5DT 2MWCA 3NIFF 4KAQH 4X83A 3BKCL 3OKYA 1IAIH 1OPGL 5EU3A 4NSKA 1G7MA 3QXVA 1EHXA 1KCSL 4YBQD 1G9NC 2O93L 1E4JA 1GCFA 5GJTH 1T5XB 4G80A 1JPTH 4EI6B 1H3XA 5J1AB 4HWBA 4IRJC 1D6EB 1UCTA 1BFSA 3EZ8A 5IMLA 5L8KB 2VUYA 4TUKH 3VJ6A 4NRXB 2E9WA 4L4VD 2IANA 2F54E 3TT3H 3QEQA 1JJUA 5E8DH 3WN5A 2HWZL 4PJHE 4LQ1A 2AVGA 5DA4A 3QIUB 3X3GH 1L6ZA 5JXAL 1KXQE 4NBZB 3SKMB 2GEEA 3W2DH 3P11H 4CL7A 5DJXA 3BKMH 1L7IH 2F58H 3OAUL 5C0AE 3CXHK 1KCVH 4P2RD 1BLNB 3T2PA 1AKJB 2HJKB 4NZDA 3QNXB 2WWKT 5C3TA 2GKIA 3TPKA 1FGNH 3SN6N 4M7ZC 4FQ2L 3L6FB 3ARBA 1TZHB 3OR6B 3ZE0E 4RCAA 5MP6L 6FABL 3BEWB 3TO4A 4G6ML 2IEPA 5CIPA 2E7LC 1B88A 3VFGL 4PP2A 2JELL 3O6FB 1XR9A 1K8DA 4U1SA 4PRAB 2ZJSH 3GMQA 3ARVA 3O8XD 5ERWA 4LEOA 3IAQA 4KV5F 1CDIA 1KN4L 4OQTH 4Y4HD 5D6DC 1CS6A 3TWCL 2XWBA 3VXOB 1MCKA 4NN7C 4X6FB 1L0QA 3FT3A 4LLVA 3OJDA 4S10A 4HIEB 4I3SL 3E2HC 1LO3H 1Q72H 3EDKA 4EDWL 1MCOL 4H20H 3V0VA 4TYUA 1QSFD 5HYQA 1SJVA 5B3JF 4Z7VF 2OSLB 4Q6YA 2N7BA 5I8KL 1MHHA 5EUOB 5HHOD 2NX5D 4M93C 5L2KA 2V9QA 3MX0A 5LXGH 3BD5A 4FNLH 1HKLH 4M7KL 4QHLA 4UBDD 4BSVA 5E6ID 3G6JE 3W81A 1VKXA 5CGTA 2IBGA 1PX3A 1TITA 4ONFH 1G9MH 4OLXH 1XFPA 3G04A 3QPQD 4KK6D 4KGJA 4OD3L 1S7TB 1YUHA 5E00B 2PKDA 1JRHL 1XR8A 3D3VD 3RDTB 1G7HA 1VFAA 4M03A 5EORH 4K8RL 3QXDA 1B0WA 1DZBA 4RAVB 3HZKA 2AQ2A 4U1LA 1U8HB 5K59E 3KYMA 1FO0H 2XZCL 5CKAA 3TZVC 2XWTA 4JPKH 3V8OA 3GSQA 3V52H 3VXRA 4L4VE 4CVXA 1BZ7B 2UWEF 1CFQA 5JPNB 3NZ8A 3ARTA 1CGWA 2VDQH 5F89A 4K71C 5CBAB 1XCQB 2A2QT 1YEGH 2OL3B 1LO5A 4NKQB 2W65A 5DHYB 4XNQA 1I7TA 3ULUD 4BA8A 2JIXA 1MREH 4MJ6A 4N8VB 3MCKB 2CD0A 1TVDA 3H7BB 1HXMB 1XGRA 1ZT1A 1BQHG 1OCWL 4P2RE 5L6YH 5HHNA 2X4PA 4I18C 1MHPL 4DZ8A 5LBSL 5T5NF 3KPOA 2HN7A 3EO1B 2H41A 4KJQD 4P9HL 2X7LB 4OM1H 4C56A 1CICC 1CE6B 1CXFA 3H9HA 4PJ8A 3RWCB 4U7KA 2Y7QA 4GKZB 2GT9B 1VFMA 3JWOC 3HN3A 1F4YH 1WUNT 1BD2B 2AXGA 4XPHH 1NCCH 1RD6A 2EC8A 1U3HA 1UXWB 4A2MA 3SDCA 2WW8A 3VXUA 5ESAA 2XA8L 4F7PA 2XIDA 2OK0L 1CDUA 5AYUL 1HH9A 4LAQL 4F7TB 1FV1B 4GG6A 3PL6A 5KAQF 1QSFE 3LS4L 3LCYA 3ARZA 2HKFH 2R8SH 3VFSA 5C71A 5ESQB 4LCUB 1FGVH 3H6JA 5HHOE 2NX5E 4XBGB 3QNYA 3GRWH 2HVJA 3V4VL 3MODH 1PKQE 4N0YH 4UU9A 3HE6C 3BEVA 3QZWA 5DHVB 4WEMB 5EU7C 1HILB 1NCAH 5GS1A 3H0TA 4LRIA 5TDOA 3F7PC 4PJDA 4AM0A 1U92A 4YHYB 4PBVC 2P7TA 3WHXB 3D3VE 4QGTA 5CZXC 1RU9H 2GAZB 3VE0A 2HJFA 3FRUB 3C6LD 1JRHI 4JFED 1A5FH 3U4BH 2G5BA 4XPGL 4GAYB 4JFOB 4LMQI 3EYUH 1S7QA 2KZWA 1VFUA 4NQTA 3SOBL 1YNLH 1MJ7H 4XCEA 5FO8B 4GOSA 1Z9LA 4XPAL 2G60H 1A6WH 4HKXB 4KDWA 1JZ5A 1YZZA 1E6OL 4U1HB 1INDL 1EVUA 1MWAH 2XTLA 2GHWB 4Y19D 1IBGH 2X09A 1GGCL 3TYFB 3GIZL 2DWDA 3RJDA 4YDVA 4LIQE 4LSUL 4AG4L 3CFEB 5GSVA 1CFSA 1T7WA 1U95B 3KR3L 4L3EB 2J8UA 1NFKA 4YHLL 3RWHB 2ENYA 2OJEB 2KKQA 4M43H 3ULUE 5FM4A 5LJYH 2R2BA 5KVFH 1A1NB 2DLTA 3F65A 3T65B 4PBWD 3BH9A 4JZOB 4FMKA 4Y5VA 3MLRH 4WO4D 4D9LL 5CP7B 2K3TA 1ZGLP 1TJGL 5IB2A 4IS6B 3RL1B 3WJJA 2ICWB 3QDMA 4FQIH 2WBKA 5DFVD 5HHPA 2A77H 1CFNA 2P45B 5I16B 4XNZB 3D39B 5C09B 4NPYA 3AB0B 4OZIF 2ZWLT 4BFEA 3F12B 5IW1B 4UB0H 4YK4B 4X7TB 3RVVD 4KJYB 2FGZA 4FXGB 4PY7B 1DLFH 2AJ3A 4F3FA 4JPVH 5FYJH 3IF1A 3TP4A 1MHCB 5ICXB 1I8KA 3QIUC 1D7FA 3FQUA 1QA9A 3VA2C 4QY8A 3QXWA 2CGRH 5HVHB 1HHIA 4KQ4L 2DQTH 4GMSH 4MDIB 3C87A 2R0ZL 1U8JB 4IHOA 4PRPB 2VL4A 5KSBE 2E6QA 3U0WH 2P5WB 1ZAGA 3LZFL 5E1AB 5GIRB 3GJFK 1FZKB 3TIEA 1CE1L 5DUMH 1YPZB 5CEZL 1XMWA 1P7QB 5DF0A 4QOKD 1DVFB 5ISZE 3BYTA 4J23A 2JJVA 3SPVB 1D5MA 3BUTA 2B4CL 3M8OH 3MRRB 2R2EA 1NC4D 3O6FC 5IEKB 3MCLH 4ODXB 5KOMC 2Y5EA 2FJHA 1DSFL 3HZVA 4P5KA 5ANMA 4EDXA 3TT1L 1CLCA 5I66B 4NKIL 3BGMA 1MFDH 4JFEE 2F74A 2HKHH 1MH5A 4G7YH 4W81A 4LSVH 1A6UH 1GGUA 1KB9K 1EEUA 4DK3A 4UTBL 5SX5K 1PZUB 4AEFA 2B20A 3ELAT 2Y6SC 5DRWB 1KIQB 2B1HL 1JZ4A 4G42A 2FSEA 2OTPA 4G6AC 3C5SA 4Y19E 4PP1C 5CSGA 4MJ4A 4OLZL 2PTUA 4PGCB 1XGPA 5I1EH 1XF5B 4Z7WF 3OZ9H 4MS8C 2IBZX 1QBLH 5GRUL 3VMNA 5T1KA 4DWHA 4WTZA 2DTML 2XACC 3RDTC 4UILH 4DAGH 1X9QA 4MNQD 1OWWA 4FHBD 4GRWF 4K9EC 4TTDC 1JE6A 4XMKH 4ISVB 5E99H 2I5YL 3RAJH 5K93A 3C2AL 3JUZA 1NAMH 3K81A 3CZFA 2H26A 5HYJD 3QUXA 3MV8D 1I75A 3FQTB 1CZ8H 4OLYH 2VYRE 1IRAY 2OLDA 4JQIL 3X17A 5ESVB 5DK0B 5JA8B 4JZJA 4GRWH 3T3PE 1HCVA 3U1SL 3H9YA 4LF3B 3GSWB 3I6GB 2QHRL 5FF6A 3IETB 5J7CC 1U42A 3OAYH 1K6QL 3RUGE 1SY6L 4HHAA 1YDPA 4PLOB 2YN3A 2X1PA 3U7AA 3F8UB 4HXAL 1NBYB 3LHPL 4XAKD 5KG9A 4MX7A 5JXED 1EFXD 4Y4KA 1P5VA 4OGYL 3SDXE 1GHFH 1B2WL 1NLDH 2P42B 1MIEH 3NIGE 5EBMB 4KTEH 2EZ0D 3SQOL 3RGVA 5C0EA 2G75B 3OWEA 4DUXA 1N4XL 1MFEL 3IDXL 4HFWB 2YKLH 4H8WH 1HQ4B 4KK9D 4DZBA 1OTSC 3BYYA 4R0LA 3HZYB 1LNUA 1ZANH 4QOKE 3IB4A 5CD3A 1MLCB 5CHNB 1GPOH 2DN7A 3ARUA 3MOAH 3NH7H 4NNPL 1IAKA 3GZKA 3ARPA 4ZAKA 4WFED 2ZUYA 3C08L 3EGSB 4OSUL 3DJ9A 1QFOA 3RWIA 4B41A 4ODUB 4LQFH 3BKJL 4OGXH 4YHOH 4I2XA 3BOVA 3RX7A 3V8CA 1ZHNB 4GKNB 3EYQC 4MJIA 4YXLH 1EHLH 3KPMA 5MI0B 1G7QB 4WIQA 4HUVA 3FRPG 2NTSP 1IEBA 4X99A 2VLLB 1K5NB 1J0ZA 4L4TD 5INCB 4HGWB 3IDIA 1FZOA 4U05A 3SDAA 4I3RL 3VFPA 3TBVB 4D0BB 1HN1A 2IH1B 2R15A 1AGEB 1OARL 5F3BB 2Y5TA 2BERA 4WI9A 4DN4H 5SWQA 3QUML 4PJXA 5IF0A 3QG6A 5BOPA 4JM2F 3ZHKA 1RUMH 4MAUL 4J1UA 1AGFB 3ARGA 5D7JD 4WFGD 1QSEB 1I3RB 3MRIB 3VD3A 3ARSA 1KG0A 4W6WB 1C8PA 3CMGA 4LPCA 4NT6A 1P2CA 4YHYC 2QL1A 4O51A 4JLRA 4XP9H 3E8UH 4APQD 4AJ0A 5F1OB 2VZTA 3C6SB 3FQRA 4N0UE 2NXYB 2VZ3A 1EGJH 2OI9B 2B0SH 4I3GA 1BZ9A 4NGHL 1F58H 2Q8AL 2W0KA 5F6IB 1N0XL 4D8PA 1JGDA 2BMKA 5DC0A 3FTGA 1HHJB 2ADFL 2DBJA 4IRJA 3V0AC 1OGAA 4QRUA 5DJCB 5E03A 3V9FA 5TF1L 4X6DB 1BGXH 1SEBB 4G7VH 1WZ1H 5HYJE 4PGEB 3MV8E 3T0DA 4V1DB 3KLAB 2DKMA 5D7SH 4JG1H 5ACMA 4GJTB 1S3KL 3QPXL 3OB0H 2E9IA 4WWKA 2AJXH 5DURD 3SE4A 3HS0B 1HSBB 3KDMA 5EZOH 4JN2A 5SV3A 3ECBB 5D7IE 1MFAL 5E6YA 1J1PH 1DDHA 3KPRA 4XAKE 4ONGL 2FX8L 1Z5LB 1VACB 3PQYB 5GGQL 4NQDE 4XWGL 3DXAD 5CJBA 4LPWA 2DBLH 2FLBT 4PJBA 1A4JA 4M62H 2FGWH 2GJ6B 2ESVD 4OCXL 2GITB 2V2XA 3RPIA 1XF1A 2VLJD 4XNZC 5CWSA 1EFQA 4R96B 3AB0C 4Z18A 3RA7L 4JY5H 5IB1B 4OFPA 3MROB 4R8WL 3T0EE 5KS9E 4YK4C 1WITA 1QBML 4Z0BL 2XZQL 1R3LB 3SEPA 1H3PH 3MRFA 4M6NH 5SWZA 4ZTPL 1KN2L 3RTQB 4JRXB 1A6ZB 3PABB 4LU5H 3ZTJG 5HVHC 2APBA 3AM8A 1J5OH 5I76B 4NZRL 2PW1A 2X4UB 4XHJC 1T6WA 4BZ1L 3QA3A 1BJ8A 2EE9A 5GGRY 1MCPL 3UTSD 1G0YR 1IC4L 3RWDA 1Q8MA 2GJZA 4S2SA 4PS4L 4UDTA 4L4TE 1A6PA 3AROA 1FDLH 3UJTL 2BSSA 3ZZ1A 4LCWB 4HCRL 1JGVH 4P3WA 5AWNL 2NMSA 4GW4B 4WHYH 4HKZB 2W9DH 1QPPA 3BHBB 3O9WA 1Y6MR 5C0JB 4F9LA 4RRPA 1DVFC 4XAWL 4M3JA 4M1CC 4PJFF 1W0VA 4QRTB 4KUZL 4LLDA 3B3IB 4LHUB 1BPVA 4FXKA 3FB6B 3MRDB 1MJJB 4Z8FH 2NNAA 3LY6A 4JRYB 4ZD3H 5FUCE 3N1QC 3EJJX 4QRRB 1M05A 2HLAB 2HT4C 2ZNXA 1WZKA 2FB4L 3O3UN 2KDGA 5F1IA 3W5MA 4EI5D 1U8OA 4WV1B 1S7XA 1B4JL 3OHXA 4OUOA 5BV7H 5CILL 5FO9B 5JORA 1T89A 3SGEI 2JF1A 3KG5A 4RFEB 1F2QA 4OT1L 1SBSH 2R29H 5F7DB 3O2WH 2PUQT 4OZFA 4ODWB 1FN4A 2YWZA 4WTXA 2BCKB 4JDTH 2CXKA 4R6UA 4UDUA 1YMHA 2EDFA 4POZC 1P1ZB 3VFWA 5D1QA 4ZFOL 5T5NG 5CJOH 1CD8A 3MJ9L 4DOHE 4RWYH 4I0PD 3CFCH 1C12A 5T3XL 1AFVL 3N1GC 2YPLD 3SDDA 3WE6B 3UC0H 2PXYA 2VLRA 3SCMB 3H9SD 3WFEH 2AP2A 2D0FA 4G9FD 4U1NA 4Y2OA 4AT6A 1BFOB 4U0QB 5BS0D 1TCRA 4M9OA 4PGDB 1HYSC 2Z93A 3U7YH 4KZEL 2HRLA 3PHSA 3CVHH 4I4WB 4JFQB 3DXAE 2BSTB 1K4CB 5KAQG 4OKVA 4P5MB 5D71L 3HNVL 5EBWB 4HS8H 4U3HA 5EZIH 4TPRL 2ESVE 5CMAB 4YXHL 4XXDB 1OP5K 3S36X 3GUTA 1REIA 5I1JH 1OP3K 3PNWB 3QAZB 2IPTH 3CAFA 2BP3A 4LLYA 4RIRA 2VLJE 4UT7L 3SO3B 1PJ9A 4WW2F 5E94B 1JTOA 4MHHG 4K7FA 3MLSH 1DUZA 1U8IA 1YY8A 3FOMA 2O5YH 2VXUH 5JHLL 1J8HA 1U58A 1CXEA 3EOAA 4NP4H 4QRQA 2BVOA 3QFJA 1JGLL 2F54B 2BHUA 4OFDA 3VGGA 1JK8B 1XIWB 2VIRA 1JHTA 2NY1D 1RHHA 3K2MC 4PJHB 4XPFL 2HRPL 4LCIH 4AH2B 3UTSE 1AXTL 3JTTA 5GRVL 1FC1A 1VGEH 4F58L 5DSCA 3STLB 5C2BL 1DBAL 2FEEL 1MCSA 1TQCB 5DJYA 1NC2A 1NEUA 1FORL 2O5ZL 1QLRB 5C0AB 4PJ7A 3FONB 1A7PL 4LLQA 3UCRA 1A14L 1ZLVK 1DUYA 2EO1A 1U3YA 4TULL 1BJ1H 5IQ7H 2EYSA 4Q9BA 3TJHC 1J0HA 3DBXA 1JZ7A 2O61A 1PQZB 1OAYH 2J6EL 4OJFL 3QWRA 3W39B 2DJSA 1L0YA 2WM0A 4MNHB 2NY2B 4XCFH 3K0WA 5MI0C 3HLAB 1JHLH 3H9ZA 1OTTC 1ONQA 1KEGH 1LWRA 3VW3H 3EAKA 4AENA 1GGIL 3SHSA 3MSPA 3CXDH 4LGPB 3DX7A 1NCDL 3W0WD 1MRFL 4NQXA 4W6XB 3KPSD 2C1OB 2GQHA 1MRCH 1E4WH 1KPUB 4Q2ZA 1SHMA 4IMLB 4NWUL 3N06B 2NCMA 3IFLH 3VCLA 3CLFL 1YYMH 4YNYB 5DUPH 5EWIH 1QG3A 2VKWA 3JVGC 4EN3A 4RBPH 2ICWI 1K3ZA 1WWCA 3QBTB 2QLVB 2YPLE 3HB3D 2E7BA 3H9SE 3G6JB 3QUZB 1T22B 4G9FE 3BN9D 5GGVH 3ZL4L 1MCCA 5BS0E 2MCPL 1FJ1B 2NXYC 4LHJB 2OI9C 4JB9L 5F7UA 3MUY1 4JAMB 1MUJA 4JY4B 1I9JH 5F6IC 3VWJB 2QQKH 5J1AA 2NY3B 3CFKB 4LBEB 3WS6C 3MLTA 4GW1B 3VMPA 1OM3L 4UT9L 2VDPL 4NRXA 1WGOA 1ZVSB 3IJSB 2FX7H 2C4FU 1C7SA 4KVCL 2X4NA 3HPLB 2Q76B 5E5RB 3NCEB 4O2CB 3SDYL 1BEYL 1KTRL 4DW2H 4KK5D 5JHDD 2EICA 3ARDD 3QIUA 1LO0L 5AYQA 5KVDL 3F7VB 3KLHC 3HMWL 3SKMA 1AQDB 3Q6GH 4BQ9A 4ZUTA 2EE6A 5M95B 3CH1A 1DN2A 4L4VB 2VUOA 3NCJH 5D9SA 1QLFA 5CGYD 5I8EB 2C7UA 3HFMH 1WJ3A 1JNHB 4YDKL 5HD8C 1IM9D 1EVTC 1BLNA 1QLEL 3LV3A 1AKJA 2OS7A 4KJPD 3MRMA 4L5FL 3QNXA 3D87B 4WI6A 4N9GB 5GHWL 3N9GH 4PG9A 2CDFA 4X9FA 3CK0L 3OR6A 5I18H 4GAGL 5J56B 3LS5H 3N0PB 3BEWA 2YPVL 3UO1L 3VWKA 1LEKB 2FEEI 4OLUH 5HYFA 1SY6A 4GW5B 4OD2A 1R0AH 3O6FA 4P2RB 3SE8L 4KH2A 5B38G 1BBDL 3GHEL 3EOBB 1T03L 5E4IA 2HTKC 3VXOA 2CIKB 4WWID 5EO0B 3RTQC 1N6QH 2HMID 3C2SA 3U30B 4X98A 4ELKB 3SKNB 1M7DB 5C0DB 1BFTA 4PG2C 4XH2A 1IGFL 5GS0L 3A67L 3WS3B 3O8XB 4CN1A 1NJ9B 1TJIL 2GW5A 2XWJA 5JW4R 4EZMA 1DBML 4ODSL 4U6HA 5TDPB 1CYGA 3UPAA 3W0WE 2VDMH 4EUPH 2YD3A 3BVNB 2R4SH 4BQ6A 3S97C 5SWSA 2RIKA 3MREA 5E2UL 1BVKA 1LEGA 2DQJL 1BP3B 1QSFB 3NIFE 4PJIE 1FAIH 5INDB 4RNRB 2R1XB 2Z92A 4R4BB 5K9KB 1XF4B 5HHOB 2NX5B 1CVSC 3RDTA 2IG2H 3VGBA 3Q5OA 1DJSA 3V7AG 4J8RA 1PKQB 1FLRL 1LHZA 3QCUL 5HDQH 4WV1C 3S5LA 4H25A 4L8CB 5C07D 4I8DA 3IU3A 4HWZB 1A6VH 2H8PA 3P73A 1U8HA 3K8MA 1ZHLB 3RVTD 5C70A 3D3VB 1QFUL 4BJLA 1QACA 1GOFA 3QUMA 1A6TB 1XGQB 4OTXH 4N8CL 1JCKA 4UZGA 5FHAL 1HSAA 2IMMA 4E41A 1HINL 2OZ4L 3B4NA 4M48L 4X4YB 2BY1A 2B1AL 4U6YA 2DDQL 2E3VA 2W91A 2YD4A 4OFKA 4YEEA 1EHNA 5JHDE 2Z4QB 3FZUD 2DQUL 5GGTL 1K4DB 4NQEA 3SCMC 4Q9RH 4UQ2B 5EU5A 4FQJH 4UNUA 2FEDD 2ZSVB 4N8VA 5JR1H 4FQ1L 1S9WB 3F6LA 3VXMA 3LN5A 4D0DA 4A6YB 2BDNL 2Q3ZA 4PJCA 5BCAA 1C5DB 3BFOA 4LVHB 5BOZG 3EO1A 3RU8H 1U93B 1E28B 2AJVL 5CUSH 1FC2D 5ABDE 1CE6A 3RWCA 3QAZC 2CRMA 3CSBA 1HIMH 3P0VL 3SO3C 3K46A 4XVSH 2RHEA 3QXAA 4HJGA 4QXTB 4G9DB 3VFNA 4PRIA 4X6BB 4R4FH 4NZUL 3FQNB 3HUJA 5B3JE 3IT8D 1RK1B 3CXHJ 3TBSA 4YFLI 3DO3A 3EJZD 2BC4A 5CJ5A 3ZYOA 1EBAA 5TDNB 3NACL 4S1QL 1KIRB 2EXYC 1XIWC 4O00A 1OWRM 1UM4L 4YR6B 4J6RL 1ZT7A 2XY2A 2UYLB 1NGYB 4LNRA 4WUUA 5JO5A 5L9DL 4LCUA 2CO7B 3T4AB 2PW2A 3GSOA 4DEPB 1TQCC 1F90L 4PB9H 4OZ4A 4C59B 4ELME 4K7PL 1UKTA 3C5JB 4K94C 1CD9B 3IRPX 2KQMA 5DHVA 4MQ7A 4YO0A 3FB8B 3GSVA 1AJ7H 4Y8AA 5ISZB 4NKDB 2GAZA 1FFRA 4L4JA 2J1KA 2NY2C 4WCYL 4JFOA 5D1ZD 4HCRA 1INQB 1LD9B 1MJUH 2JB5H 4KROD 5FO8A 2E6PA 2Z91A 5JTWA 5KSAD 4HKXA 2A74B 2UWEE 5HGAA 3T0AA 1AI1L 2MFNA 5HHMD 1GYAA 5ALBH 1I3GL 3F58L 4NCC2 2Y06L 3PWUB 4HW6A 2DMCA 3C6LB 3SGDI 4JFEB 3A6CH 1FBIL 4PRHA 3DROB 1ROWA 4R9HA 3OXRB 5DJZA 3QIBD 3CFEA 1EMTH 5CJQL 4U6VH 4FQHA 4OFYA 4MVBC 3MV01 3BPCB 5BRZD 4M6AA 3W11C 3DX8B 4Y19B 1NEZG 3V6FB 5D1XD 3ZDYE 4P48A 3D48R 3PGFH 1ACYL 3QUZC 3TCLA 3TFKC 1A1NA 4HJJH 3T65A 1IM3A 4UUJA 1A3QA 4KJWC 4YIQB 4JY6B 3ZKND 3KXFD 5C0NC 4JR9H 4M7LH 4ZFOA 3MJ9A 3N85L 3B9KA 1UB6B 3VWJC 1JPSH 2ICWA 2NY3C 4PTUB 4HWBH 1RUPH 2XICA 4O5LL 5C09A 1ZLSL 4FA8A 1IZKA 3L5XL 3MRBB 4G8IA 4XP1L 5IW1A 1RUKL 3JWDH 4KRNA 1VPOH 1WC7B 3CD4A 4X7TA 4D0CB 4K94L 5ITFA 4YBQC 4TSAH 1Q1JL 5IP4A 3KYNA 3JV6B 5I8CB 4UINL 5FGBC 1MAJA 5ICXA 5B3NA 4NN6B 1IC5H 2RGSA 3S35L 2HT3D 2VDQL 5DK3A 3D25A 5HHQB 1CU4H 2OTUA 1KPRA 2EXWD 2P5WA 2IAMD 1FHGA 3MNWB 1S7SB 4ORGB 2I60H 3RUGB 5A40E 1KLGB 1WBZB 4M9PA 2NXZD 4DGVH 4M1GH 3H3PH 1RJLA 3ARFA 4FQCH 2AEPL 4QHNB 3O4OB 1H8NA 4HH9B 4LFHG 5LCVH 1DR9A 5CIPH 5F7YC 4DQOH 4AL8H 1FL6A 1CLZL 1S78D 1I8LA 5IEKA 2VO5A 3WD5H 3GFUA 3IFOA 4HK3N 3BT2L 2XN9A 4OGZA 1IGIL 3CFJA 1DBJL 3RWGB 1UWGL 2DM4A 4CNIA 3QDGD 4QOKB 5AEAA 4Q0XH 1CGSL 1T0NA 3U30C 3LKRB 2XFXB 2ZPKH 3DMMD 1AY1H 3B2VL 3PWLB 1NC4B 2D31A 4P5TA 3MV9E 3MRHB 3O8XC 4HK3J 5JOFB 2EYTB 4F7EA 5TF0A 4WJ5A 2ARJQ 2DM2A 2L7UA 5HHME 3EO9L 4JJ5A 2EDBA 1P84K 1ODAA 1WT5A 4KK8D 3WFCL 1SJEB 3MNVB 2OX5A 3JBG7 1QO3B 2J6EA 4HIJB 4WEBH 1JYXA 1XF5A 2NW2B 3U83A 1U3ZA 3T2NL 1T7VA 5E9DA 5IV2B 4JM4H 5CZVL 1L4IA 5BRZE 1AD9A 3PJSB 2FJGB 2AJYH 5D7LE 4Y4FD 4PRNA 3MRNA 4TVPL 2V17L 1QR1B 5DMYA 1D9KD 4UBDC 2YPKA 1GZQB 4CJ0A 1Q0XL 3WXVL 1LMKA 1X4YA 3TH4T 4Q9QH 4ISVA 2XV6B 4RISH 4OZIE 3QPQC 4LGSB 4KK6C 1W72L 3CDGB 3KPQB 4JANA 3FFCD 3KXFE 4QCIB 4ODVL 4N0UB 4FXLA 4YZFF 1F3JB 3FB5B 4PJAF 3GSWA 2RB8A 4MQXD 3KPTA 2R23A 3I6GA 3IETA 4N0CD 5EOQL 4KZDH 2DRUA 4TNWK 3HNSH 1QEWA 1FFPB 2AK1L 2VXVH 5HYJB 1BFVL 1MAMH 2FHCA 3MV8B 4S1RH 1FH5L 1OF2B 4EOWH 1N6UA 3QIWD 3GMPA 3O0RL 2VWEE 3HNTH 5TFSH 5T1DH 4M7JL 2G75A 1AHWA 4LSPH 5J4MA 3OKMB 1C5CH 4KHXH 1ZTXL 5DJAB 4KXZH 5EOCH 5I8OL 3TNMB 4ZOBA 3HZYA 2AXJA 4LVHC 1YQ2A 3WDHA 4D2NA 3ULUC 3EFFB 4M4RA 4NQDB 3CU7A 4MMXC 1EFXB 4QXGL 2L0DA 2P5ED 2P8PB 3FFDA 1S7RB 2A9NH 3BP6B 5C0GB 4GG6F 1MI5A 4PB0H 5IM7A 2BHYA 3D0VA 2DJ4A 1MQ8A 4GKNA 1IKNC 3QDGE 3DRQB 2CMRH 4KJQC 4ZNEE 3RP1A 2EDHA 5ADOL 3T0EB 1EEYB 3V79C 4YHZH 3IFNH 5KS9B 2AEWA 1AO7A 2EIZB 4D0BA 2F15A 4MQSB 1QFPA 4CGTA 5TGBA 5IHZB 1AGEA 4WENB 4PJDF 2KUTA 3OKEB 4Y1AE 3NN8A 3MV11 3I2CH 4Z7WE 3U0WL 4U1KB 1N5YL 4JKPH 4QNPF 4ZSOE 4DEPC 2Z0BA 5IESL 4KMTL 1I8MA 1J0JA 2M26A 2OXGA 3ULVH 1JNLL 4Z5RB 4L4TB 1AGFA 1RZ8A 4I48B 4LSTH 3ZDXF 5K9QG 3FO2B 1I3RA 2QQQA 3FQXA 3STBA 5GGRA 2IQ9H 3HE7D 1P4IH 1C16B 4LRNH 4NBXB 3AGVA 1ES0A 2MHAB 2AEQH 3P30L 2OCFD 1RK0B 5EU4B 4F57H 1JWMB 1PZ5A 3GGWA 4UT6H 1KB9J 3RFZC 1WV7T 3WLWD 1WAAE 5GRVK 5B39G 5IGXH 4HK0A 1QVOA 5FHBL 4KKCD 3OAZH 2ZUSA 1HHJA 4NQCD 3CDFA 5FCSH 4A6YL 4JEGB 3FFCE 5IT2H 2UZIH 1QZ1A 3GSNB 3CVIL 4GKSB 4Z0XB 4PR5A 3V7AE 3C6LC 5T1LB 4G5ZH 3BP4B 3PE9A 4S1DD 1Q94A 2OP4L 4WW1A 1YNTA 2LAGB 1ND0B 2WAHA 3PWJB 4XMLH 3BUYB 1YEJH 2A6KA 1T1WA 3S37X 4U2ZA 4OIAA 1CK0H 1CN4A 2HJLB 4DOHB 1A0QL 1JF1B 5CLWA 5TQ2H 4CU7A 3IFPB 1CBVH 3F7QA 3L3IB 1DLHA 5DURB 2Z31D 1VHPA 1DBKL 5EZLB 2YD8A 4JFZL 1UZ8B 4LSQL 4PUBL 1TETH 3FT4A 2FH8A 2PCPA 2UVFA 1NMAH 3L7FB 2GJ6A 2EKSA 4JKLA 1H3VA 3T8XB 3LDBB 4JREB 1MLBA 1A02N 1K3IA 2OZ4A 3IVKA 3OGOE 5BZDA 2OQJB 2VLMD 3GMMA 3QUYB 4G8EB 1NDGA 4DUVA 3DXAB 1M71B 2L7JA 3MROA 5GGTA 4OZHE 1DANT 1EK3A 1R3LA 4G43B 3RL2A 4PLKD 1T83C 2ESVB 2G5RA 5DVKA 1BF8A 3UTZB 3RTQA 4JRXA 4URTB 3PABA 4NN6C 3ZE1F 4GAJL 5IBLD 4RX4A 5DFVC 2VLJB 1JGUL 3MRPB 5JW3H 2VLKA 1LK3H 2PF6A 2YRZA 3PF2A 1YN7A 3RVVC 4I9WD 5BVPH 5I1CL 4NZTL 1DN0A 4R90H 1TJHL 5FXCH 4HKZA 3MNZB 1ZMYA 1LE9A 4PJEA 3VMOA 3O4OC 1GAFH 3UTSB 1KELL 3QISA 4LHUA 4PBXA 4IIQA 2CJUL 3I9GH 5EN2A 1A6AB 3BO8A 1I7ZA 2VZOA 1FNGB 1JTTA 1MIML 1KJVB 1NUNB 5D2LE 3UAJD 2JCCE 3QQ9D 1B0GB 4WV1A 3K4ZA 2V5YA 2QR0A 3VD4A 2R56L 1V7NH 3QYCA 5IFJB 3MA9L 4HIXL 1KPVB 2I9TA 1CLOL 4M8VA 5HHXL 1CF8H 1P7KB 3ZKXB 4OV5A 4HQQH 3EOTH 5BJTA 1A1MA 4NQCE 3CX2A 2D03L 2YRPA 4L3CA 4EI5B 5C8JB 2B8OT 1TZIA 3WKML 2NLJB 4Z77B 1MEXL 5B4MD 1IT9H 3PXHA 5H35A 5BQ7B 4YDIH 4KGLA 3V4UL 3RWEB 2BFVL 3EO0A 1J87A 2DLFH 1UT9A 3WUWB 2C1PA 1GC1L 3DX9A 3O2DL 1S7WB 1LO4H 1ZSDB 3AY4A 2ARJA 1A2YA 2X89A 4LPXA 2RCSH 5HY9B 3CMOL 4O02L 4I0PB 5IIEB 1SMOA 4I4WA 4JFQA 5EZJB 2YPLB 4DKFH 2BSTA 1K4CA 4NKMB 4N1HB 5FECB 1J0KA 3H9SB 2WWMD 1UB5A 1KV3A 1RFDL 4G9FB 3HI1A 5GGVY 4XXDA 1YJDH 4I77L 4MD5B 5BS0B 4B50A 4HMDA 2VLME 3PXJA 1CLYH 4XMPL 4OCNC 1T7ZA 1U8NB 1F4HA 4CJ1A 3MLWH 1FNSL 2WMPA 1PAMA 2A73B 5IB5B 4R97B 1LP9E 5ITBL 2WIIB 2V7HA 2VQTA 4PJ9D 4Z7VA 3UTTE 3BKCH 3M17B 1OPGH 3WHE0 5DI8B 5CLTA 4PY8J 1KCSH 2PYEA 3Q1SL 1RULL 4P4RA 3M07A 2H2PD 3E3QE 3JZ7A 3VFVA 4PJHA 1F11A 4UQ3A 4QYOB 5GS2H 4DVBA 1FIGL 3OG6B 4PJFE 3STLA 3UPRB 3SJVE 4I9WE 4OZGE 4X7EC 3PP3H 2W92A 3MRQB 3G9VA 5DJ2B 2DQEL 2ICES 3AFLA 3RIAF 2OYPA 4A2LA 3A6OA 2BRRL 3PIQA 1V7ML 3FONA 1RUQL 5I1KL 5LGJB 1P9MC 1JI1A 5JXEC 1J1XL 2NY1B 2V7NB 4BFBD 3LRSA 2HWZH 3DVGB 4JDVB 1IMHC 4M02A 1WEJL 1RZKC 5JXAH 1S9XB 2EZ0C 2X1WL 2EDXA 3I3EA 1PQZA 1N64L 1ZEAL 3TJEL 3OKOB 1G7IA 3BZ4A 3OAUH 4KK9C 4MNHA 4NKOA 5DD0L 5FYKL 3HRPA 1FL3A 1D5XB 4NN5B 1EV2E 3BPNB 3QDJD 3T0EC 3P77B 3DYMA 5IK3A 4FQ2H 1FQ9C 2W0LA 5GS3A 5MP6H 3T77A 6FABH 4G6MH 3TC9A 4Q9CA 1ZA6B 3VFGH 3DI3B 4IMLA 2JELH 4GMTL 4YX2L 2VH5L 4YNYA 4MSWB 3EUUA 1KN4H 2VQ1B 1V3KA 4PRBA 2BNQD 4FZEL 3TWCH 3BIAX 5F9JB 5CBEB 3W0WB 1B90A 4UTAL 5EFIB 1OSZB 2YUXA 4W4OA 4EDWH 1MCOH 3DV4A 1T22A 3EZJB 3PDDA 4F7CA 2NY5C 3CC5A 4NQVB 4PJIB 2IFGA 5JW5B 2ORBL 5I8KH 1MELA 3GHBL 2PETA 1QSZA 5IVXA 5FUCC 5C0CD 1FVCB 4JAMA 2EH7L 4M7KH 4POYA 4K7PX 4ZOAA 2BVPB 1BVZA 4ZNCD 1OP3H 4CMMA 1IEAA 3IJSA 5MEOB 1O7SA 1INEL 1FFNB 4KRLB 4OD3H 1L6XA 4XXCC 3NFNA 2BOCA 4FQPA 4L1DA 3OQ3B 5D6CA 1JRHH 2LVCA 1RHFA 3HPLA 4CDGC 5FGBA 4POUB 3HZMA 1TNMA 4YHPB 3O41B 3TBWB 1AQDA 4BM7A 4CVZB 2BNRD 3UBXI 4JDZA 4K8RH 5A1AA 4P3DB 5JMOC 2ZNWA 4NO5B 4L4VA 4J3XA 4XNMB 5FUZL 4ZTOL 3O6ML 1W72A 3CSPA 1DQLL 5EU6D 5A2FA 1OT1A 5JHDB 2ZG2A 4L8SB 4X6CE 2XZCH 1KB5L 4N9GA 3B83A 3IDJA 4ZYKB 3AAZA 1T4KA 5I1AB 3LDBC 4JREC 3S4SB 1UQSA 4R7DA 4XZUB 3NCYP 4X4MA 2BVQA 5CP3A 5F7HA 4TSBL 1ZLVH 4WI5A 1GOHA 3QUYC 5TE7L 1IM9B 2HAZA 4ENEC 3IXAB 1DEEB 1RSFA 3QXUA 3SKJL 4NHUA 1U91B 4HPOL 1K9TA 4F2MA 3WIFA 4HFUL 2OR8A 2BVEA 3G6AA 1DE4A 3BKYL 4QHUB 2OJZL 3BAEL 4ELKA 4HUNB 1OCWH 2EIDA 3LKPA 2W9LA 4FTVD 2VXTL 3WS3A 1HHGB 3O8XA 1QFHA 5AAMA 1MHPH 4HLZG 4Y4HA 2D2OA 5LBSH 5TDPA 2FATL 3KWWB 4CRPA 4P9HH 4OUUB 1H8SA 5I1HL 1JHKL 2P8LB 5D5MA 1R5WA 3D2UD 1QSFA 3ZMRA 5HYIA 3BDYL 1CI5A 2X4RB 1JWSB 5HHOA 4HKBB 2FECL 1PKQA 1FO0B 4ELMB 2XA8H 4X6EA 4NRYA 2OK0H 5E6IA 5ILTL 1WZMA 3MRCB 5AYUH 3AXLB 3WIIL 4AY0A 4LAQH 2Z35B 1JFQL 5F70A 3LS4H 2GCYB 1WBXB 3O3EB 4HWZA 3PWPD 3MLZL 4K3DL 1DFBL 5HPMA 4IOIB 4LNVA 1KT2A 2EDRA 4HAGA 1ZHLA 4L1HA 2I25N 2A6DB 3GB7B 4XNYL 2X70A 5C0CE 3V4VH 4OZFH 3ZKXC 4K3EL 1A6TA 1XGQA 4G6FD 4XP6L 3VFRA 1AE6L 1A1OA 1VCAA 4EI5C 2XTJD 3UTQB 3VXPB 2EDJA 4N8PA 2XZAL 5F7WC 4OIIL 2NY0B 5T5FL 4CU6A 3PG2A 2UWEB 3BE1L 3L3JB 4ALAL 1N7ML 3DIFA 2W59A 1K4DA 3CFDA 5I15L 4QKXB 1Z6JT 4WFHD 2MNUA 2BNRE 3I02B 3MUZ1 2ZSVA 4XPGH 4R2GD 4Z9KB 3SOBH 3NGBB 2D0GA 1TLKA 5ADPL 3ARRA 1S9WA 2DYPD 4G6AD 4XPAH 5F9AC 4Z7OF 3HI6L 4A6YA 4I0PC 3MLVL 5KVMC 5GJSL 1J12A 1E6OH 5IMMB 4LCCA 1INDH 5EU6E 1AD0A 3RBSA 3F7RA 4OD1L 1UVQA 1HYRC 2ZCKL 3KVQA 1ED3A 3P9MA 1GGCH 3GIZH 2XRAL 2OXHA 4BQBA 1UZ6F 4LSUH 2D4FA 4AG4H 5FCUL 1NANI 2I26N 1FVDA 3KR3H 4QXTA 5TJWK 4YHLH 5BZWA 1MCQA 5J1TC 4R97C 1RZFL 2KH2B 1CGYA 2AW2A 4OLWL 2YC1B 1RK1A 5DVLA 3S3SA 4ZS6C 4OF5A 1LK2B 1WVZA 2ADIA 3L3OA 4NWTL 3AREB 2ADJB 4PJ7F 5GQBA 3OX8B 3RZCD 1NDMA 4D9LH 3CPLB 3GI9L 4R7NB 3E6FB 1TJGH 4FTVE 5B38A 5DDHA 4MXVE 4N1CA 2AJZA 3HCVB 4FS0A 5F6HJ 4YBHA 1S7VB 4HUUB 1LE5B 5EOTB 4WDIB 5DVNA 4OF3A 2X4OA 3NBNA 2PO6D 5JQ6L 5BO1H 1R5IB 2VXSL 3C5JA 2IFFL 4MGXA 2GK0B 4CMHB 4ETYA 4NNXB 2NY1C 5ID1B 1K2DA 4NNYA 5EIIB 1OAQL 1EAJA 4OF8A 4WUKL 3FB8A 5CZKA 3RNKB 4KQ4H 3REVA 3NIDF 3H2WA 3IDUA 1KULA 2MKLC 1WLHA 2R0ZH 4NKDA 4C4KT 3MXVL 1NLBL 3AS3A 2ZCHL 1LVEA 2CXGA 1MWAB 4BKLB 3LZFH 2FECI 3WO4B 5HTSA 1CE1H 1QTYT 4K23L 1INQA 2WANA 3WEXA 4NN5C 1TMCB 3BPNC 5CEZH 3PWPE 5L88L 4HS3B 4KTDL 4PJGE 2A74A 3ZT7A 4YGVB 4FABL 1RY7B 2B4CH 3C6LA 5GGSB 4TUJA 5HGBA 3EYQD 1BD2D 2XTJE 3MLPA 3MV9B 5B21A 2VTFA 3GJEA 4KROB 1DSFH 5KSAB 5FOBB 1M7XA 4EVNB 3FL7A 3BPCA 3QEQD 3NCBB 3TT1H 4H1LA 5HHMB 4NKIH 1KXVC 1QFWL 4H26B 3CSYB 3WXWL 1GSMA 4Y19A 4Q97A 4PPTA 5JQHC 3I84A 5BW7C 4PJ5E 4QTHA 5EBLA 2FBJL 3QIBB 5GRXG 3KYOA 3I3BA 4YIQA 4JY6A 4UTBH 1RZ7L 2FO4B 2B1HH 4UV4L 5BRZB 3M1BB 1UB6A 3HB3C 4X9IA 1GL4B 2X4TB 1RVFL 4OLZH 3U0PA 4EIZC 5D1XB 1KSRA 1FNEB 1XF3B 2VDLL 2F53A 1MPAL 2DJUA 3BN9C 1BIIB 4MWFA 3BXNB 1SYVA 4CW1A 1S7UB 5IBTL 1WC7A 4W70A 5HGHA 3O2DA 4WO4A 5GRUH 3MUGB 5DJ0B 3KXFB 4WVRA 2DTMH 3JV6A 5I8CA 3MOBL 4JHWL 3VFMA 3WNMA 5C0IA 3CDYA 5FKPA 3UYPA 5E08L 3V5HA 4BH8B 1NFDA 3BZFA 1PYWB 5HHQA 1K85A 2I5YH 5B22A 4Y5YA 1I7UA 1FFQA 3MNWA 1S7SA 5DQ9A 1NCTA 3U9PL 1CD1B 1A7OL 4B7LA 2K1MA 4JM2A 3F5WB 1DQJA 4KK5C 3BP5B 4L8SC 4TQEL 3X13A 4JQIH 4HIIA 4LVOB 3QI9D 4P9ML 3U1SH 1AIFA 3B5TA 4ZDHB 3LKNB 1QBBA 5L2KD 2QHRH 3UBXA 5IMOB 2IAMB 5K9QI 3DUUB 5CGYC 1K6QH 1JWUB 1SY6H 3GMOA 3MGOB 1D5BB 2C3VB 1U8KB 1QKZL 2NXZB 3X11A 4HXAH 3LHPH 2MMXA 3R1GL 5EUOF 1IAOB 5EC1A 1M6OB 3UTPD 4JG0L 4OGYH 5E2VL 2ZZUT 1B2WH 1R3KA 1CXLA 3SQOH 2V2TA 3PWLA 4QRPE 1NCBL 1N4XH 3U0TB 1NC4A 1MFEH 2YR3A 5IHUL 3IDXH 2XI9A 4BQ8A 3D6GA 4KTYA 3QJFB 2EYTA 1G9MC 1SJXA 1M7IA 3BIBX 3QDGB 4NNPH 3DMMB 5JPMB 1AQKL 1SJEA 3C08H 4OSUH 4B5EA 3BKJH 2WP3O 3EYFB 4X8JA 1V3LA 4JQVA 5DEFA 4Y1AB 2VSCA 4Z7WB 5L2JA 1X3DA 4WHTA 4ZSOB 3OKDB 3QEQE 1T5WA 2ZUQB 2FJGA 3MJ7A 3PJSA 5DC9B 3OAYK 1IILE 3LPGA 4ZQKB 4HWNA 1QFWI 3ZHLA 1GZQA 4I3RH 2E7MA 3QH3A 5JDSB 2JIXD 2CIIA 5A16B 1OARH 2DQFB 1JVKA 4P3CL 5DTFB 1ZT4A 3VD5A 3CDGA 3KPQA 4JZNA 3MRGB 4QCIA 2HYMA 3VI4F 2W07A 3QUMH 4Y4FB 2R69L 3VRJA 3BH8A 1NEZA 4MNQA 4PRDB 1D9KB 1MY5A 4MAUH 4NRZB 1F3JA 2R1WB 2FHFA 2VE6B 5BXFB 3VDBA 1GOGA 3RI5F 4XNXL 2NY0C 4N5UA 4YPGB 3ZTNL 1VFBA 5KW9L 2GTWB 3MYJB 1PY9A 3FFCB 1CFTA 3RVTC 3HRZB 1AP2A 5E2JA 5HYJA 3MV8A 4PJCF 2ZCLL 4LARL 1OF2A 1OT2A 5HYSG 2FH6A 3IDNA 3NA4A 4NGHH 5DT1L 2Q8AH 3BD3A 1QRNA 3NGBC 2MQ0A 3K2UL 1N0XH 3SDCD 2ADFH 3VXUD 1LQSR 3DVNA 3SGJC 2BSRB 2P43B 5IKCB 5TF1H 3PDOA 3BQUB 3ZKMD 2GI7A 2IADB 3OKMA 3TBTB 3MYZA 3EYVB 3FZUC 2XPGA 1KOAA 1S3KH 3VFOB 2CDGA 3QPXH 1NAKL 4YHKL 4ZOEA 2FEDC 5C08D 5AG9A 2P8PA 5L2KE 2JE8A 3W9DB 1KUMA 3WSQL 1UACL 2JB6B 4TVSa 3ULVD 4JVWA 1HYSD 2A6JA 3PWNB 3U79A 2D9QB 3MGTB 4OCMC 5KZCD 5FIEA 1MFAH 1QHOA 3SKUD 4ONGH 2FX8H 5GGQH 4KDVA 5IB3A 2OMNA 4XWGH 3UTPE 1WIPA 3AREC 1JIBA 3VXNB 1KB5A 4OZHB 4M61B 3VD7A 1JI2A 4OCXH 4BELD 3RPKA 4XBPB 1X4XA 2P49B 3I3DA 4ACPA 3HAEG 1D5IL 5D8JL 1OB1B 2R4RL 3DUSB 1ZGLA 5H37H 4NDMA 3MJ8B 4PTTA 2EC9T 3RA7H 3UPCA 4M6OL 3LN4A 3VXTB 3EJZC 2NZIA 4M1DL 4MXWL 4R8WH 1AXIB 4N0FA 3O2VL 1J0IA 3GSXA 1QBMH 4Z0BH 2XZQH 4CMHC 5JA9A 3UYOD 4WY7L 2W1NA 3GMRA 4Y5XB 1I1FA 4ZTPH 3ES6A 5DHVH 1KN2H 3GSRB 5I2IB 3E1F1 1C16A 2LTQB 5FFLA 4MCZB 4NZRH 5H2BB 4BZ1H 1A9EA 1MCPH 1IC4H 1JWMA 1Q9WA 4GG8B 1C5BL 4PS4H 4R4ND 3UJTH 3WO4C 1O7VA 5D7JA 4HCRH 5AWNH 2IQAB 4H88L 4HF5L 1NGXB 4YZFE 4YXKL 4NO2B 2QQNL 1AR1D 3HE7B 1F4XL 4ZFZA 1P84J 2UV3A 5D2LB 2C26A 4NM4L 5E2WL 2JCCB 4XAWH 3TIDB 2QSVA 1R3HA 3WJLA 4APQA 1EEZA 3HA0A 4GKSA 4KUZH 4D9QD 3QDMD 4Z78B 4GQ9L 1NBZA 4U6XA 2VERN 5DMKA 1VA9A 4OGAC 2ATKB 4YWGL 4KROC 4NQCB 2FB4H 3BUYA 5KSAC 3G6DL 1JV5B 3ULSA 5HPOA 3EHBD 1I1AA 1ZLWK 1B4JH 3OMZA 5F3HB 2GIYA 5CILH 5DRXB 1TVBB 1JF1A 4OT1H 2AGJL 4L29B 4DKDC 2Y36L 1ZS8A 1FG2A 2ZOLA 3QIBC 2D0HA 1MCIA 3VXUE 4ZS7L 1P7HL 2AXHA 3T8XA 2PTTB 5DRNA 2R2HB 3MJ9H 5AD0A 3GI8L 5D1XC 1GGBL 2B39A 3HTLX 4G8EA 2DMBA 4F33A 5T3XH 1AFVH 3SGKC 2HLFC 2Z31B 4M6ML 2YD1A 1KEML 2CLVB 3ULVE 4G43A 3ZKNC 2LU3A 1OAKL 2ESVA 1YPZF 4HT1L 2SEBB 5FA4B 4KZEH 2VLJA 3TNNA 3MRPA 1CL7L 2VDKL 1LP9B 3VU2A 5D71H 3RKPA 3HNVH 2FBOJ 3R8QA 3FB7B 4L8BA 4TPRH 3UTTB 4YXHH 4O4YL 3SE3C 4RGOL 4QXWA 4JQXC 3MGAA 1VGKB 4LVOC 1TTGA 3KLHD 4UT7H 3WL9B 2HT3C 3O11B 5HBBA 2VWEC 3UTSA 2EXWC 2X9YA 4PGBA 4NIKB 1X44A 2FO1A 5JHLH 1OAUL 2IAMC 5BV7B 1ETZB 4NZJA 4PJFB 4P2OA 1FP5A 5TE4L 4ODHL 5JUEL 4OZGB 2NXZC 2E6JA 4ZUUB 2DI9A 1JGLH 1DEDA 2C4XA 5I73B 1T1ZB 2WIMA 4W4NA 1IGJA 4BUHA 1H0DA 4ERSL 3QUKB 1P6FA 4XPFH 5T1KD 2HRPH 3V5DA 1KTDA 1AXTH 1I1CA 2I24N 3OKLB 4NO0A 2J8UE 1BVLB 4F58H 5C2BH 4NYLA 1S78C 1DBAH 2F5AL