3G0VA

Crystal structure of the c-terminal domain from the rous sarcoma virus capsid protein: mutant d179a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
76
structure length
76
Chain Sequence
GPWADIMQGPSESFVDFANRLIKAVEGSALPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 25
structure length 76
sequence length 76
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g0vA00
4U0BA 3MGEA 4U0FA 3DS2A 3VRLC 1D1DA 3G0VA 2M8NA 2JO0A 4COCA 3G26A 4M0IA 3DS3A 4IPYA 4U0DA 2LF4A 2M8PA 3DS0A 5HGMA 4PH0A 4XROA 1A43A 2EIAA 2L6EA 4XFYA 3NTEA 5HGNA 4U0AA 5JPAA 2XXMA 3DTJA 2XV6A 3G29A 4U0CA 2JYGA 3H4EA 4XFXA 3DS5A 3G21A 3LRYA 4QNBA 1EIAA 1E6JP 1EOQA 3G1IA 5DCKA 4COPA 5HGOA 2M8LA 2JYLA 3P05A 5HGLA 3DS4A 4WYMA 4PH1A 1QRJA 1BAJA 3DPHA 1AUMA 4XRQA 2BUOA 2XT1A 3G28A 4U0EA 4XFZA 5I4TG 2ONTA 3G1GA 1A8OA 3H47A 2KODA 3DS1A
chains in the Genus database with same CATH superfamily
2CNRA 1QVGO 2LTEA 1YJ9P 1VQ5P 3H0DA 5KP6B 1IMPA 4CA3A 4F37A 5HGLA 2E1MA 1EMVA 2FQ0A 2MR8A 1M74A 2DGYA 1VQ6P 3RG6C 2FADA 3I55P 2PNGA 4IPYA 2KR5A 2LF4A 1MZ8A 2EIAA 4U0AA 3CCMP 2K94A 2N5IA 1VQPP 5HGOA 2JYLA 2GZGA 2Z46A 3CPWO 1JJ2O 1AYIA 4U0BA 2M5RA 5HVCA 1K30A 2PEKA 2L9FA 2M8PA 2OTLP 2XZ0D 3G6EP 4U0CA 2N6ZA 2KGAA 5DCKA 3M1MA 1S72P 1HY8A 1ZMBA 2KG9A 2FHSC 3DS1A 2AVAA 5CZDB 2BHVA 2AFEA 2EG5A 3RG2A 2JAZA 3DS0A 2KOOA 4GR6A 1NQ4A 2AF8A 2PEMA 3G29A 5KP7B 4H2WC 1EOQA 3G1IA 3U43A 2KG6A 1KLPA 2PENA 2DNWA 4PXHB 2EHSA 1YITP 2JB0A 4COCA 3G26A 1E0HA 1L0HA 4QNBA 2CG5B 1K8AQ 2GZIA 2QNWA 3CMEP 3G28A 3CE7A 1A8OA 4DG9A 2LMLA 3CC7P 3MGEA 3GJNA 2FQ1A 2MD9A 1A43A 1CEIA 1K9MQ 2VLPA 2XXMA 3CXCO 2MY5A 5KP8B 1E6JP 2N50A 4WYMA 1VQOP 2KORA 4PWVB 2VLQA 2OARA 1OR5A 5BS1A 2QEXP 4GR2A 4M0IA 2PEQA 2GZFA 3EJBA 5HGNA 4H2YC 1UJZA 2LKIA 3CCJP 1L0IA 1ACPA 1IUQA 1AUMA 2KWLA 2KOSA 5I4TG 2LPKA 2P9XA 3CMAP 4BPHA 3CCRP 1T8KA 3HZQA 1VQKP 2GZJA 4XROA 2L6EA 3Q20A 5F2KA 2FVAA 4QKOA 3CD6P 2Z45A 2EHTA 3LRYA 4COPA 4H2XC 1VQNP 2GZEA 4R0MA 1VQ4P 2XT1A 4U0EA 2PEIA 1Z6MA 2KODA 2WPTA 1NJIQ 3VRLC 1RO0A 2K0XA 1UNKA 2PEOA 1VQ9P 1W2BO 1AF8A 3B4QA 1VKUA 2MVVA 1RO2A 2JQ4A 4PH1A 3GZLA 3LMOA 2KGEA 1DNYA 2MF4A 2JBGA 1KQSO 1KD1Q 1F80D 2CQ8A 2K92A 3GKLC 2GDWA 2XV6A 3EJEA 3DS5A 3G71P 2K2QA 2QA4P 2L0QA 1K73Q 1GXGA 7CEIA 1RNIA 2N6YA 4U0DA 1VHNA 2N5HA 3CCLP 3NTEA 2AFDA 2MR7A 1M6NA 1Q86Q 2X2BA 1Q7YQ 2ERHA 3DPHA 4XRQA 1YIJP 2KGCA 4UHPB 1IMQA 3HYBA 1M6EX 4BPFA 2K93A 1M1KQ 1N8RQ 4PH0A 2FVEA 3B5IA 2LIWA 2JYGA 3CCSP 2VSQA 3G21A 2FACA 2VLOA 2VLNA 2LL8A 2JGPA 3NY7B 3EJDA 2BUOA 1M90Q 2ONTA 2L4BA 1YJNP 1QVFO 5EJDA 4U0FA 3DS2A 2CGQA 1D1DA 3OW2O 3G0VA 5F2NA 1HQBA 2OTJP 2L22A 5HGMA 1VQLP 2PY8A 4XFYA 5EW5E 3DTJA 2N98A 4IZ6A 4MRTC 3DS4A 1X3OA 1BAJA 3WBHA 2GYKA 3CCEP 1GXHA 3G4SP 2CWOA 3GZMA 3DS3A 2KOQA 4NEOA 2K0DX 3CCQP 1EIAA 3CCUP 3CC2P 1DV5A 2GDXA 1VQ8P 1YJWP 2XZ1C 3G1GA 3H47A 1KC8Q 1Q81Q 2NO8A 2M8NA 2JO0A 2PEJA 2ROQA 2Z44A 5HV8A 2K5XA 1ZNVA 2GDYA 5JPAA 3E2DA 1VQMP 1YHQP 3CCVP 2LIUA 3H4EA 5F2OA 2KGDA 2FQ2A 1Q82Q 1FR2A 1QRJA 1YI2P 3I56P 2EFJA 4XFZA 2JU1A 2KOPA 4HKGA 2MVUA 4XFXA 2LOLA 1GPJA 2KG8A 2KW2A 2M8LA 2K0YA 2FVFA 3P05A 1VQ7P 4BPGA 2JU2A 5BS2A 1BXIA 2FAEA 3CC4P
chains in the Genus database with same CATH topology
4U0FA 3DS2A 3VRLC 1NJIQ 1D1DA 1RO0A 3OW2O 3G0VA 4COCA 1QVGO 5F2NA 3G26A 1YJ9P 2PEOA 2OTJP 1VQ5P 5HGMA 1VQ9P 1VQLP 2PY8A 4XFYA 3H0DA 1W2BO 3DTJA 4QNBA 1K8AQ 1RO2A 5HGLA 3DS4A 2E1MA 3CMEP 4PH1A 1BAJA 3WBHA 3G28A 3CCEP 1M74A 1A8OA 2DGYA 1VQ6P 3G4SP 3CC7P 3MGEA 3RG6C 1KQSO 2CWOA 3I55P 1KD1Q 3DS3A 4IPYA 2LF4A 1A43A 2EIAA 3CCQP 4U0AA 3CCMP 1K9MQ 2XXMA 2XV6A 3CXCO 3DS5A 1VQPP 1EIAA 3G71P 1E6JP 3CCUP 5HGOA 3CC2P 2QA4P 2JYLA 2Z46A 4WYMA 3CPWO 1VQ8P 1JJ2O 1K73Q 1YJWP 1VQOP 3G1GA 3H47A 1KC8Q 2OARA 4U0BA 5BS1A 2QEXP 1RNIA 1Q81Q 1K30A 2PEKA 2M8NA 2JO0A 2PEJA 4GR2A 4M0IA 2PEQA 2Z44A 4U0DA 2M8PA 2OTLP 3CCLP 3NTEA 5HGNA 3E2DA 5JPAA 1VQMP 3G6EP 1YHQP 4U0CA 3CCVP 3H4EA 5F2OA 3CCJP 1M6NA 1Q86Q 1Q7YQ 5DCKA 3M1MA 1Q82Q 1S72P 1IUQA 1ZMBA 1QRJA 3DPHA 1AUMA 1YI2P 4XRQA 1YIJP 3I56P 2EFJA 4XFZA 5I4TG 3HYBA 2P9XA 1M6EX 3DS1A 2BHVA 2EG5A 3CMAP 3CCRP 3HZQA 1M1KQ 1N8RQ 3DS0A 1VQKP 4PH0A 4XROA 2L6EA 4GR6A 3B5IA 3Q20A 5F2KA 2PEMA 3G29A 4XFXA 2JYGA 2Z45A 3CCSP 3CD6P 3G21A 3LRYA 1EOQA 3G1IA 4COPA 2M8LA 3P05A 1VQNP 2PENA 1VQ7P 1VQ4P 2BUOA 2XT1A 4U0EA 5BS2A 2PEIA 1M90Q 2ONTA 1YJNP 2KODA 1QVFO 1YITP 3CC4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0B A;  3MGE A;  4U0F A;  3DS2 A;  3VRL C;  1D1D A;  3G0V A;  2M8N A;  2JO0 A;  4COC A;  3G26 A;  4M0I A;  3DS3 A;  4IPY A;  4U0D A;  2LF4 A;  2M8P A;  3DS0 A;  5HGM A;  4PH0 A;  4XRO A;  1A43 A;  2EIA A;  2L6E A;  4XFY A;  3NTE A;  5HGN A;  4U0A A;  5JPA A;  2XXM A;  3DTJ A;  2XV6 A;  3G29 A;  4U0C A;  2JYG A;  3H4E A;  4XFX A;  3DS5 A;  3G21 A;  3LRY A;  4QNB A;  1EIA A;  1E6J P;  1EOQ A;  3G1I A;  5DCK A;  4COP A;  5HGO A;  2M8L A;  2JYL A;  3P05 A;  5HGL A;  3DS4 A;  4WYM A;  4PH1 A;  1QRJ A;  1BAJ A;  3DPH A;  1AUM A;  4XRQ A;  2BUO A;  2XT1 A;  3G28 A;  4U0E A;  4XFZ A;  5I4T G;  2ONT A;  3G1G A;  1A8O A;  3H47 A;  2KOD A;  3DS1 A; 
#chains in the Genus database with same CATH topology
 2CNR A;  1QVG O;  2LTE A;  1YJ9 P;  1VQ5 P;  3H0D A;  5KP6 B;  1IMP A;  4CA3 A;  4F37 A;  5HGL A;  2E1M A;  1EMV A;  2FQ0 A;  2MR8 A;  1M74 A;  2DGY A;  1VQ6 P;  3RG6 C;  2FAD A;  3I55 P;  2PNG A;  4IPY A;  2KR5 A;  2LF4 A;  1MZ8 A;  2EIA A;  4U0A A;  3CCM P;  2K94 A;  2N5I A;  1VQP P;  5HGO A;  2JYL A;  2GZG A;  2Z46 A;  3CPW O;  1JJ2 O;  1AYI A;  4U0B A;  2M5R A;  5HVC A;  1K30 A;  2PEK A;  2L9F A;  2M8P A;  2OTL P;  2XZ0 D;  3G6E P;  4U0C A;  2N6Z A;  2KGA A;  5DCK A;  3M1M A;  1S72 P;  1HY8 A;  1ZMB A;  2KG9 A;  2FHS C;  3DS1 A;  2AVA A;  5CZD B;  2BHV A;  2AFE A;  2EG5 A;  3RG2 A;  2JAZ A;  3DS0 A;  2KOO A;  4GR6 A;  1NQ4 A;  2AF8 A;  2PEM A;  3G29 A;  5KP7 B;  4H2W C;  1EOQ A;  3G1I A;  3U43 A;  2KG6 A;  1KLP A;  2PEN A;  2DNW A;  4PXH B;  2EHS A;  1YIT P;  2JB0 A;  4COC A;  3G26 A;  1E0H A;  1L0H A;  4QNB A;  2CG5 B;  1K8A Q;  2GZI A;  2QNW A;  3CME P;  3G28 A;  3CE7 A;  1A8O A;  4DG9 A;  2LML A;  3CC7 P;  3MGE A;  3GJN A;  2FQ1 A;  2MD9 A;  1A43 A;  1CEI A;  1K9M Q;  2VLP A;  2XXM A;  3CXC O;  2MY5 A;  5KP8 B;  1E6J P;  2N50 A;  4WYM A;  1VQO P;  2KOR A;  4PWV B;  2VLQ A;  2OAR A;  1OR5 A;  5BS1 A;  2QEX P;  4GR2 A;  4M0I A;  2PEQ A;  2GZF A;  3EJB A;  5HGN A;  4H2Y C;  1UJZ A;  2LKI A;  3CCJ P;  1L0I A;  1ACP A;  1IUQ A;  1AUM A;  2KWL A;  2KOS A;  5I4T G;  2LPK A;  2P9X A;  3CMA P;  4BPH A;  3CCR P;  1T8K A;  3HZQ A;  1VQK P;  2GZJ A;  4XRO A;  2L6E A;  3Q20 A;  5F2K A;  2FVA A;  4QKO A;  3CD6 P;  2Z45 A;  2EHT A;  3LRY A;  4COP A;  4H2X C;  1VQN P;  2GZE A;  4R0M A;  1VQ4 P;  2XT1 A;  4U0E A;  2PEI A;  1Z6M A;  2KOD A;  2WPT A;  1NJI Q;  3VRL C;  1RO0 A;  2K0X A;  1UNK A;  2PEO A;  1VQ9 P;  1W2B O;  1AF8 A;  3B4Q A;  1VKU A;  2MVV A;  1RO2 A;  2JQ4 A;  4PH1 A;  3GZL A;  3LMO A;  2KGE A;  1DNY A;  2MF4 A;  2JBG A;  1KQS O;  1KD1 Q;  1F80 D;  2CQ8 A;  2K92 A;  3GKL C;  2GDW A;  2XV6 A;  3EJE A;  3DS5 A;  3G71 P;  2K2Q A;  2QA4 P;  2L0Q A;  1K73 Q;  1GXG A;  7CEI A;  1RNI A;  2N6Y A;  4U0D A;  1VHN A;  2N5H A;  3CCL P;  3NTE A;  2AFD A;  2MR7 A;  1M6N A;  1Q86 Q;  2X2B A;  1Q7Y Q;  2ERH A;  3DPH A;  4XRQ A;  1YIJ P;  2KGC A;  4UHP B;  1IMQ A;  3HYB A;  1M6E X;  4BPF A;  2K93 A;  1M1K Q;  1N8R Q;  4PH0 A;  2FVE A;  3B5I A;  2LIW A;  2JYG A;  3CCS P;  2VSQ A;  3G21 A;  2FAC A;  2VLO A;  2VLN A;  2LL8 A;  2JGP A;  3NY7 B;  3EJD A;  2BUO A;  1M90 Q;  2ONT A;  2L4B A;  1YJN P;  1QVF O;  5EJD A;  4U0F A;  3DS2 A;  2CGQ A;  1D1D A;  3OW2 O;  3G0V A;  5F2N A;  1HQB A;  2OTJ P;  2L22 A;  5HGM A;  1VQL P;  2PY8 A;  4XFY A;  5EW5 E;  3DTJ A;  2N98 A;  4IZ6 A;  4MRT C;  3DS4 A;  1X3O A;  1BAJ A;  3WBH A;  2GYK A;  3CCE P;  1GXH A;  3G4S P;  2CWO A;  3GZM A;  3DS3 A;  2KOQ A;  4NEO A;  2K0D X;  3CCQ P;  1EIA A;  3CCU P;  3CC2 P;  1DV5 A;  2GDX A;  1VQ8 P;  1YJW P;  2XZ1 C;  3G1G A;  3H47 A;  1KC8 Q;  1Q81 Q;  2NO8 A;  2M8N A;  2JO0 A;  2PEJ A;  2ROQ A;  2Z44 A;  5HV8 A;  2K5X A;  1ZNV A;  2GDY A;  5JPA A;  3E2D A;  1VQM P;  1YHQ P;  3CCV P;  2LIU A;  3H4E A;  5F2O A;  2KGD A;  2FQ2 A;  1Q82 Q;  1FR2 A;  1QRJ A;  1YI2 P;  3I56 P;  2EFJ A;  4XFZ A;  2JU1 A;  2KOP A;  4HKG A;  2MVU A;  4XFX A;  2LOL A;  1GPJ A;  2KG8 A;  2KW2 A;  2M8L A;  2K0Y A;  2FVF A;  3P05 A;  1VQ7 P;  4BPG A;  2JU2 A;  5BS2 A;  1BXI A;  2FAE A;  3CC4 P; 
#chains in the Genus database with same CATH homology
 4U0F A;  3DS2 A;  3VRL C;  1NJI Q;  1D1D A;  1RO0 A;  3OW2 O;  3G0V A;  4COC A;  1QVG O;  5F2N A;  3G26 A;  1YJ9 P;  2PEO A;  2OTJ P;  1VQ5 P;  5HGM A;  1VQ9 P;  1VQL P;  2PY8 A;  4XFY A;  3H0D A;  1W2B O;  3DTJ A;  4QNB A;  1K8A Q;  1RO2 A;  5HGL A;  3DS4 A;  2E1M A;  3CME P;  4PH1 A;  1BAJ A;  3WBH A;  3G28 A;  3CCE P;  1M74 A;  1A8O A;  2DGY A;  1VQ6 P;  3G4S P;  3CC7 P;  3MGE A;  3RG6 C;  1KQS O;  2CWO A;  3I55 P;  1KD1 Q;  3DS3 A;  4IPY A;  2LF4 A;  1A43 A;  2EIA A;  3CCQ P;  4U0A A;  3CCM P;  1K9M Q;  2XXM A;  2XV6 A;  3CXC O;  3DS5 A;  1VQP P;  1EIA A;  3G71 P;  1E6J P;  3CCU P;  5HGO A;  3CC2 P;  2QA4 P;  2JYL A;  2Z46 A;  4WYM A;  3CPW O;  1VQ8 P;  1JJ2 O;  1K73 Q;  1YJW P;  1VQO P;  3G1G A;  3H47 A;  1KC8 Q;  2OAR A;  4U0B A;  5BS1 A;  2QEX P;  1RNI A;  1Q81 Q;  1K30 A;  2PEK A;  2M8N A;  2JO0 A;  2PEJ A;  4GR2 A;  4M0I A;  2PEQ A;  2Z44 A;  4U0D A;  2M8P A;  2OTL P;  3CCL P;  3NTE A;  5HGN A;  3E2D A;  5JPA A;  1VQM P;  3G6E P;  1YHQ P;  4U0C A;  3CCV P;  3H4E A;  5F2O A;  3CCJ P;  1M6N A;  1Q86 Q;  1Q7Y Q;  5DCK A;  3M1M A;  1Q82 Q;  1S72 P;  1IUQ A;  1ZMB A;  1QRJ A;  3DPH A;  1AUM A;  1YI2 P;  4XRQ A;  1YIJ P;  3I56 P;  2EFJ A;  4XFZ A;  5I4T G;  3HYB A;  2P9X A;  1M6E X;  3DS1 A;  2BHV A;  2EG5 A;  3CMA P;  3CCR P;  3HZQ A;  1M1K Q;  1N8R Q;  3DS0 A;  1VQK P;  4PH0 A;  4XRO A;  2L6E A;  4GR6 A;  3B5I A;  3Q20 A;  5F2K A;  2PEM A;  3G29 A;  4XFX A;  2JYG A;  2Z45 A;  3CCS P;  3CD6 P;  3G21 A;  3LRY A;  1EOQ A;  3G1I A;  4COP A;  2M8L A;  3P05 A;  1VQN P;  2PEN A;  1VQ7 P;  1VQ4 P;  2BUO A;  2XT1 A;  4U0E A;  5BS2 A;  2PEI A;  1M90 Q;  2ONT A;  1YJN P;  2KOD A;  1QVF O;  1YIT P;  3CC4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...