3G0ZA

Structure of s. pombe pop2p - zn2+ and mn2+ bound form
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
SPIRDVWSTNLQQEMNLIMSLIERYPVVSMDTEFPGVVARPLGVFKSSDDYHYQTLRANVDSLKIIQIGLALSDEEGNAPVEACTWQFNFTFNLQDDMYAPESIELLTKSGIDFKKHQEVGIEPADFAELLIGSGLVLQEEVTWITFHSGYDFAYLLKAMTQIPLPAEYEEFYKILCIYFPKNYDIKYIMKSVLNNSKGLQDIADDLQIHRIGPQHQAGSDALLTARIFFEIRSRYFDGSIDSRMLNQLYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The activity and selectivity of fission yeast Pop2p are affected by a high affinity for Zn2+ and Mn2+ in the active site
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase, gene regulation
molecule keywords CCR4-Not complex subunit Caf1
total genus 85
structure length 252
sequence length 252
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3g0zA00
2G8VA 2I5JA 3QO9A 3ZT3A 2OPQA 1U49A 1FXXA 1W0HA 1RTIA 2F8SA 4FJHA 2RN2A 5HBMA 2XO7A 3NCIA 5HRNA 3LAMA 2VG5A 4KV8A 2R7YA 3SQ1A 3CM5A 2D0BA 4B8AB 3V4IA 4HCBA 4F3TA 1XC9A 4N5SA 5HRSA 4WE1A 2QKKA 1W9HA 2GBZA 2KQ2A 1J5OA 4B9TA 4IFYA 3IS9A 4J2EA 4W5RA 3V9WA 1JLBA 1SL0A 4DSKA 3AVCA 3L3VA 1C1AA 4N56A 3NF8A 2NUBA 1Z25A 3AA3A 1ASWA 3L2VA 3V9ZA 3AVKA 5JS2A 3ASMA 1LV5A 4RW7A 2BANA 4Z4CA 4DFMA 4ZTFA 4DQRA 4IDKA 1TK5A 3CFPA 1D9FA 3QNNA 4B9NA 4DFJA 1CXQA 1KFSA 2KFNA 1Z26A 1RT6A 4I7FA 3SV3A 1U45A 1NJXA 4OPJA 1JLAA 3NGIA 4DU3A 1NK0A 4PUOA 1DLOA 1TKZA 5HRPA 2BDPA 1CZ9A 5FROA 3TAEA 1S5JA 4E7LA 3BDPA 1YTUA 4RG8A 3DLGA 2OYQA 1C0UA 4DG1A 2IGIA 4Z4IA 1HNIA 4CFAA 2YKNA 3U6FA 3HP6A 3DLKA 3NF6A 1HNVA 5CZ2A 4Y1CA 1JLCA 3OVNA 3CQ8A 4M3WA 2YNFA 3SQ4A 2HB5A 4CF9A 3OS1A 4FW1A 1TK0A 5T7BA 3T1AA 4B8CA 3ALYA 1GOBA 3CYMA 4CESA 3WNHA 2E4LA 4HUGA 1VSHA 1WAFA 1TAUA 1TKXA 2BE2A 4DU1A 2XY6A 3PV8A 1QE1A 3G10A 4XIUA 3KK2A 3L2RA 3QEPA 4FK4A 2KZZA 1VSFA 2WONA 4KTWA 3AO4A 1KFDA 2DFHA 3PY8A 1JLFA 3OY9A 4DSLA 1N5YA 4IKFA 3TAQA 1U04A 4CHQA 4LSNA 3DMJA 1ZBFA 4W5QA 4ZTJA 4FLUA 3O3FA 4FZXC 1HYZA 4B9VA 1EKEA 3CG7A 4DFPA 2FC0A 4CGIA 1RDDA 3C94A 1UA1A 4C8LA 3NH2A 4NCBA 3LZIA 3NFAA 3KLGA 3KD1E 3VQAA 4KHYA 2Q3SA 4F2RA 4CE9A 1F21A 1L3UA 2PZSA 5KI6A 4EP4A 3HP9A 2E6MA 4E0DA 1BGXT 4CEDA 1D8YA 4CJRA 4KB1A 2XRIA 3AVBA 3QETA 1RBRA 5J2QA 1RBVA 1RDBA 3AO5A 4CJEA 4CIEA 1SL2A 4BDPA 2KFZA 3FFIA 4DSJA 4AILC 4CK1A 3OYIA 1A5VA 3P83D 4JLHA 3SQ0A 4CJWA 3S3MA 4DS5A 3QLHA 4M3XA 3IAYA 3B6PA 2OPSA 1KVBA 3LP0A 1HMVA 1SV5A 4CJKA 3QNOA 1KRPA 2BGGA 2OPPA 5CY4A 1EXQA 1VSJA 4FJKA 4E7JA 2HNYA 1REVA 4ELVA 3AVLA 3QINA 3V1OA 3LDSA 4KAZA 4H4OA 2Y1IA 1TAQA 2B4JA 4CEOA 4KTZA 4IFVA 4EP5A 3KLEA 1L3TA 2Z1GA 3HYFA 4Z4EA 1J53A 2VWKA 2HHVA 1NK8A 1S1UA 4HUFA 4N76A 3KK3A 4G1QA 2G8HA 1NK6A 4DLEA 1JKHA 4DTOA 3OYBA 3QESA 2WOMA 1TKTA 3HPGA 3AVAA 1QSSA 1JL2A 1FKOA 2HVHA 1QHTA 3O4NA 1WLJA 4KREA 2FBYA 4C8NA 4RW6A 4M45A 3K58A 4N41A 1QSYA 4IG3A 3AVJA 2P5GA 4Y1DA 1U48A 3M8QA 4M41A 1QTMA 4BWMA 4DF4A 2EHGA 1KLMA 4KHUA 3OYDA 4FLVA 1RT7A 1S6QA 3OYAA 4DQPA 4E19A 1X9SA 3QIPA 1BCMA 4W5NA 3ZT0A 3OYLA 1JLQA 1VSKA 2HNDA 2PYLA 1CLQA 5J2MA 3CFRA 2Z1JA 2D5RA 3HM9A 4K8ZA 3TAFA 4ICLA 1S9GA 3EZ5A 4KFBA 2FBXA 4Z0UA 3VQCA 1LW0A 1RNHA 3LPTA 4O4GA 3OYCA 4DF8A 1QS4A 1U4BA 4HUEA 3VA3A 2ZQBA 2PY5A 3P1GA 4DTSA 4E7HA 2X6SA 4LH4A 4OLBA 4CGGA 5SWMA 5J2PA 1C1CA 3K2PA 2EX3A 3K5NA 1J54A 1I39A 3F73A 2DFFA 3HK2A 3G0ZA 4AHUA 2HHWA 3AVGA 2YNGA 5C42A 3VA0A 2FBTA 4FJMA 3ZT2A 3DLHA 4CJ4A 4O5BA 1CZBA 1D5AA 1NKCA 1JLEA 4KHQA 1BCOA 3KK1A 3V1RA 1LAWA 3VQ8A 4CF2A 4CCHA 4CK2A 4DSIA 2HHTA 3C95A 4CEBA 1RTHA 3K59A 4FLTA 3HPOA 1ITGA 4QOZB 3RMAA 4L8RB 3NBPA 2P51A 3HVRA 3DRPA 4OLAA 4BDYA 1YVUA 1UOCA 3SYZA 3KTQA 1RBTA 1BI4B 1Q9XA 4CGHA 1VSMA 4CJSA 3PX6A 1VK0A 1UA0A 3O3GA 3SJJA 3HPHA 3AO1A 4CEFA 4FYDA 3RRHA 3V9SA 3MXMA 4CEQA 2XY8A 4CGJA 4OKEA 4DTRA 4KTQA 4KB0A 4NCAA 1NK5A 1L3VA 4IG0A 1RDAA 3LWLA 4DSFA 2QKBA 4CF0A 3LZJA 4DLGA 3ZSOA 3T3FA 2OPRA 3S9HA 4FJGA 5E41A 4W5TA 4OVLA 4I2PA 4DMNA 4CFCA 4JRQA 3O4QA 2YHAA 1NKBA 2DFEA 3AVHA 1WSJA 3M8SA 2G8KA 4FJLA 4FLYA 3NF7A 2JLEA 4DTMA 2GUIA 3OJSA 1ASUA 1QSLA 3DRRA 4FZYA 3HL8A 1YT3A 3MEDA 5CZ1A 4LH5A 1IO2A 3ZSWA 1NK4A 3NH1A 3WNFA 3K5MA 1C0MA 1WSFA 3KIOA 4LSLA 2HW3A 2IDOA 4M3ZA 5C25A 2ATQA 4B9MA 2RPIA 3B6OA 4C8KA 1RILA 1Q9YA 5HROA 4C8OA 3SZ2A 3PX4A 4W5OA 2QK9A 2IS3A 1SKRA 1JL1A 3ZSRA 3SUNA 3KD5E 1WAJA 4CEEA 4O0IA 4FJJA 3V6DA 2KTQA 4OKJA 4CF1A 1RBSA 3ZSYA 1YTAA 4OKKA 1SUQA 4BACA 2DTUA 1B9FA 2YNHA 4KHWA 1UWBA 3IG1A 5KRSA 3OYFA 1S1VA 3QEVA 1RTJA 3QIOA 4F8RA 1NK7A 1S1WA 1HPZA 4M3UA 4DU4A 3EYZA 3AV9A 4CHPA 3F9KA 4KRFA 4GMJB 1BQMA 4Q5VA 2O4GA 3EY1A 4DQIA 4KI4A 1G15A 2ZE2A 4FM2A 3V9XA 3S3OA 1ZBIA 2G8UA 3DLEA 2IAJA 3VQDA 1T05A 4J2BA 1KCFA 1IG9A 4AHSA 2LSNA 3DLRA 1RTDA 1LWEA 1WN7A 1HJRA 4E7KA 4CFDA 4IBNA 3I0RA 3KLFA 4R5PA 2F8TA 5HRRA 5FRNA 1ZBHA 4FJ9A 5C24A 3ITHA 4CERA 4AH9A 1XI1A 4E89A 2E6LA 3HVTA 3E01A 5J1EA 3ISNC 2DY4A 5DMRA 3M8PA 4DS4A 3QEXA 1KLNA 2X78A 1C1BA 1EP4A 4E1NA 4OGCA 3TABA 4B9LA 1XWLA 3A2FA 4B9UA 4N47A 1QQCA 4HHTA 3JYTA 3RMCA 1RT4A 1S6PA 4FJ7A 3AVFA 3SPYA 1LWCA 2QXFA 3C6UA 3DOKA 4B08A 4CHNA 1EX4A 1MU2A 4OPKA 3HO1A 4B3OA 4O44A 3RMDA 4M42A 1RDCA 3LWMA 1T03A 3SPZA 1IKVA 1TGOA 3NE6A 2Z1IA 4FJXA 4Z4FA 1KVAA 1R0AA 4FJIA 4NYFA 3OYNA 3OYHA 3MXJA 5JS1A 4CK3A 4CJLA 3K57A 3TAPA 3D45A 4ELUA 1JLGA 4C8MA 3SCXA 2AJQA 3DRSA 1X9WA 1T8EA 4HCCA 2ITGA 5KGXA 3SNNA 4M3TA 1VRUA 5DK5A 4BDZA 1C0TA 3QEIA 1VSIA 5EU7A 4CJFA 2RF2A 3LP2A 4H4MA 4CJ3A 3MEGA 4PA1A 4CECA 5HP1A 2G8WA 4F3OA 1IKWA 2HVIA 5I42A 1ZYQA 3LP3A 3QEWA 4DTPA 3AA2A 3AVNA 4CHZA 1A5WA 1BIZA 5CYQA 4I9LA 4FCYA 1NOYA 3CM6A 3U3GA 4QAGA 2PYJA 4Q0BA 4QCLA 1TK8A 2B5JA 1KVCA 1X1PA 4CIGA 1SKWA 4BE2A 4J2DA 1JXBA 1IKXA 5KGWA 3V9UA 4CJUA 4DSEA 3HSTB 1TKDA 4FJ8A 2OA8A 2KW4A 1CXUA 4TSXA 4Z4HA 3VQ6A 3ZCMA 4GVMA 1HYVA 3DOLA 2OZMA 1L3SA 1NK9A 2P1JA 3AA4A 4EZ6A 5CYMA 4KPYA 1Y97A 2B6AA 1ZBUA 4NCGA 3DYAA 4CGFA 1O1WA 5HLFA 1RT5A 1EETA 4JS5A 4ELTA 4JRPA 1NKEA 4E7IA 2VWJA 2KZMA 3ZSXA 4ZHRA 5D3GA 3LPUA 3AA5X 1GOAA 3AVIA 4E1MA 1N6QA 4OJRA 3S3NA 2HNZA 3WNGA 3NGZA 2YNIA 1T7PA 3MEEA 1BISA 4DTXA 2Y1JA 4JS4A 3VQBA 4PWDA 3SUOA 1VSDA 4CHYA 4PQUA 4F2SA 3AO2A 1HRHA 1Q8IA 3IRXA 1BQNA 3VQQA 3OYJA 3RTVA 3L8BA 1WSEA 4KI6A 4EZ9A 1WNSA 2X6NA 1HQUA 4K8XA 5SZTA 1X9MA 4CJ5A 4KKOA 3LAKA 3RMBA 2G8FA 3VQ7A 2ETJA 4FJ5A 3AO3A 3V81A 2F96A 4BWJA 3VQ9A 1RT2A 4HVJA 1B92A 3RR7A 3L3UA 3TANA 3SQ2A 5I3UA 3DM2A 2HHQA 3OS2A 3DLBA 2IOCA 4O55A 4BE1A 4CJQA 1NJZA 2D0AA 4FK0A 3SUQA 4FK2A 2GV9A 3THVA 3O3HA 4MFBA 4FLXA 3TI0A 3TARA 4YNQA 4CJVA 4DTUA 1UAXA 5FRMA 3MXIA 3VQEA 1LAVA 1S1XA 1VRTA 3ZT4A 3RRGA 3H08A 2OZSA 1SKSA 1NJYA 2W42A 4KHNA 1KTQA 3HT3A 3WNEA 3AVMA 1TV6A 1ASVA 2FBVA 3HXMA 4DTNA 4E3SA 4B9SA 1RBUA 1DTQA 4DWIA 3ZSZA 4LD0A 3DI6A 4CHOA 3P5JA 3LALA 3JSMA 2A1RA 3VQ4A 1C6VA 3ZT1A 2RKIA 3PO5A 4PY5A 1TVRA 3KJVA 2VG6A 3TWHA 3L2QA 4KO0A 2A1SA 4FM0A 4CIFA 1VSEA 4NYNA 4BE0A 4I9QA 3HJFA 2HHUA 1J9AA 1TL3A 1VSLA 3OYGA 1TL1A 3SV4A 4FXDA 1HQEA 1XHXA 4GW6A 3CFOA 1BHLA 3TAGA 4FVMA 3ZSVA 4UQGA 1BI4A 3NF9A 1ZBLA 3SI6A 4AHVA 2YKMA 4J2AA 1S1TA 3V1QA 4MQ3A 3NHGA 3ZSQA 3QERA 3T19A 3NGYA 5K14A 3OYMA 3K5LA 4H8KA 3KKRA 3NH0A 4DFKA 4KHSA 1IH7A 4YFUA 2Z1HA 1BIUA 5KTQA 3MAQA 2YV0X 3VN5A 4RW4A 4CF8A 1FK9A 4RW8A 1HYSA 4I2QA 4CJTA 4CFBA 1RT1A 3MECA 1SL1A 3VQ5A 3KLIA 1FKPA 1NOZA 3C6TA 4OGEA 4RW9A 4M3RA 4CEAA 1LW2A 2JGUA 3I8DA 4FW2A 4M3YA 4LY7A 3U3YA 2ZD1A 1L5UA 3OJUA 4CJPA 2P5OA 1XHZA 4FZZA 4CGDA 3KKSA 1LWFA 3L2WA 1U47A 3UIQA 1S9EA 4FLZA 5J2NA 4F4KA 4DQQA 1GOCA 3L2UA 4FLWA 3TAMA 1A5XA 4DTJA 2XY5A 3PX0A 1KSPA 1RCHA 4ID5A 3SUPA 3BGRA 4O0JA 3TR8A 3LP1A 3OYEA 2D0CA 3NAEA 1D9DA 4FJNA 4FM1A 3D0PA 4AHCA 3I0SA 3LANA 4Z4GA 1RT3A 3VQPA 2XHBA 4AHTA 3PUFA 4CEZA 1B9DA 2IC3A 3OS0A 2HHSA 3K5OA 1WSHA 2YHBA 3OYKA 3KLHA 3NDKA 3RWUA 1IKYA 1WSGA 2O4IA 1I3AA 1NJWA 3ULDA 2VG7A 2G8IA 2HHXA 1DTTA 1BL3A 1K6YA 1WSIA 2X74A 4ID1A 5KRTA 5FDLA 4DQSA 4HTUA 4AHRA 2XY7A 2HMIA 3PO4A 3RR8A 3M8RA 1JXEA
chains in the Genus database with same CATH superfamily
3QO9A 3ENBA 3ENOA 2OPQA 1NGBA 1FXXA 2I7NA 1RTIA 3MCAB 2F8SA 5AQNA 5HRNA 3LAMA 3SQ1A 4B8AB 3EZWA 4X65K 4CZMA 3FZHA 4JD2B 2QKKA 2GBZA 2KQ2A 5GINA 4IFYA 5E84A 4J2EA 3CPEA 3H3NO 4YOYA 4BGBA 1DT9A 1MDUB 5F0XA 5I9EB 3L2VA 2YI1A 2JWLA 2V51B 4RW7A 4DFMA 4BC3A 4ZTFA 3CFPA 2HSTA 4B9QA 3H3OB 3SV3A 4OPJA 4PUOA 1NK0A 2UXDK 4DV0K 1HKGA 2HOEA 4MO4A 4FWKA 1KAXA 1Q82O 2ASOA 5FROA 4RG8A 3QFPA 2FF6A 4DR4K 1T6DA 1HNVA 5AQTA 1JLCA 4DR7K 4CF9A 1WOQA 1YVNA 4C1NI 4WFAL 4G9ZA 5T7BA 1Z6RA 4B8CA 4DKWA 3C6HA 2NRZA 4JKGB 4CZHA 1VSHA 4PL7A 3CCMN 5JLHA 2KZZA 3THYB 1KFDA 3VGMA 1N5YA 4LSNA 4H0VB 5M1KA 1BOTO 1YJWN 3CCQN 4W5QA 1FJGK 3HTVA 4JAXA 1VQLN 4B9VA 3CJ1A 4LFBK 4CGIA 3C94A 4C8LA 3TU5A 4NCBA 2YX6A 3VQAA 2PZSA 2Q97A 1W2BM 5H1SQ 5ELZA 1E4GT 3VPZA 4E0DA 1BGXT 4CEDA 4KB1A 2XRIA 1NMDA 3AVBA 1QVFM 1RBRA 2KFZA 4JI7K 4FOEA 4PL8A 3OYIA 3IAYA 2OPSA 3LDQA 4CJKA 3ZLJA 1LCUA 1Q86O 4E7JA 4ELVA 3AVLA 3QINA 3VEXA 3CQXA 1TAQA 3C0BA 4EP5A 4K42A 1J53A 2VWKA 2ZGYA 4YOVA 3MN5A 3VEYA 1S1UA 4IFEA 4HUFA 3KK3A 4DLEA 5TKWA 2J4RA 2GELA 1QHTA 2PBDA 4KREA 4IG3A 3HI0A 4BRAA 4Y1DA 1IBLK 3PIOL 3M8QA 4DV2K 1QTMA 1I94K 4A2BA 4FLVA 1S6QA 1X9SA 3RVCA 1JLQA 3CFRA 3VQCA 3E9PA 1LW0A 4O4GA 1QS4A 3SAHA 3FZMA 3H46O 4OLBA 4CGGA 1E4FT 4B1VA 1X3NA 5SWMA 3K2PA 1J54A 3MDQA 1G99A 3G0ZA 5AQHA 5BN9A 2YNGA 4FJMA 3VA0A 2FBTA 4MLEA 1CZBA 1NKCA 4PKIA 1JLEA 2O8CA 1HLUA 4CF2A 1LAWA 3A5LC 4CCHA 4DSIA 4CEBA 4L8RB 3QICA 4EFHA 3DRPA 4OLAA 2P9PA 1UOCA 3KTQA 1RBTA 3T7ZA 1Q9XA 2NRWA 4BG8A 4U7BA 3SJJA 3HPHA 3IDHA 5C2FA 3TTDA 4CEQA 4DR1K 4K25A 4KH5A 3QBXA 4KB0A 4NCAA 4GKJK 4NB4A 4DSFA 3S9HA 4DLGA 3DAWA 4FJGA 3QBWA 4W5TA 4JRQA 2YHAA 4YORA 4FJLA 3NF7A 3EKUA 2GUIA 1QSLA 1ASUA 4FZYA 1SAZA 1IV0A 4Y0WA 5KQDA 3THWB 4LH5A 3HOTA 1IO2A 3WNFA 4LSLA 2HW3A 2WC9A 3SJHA 2ATQA 4C8KA 3B6OA 3H45C 3FGUA 1IG8A 2QK9A 3ZSRA 4CEEA 4Z94A 4OKJA 5JLFA 2QWOA 3ZSYA 1YTAA 3SK3A 4BACA 2DTUA 2YNHA 1UWBA 3OYFA 1RTJA 3QIOA 1OKJA 4DU4A 4CHPA 1BA1A 5FPEA 4Q5VA 4KI4A 3S3OA 3AAQA 4IXCA 1IBMK 4J2BA 1KCFA 1VHXA 2LSNA 3DLRA 1LWEA 1WN7A 5KPRA 4IBNA 5FRNA 1ZBHA 4CERA 5HOOA 3CHWA 4E89A 2E6LA 3E01A 1NG9A 4OPHA 4RCHA 5DMRA 4JI3K 2X78A 1C1BA 2QWMA 3TABA 2VGNA 1RT4A 1S6PA 3AVFA 3SPYA 4B08A 4CHNA 4JI6K 4OO1J 2BUPA 4Z4FA 4NYFA 4CK3A 4BRHA 3TAPA 5AQFA 4C8MA 2AJQA 1T8EA 4HCCA 1K9MO 5KGXA 3SNNA 5FLXO 5DK5A 2VGMA 1VSIA 2RF2A 4CJ3A 1IKWA 3GE1A 4B1UB 3QEWA 4DTPA 1NBWA 1A5WA 5AQXA 3ID8A 3CJ7A 1NM1A 1TK8A 1SKWA 4BE2A 3E9OA 1TKDA 4B3TK 2KW4A 1BG3A 3CC2N 4DR5K 4KHPK 2OZMA 3DOLA 4BR4A 2BTFA 1NK9A 4EZ6A 5CYMA 2B6AA 3DYAA 5HLFA 4BRLA 1EETA 4JS5A 1VQ4N 4E7IA 4ZHRA 1GLAG 3AVIA 2P9KA 3THXB 1N6QA 5BR9A 2HNZA 5CR4A 3MX2A 1BISA 4DTXA 4CZKA 3L4IA 4PWDA 4BRGA 4WFBL 3SUOA 3AO2A 4O5FA 3ZX3A 3OHRA 1BQNA 3CC7N 1W97L 3THXA 3DXKA 1WNSA 2W41A 3H6EA 2O8FA 4EHTA 3AO3A 4H03B 4YDUC 2F96A 4HTLA 1RT2A 1GLLO 2Q1NA 3SQ2A 4BRMA 1HKCA 5I3UA 2QI2A 1YJNN 3THVA 4FLXA 2W6LA 4YNQA 2D0PA 4CJVA 1UAXA 3G4SN 3VQEA 4CZLA 1VRTA 3N4PA 4L3QA 4JKBA 4JK9A 5A2QO 1KTQA 1TV6A 2FBVA 3JXUA 3UE5A 4B9SA 3WXMB 1DTQA 3DI6A 1C6VA 4PY5A 3KJVA 2E2OA 4KO0A 2A1SA 3KHYA 3M1FA 4NYNA 5JMVA 4JKEA 3EO3A 2HHUA 1JCGA 4FWMA 1SQKA 1TL3A 1VSLA 1XHXA 2QTDA 2P9UB 4LF5K 1BI4A 1S1TA 3MK6A 4GY2B 4MQ3A 3NHGA 4DUZK 3NGYA 3OBWA 3AAPA 1YJ9N 3KKRA 2KKZA 4KHSA 2Z1HA 3MAQA 2YV0X 4JKAA 3CQYA 4RW4A 3F2KA 1HYSA 3RSEA 2F9TA 3PSFA 4WCEL 3CCUN 2P9SA 4LY7A 3VF6A 3O8MA 5FPNA 3G71N 1HR0K 3THYA 3KKSA 1LWFA 5AZJB 1U47A 1S9EA 4FLZA 2RE2A 4DTJA 3GG4A 2QA4N 4O0JA 4FJNA 2D0CA 1VQPN 1B9DA 3MX5A 2GWKA 1NJWA 2VG7A 4B1WB 1K6YA 2GWJA 1NGGA 3PO4A 2I7PA 3DXMA 1U6ZA 4DV6K 1U49A 1W0HA 3CMEN 5M1FA 2RN2A 5HBMA 3NCIA 4FVUA 5AQWA 3V4IA 4F3TA 1ZXOA 5HRSA 1W9HA 4B9TA 3IS9A 1QVGM 4W5RA 2IVPA 3BF3A 4DSKA 4LFAK 3EKSA 5AQIA 1C1AA 3NF8A 3AA3A 3CCEN 1LV5A 1XNQK 2QWLA 5GAGP 4IDKA 2HF4A 1SZ2A 2KFNA 1ZBSA 3QMLA 1U45A 1NJXA 4DU3A 4GV3A 5HRPA 2BDPA 4E7LA 2OYQA 5AJ3K 2YKNA 1KXPA 3DLKA 2A42A 3SQ4A 4IDHA 3OS1A 1V4TA 4KH6A 5AFUA 1TK0A 3T1AA 3ALYA 3HBTA 3O4WA 1GLFO 1T6CA 2D4WA 3CYMA 2IIRA 2E4LA 4HUGA 1WAFA 4DR2K 2CH5A 2W6KA 3T1HK 3TPQA 3G10A 4FK4A 3J7AP 3CJCA 1VSFA 4BGAA 5JVHL 3AO4A 2DFHA 1JLFA 4DSLA 3CJ9A 1U04A 4CHQA 3DMJA 1TYQA 3O1WA 3TSPA 4BG9A 2KLAA 3O3FA 4FZXC 1HYZA 4K0KK 3IUCA 4DFPA 3CG7A 2FC0A 1K8KB 3J7ZO 1RDDA 3NH2A 4JKGA 2P9PB 4IOCL 3NFAA 5GAHP 3KD1E 4KHYA 4JHDA 4AQYK 1L3UA 1FW6A 4EP4A 5AQZA 3VOVA 4MDAA 1D8YA 3CETA 2JWKA 1RBVA 4CJEA 3D6RA 4AILC 1N33K 4JLHA 2A5XA 1NMNA 3S3MA 2BH1A 4ILGB 1YUWA 4CJ7A 3LP0A 1HMVA 3QNOA 1KRPA 1OVYA 2OPPA 1VSJA 4FSVA 1ATSA 3V1OA 1RDUA 4H4OA 2Q2RA 4KTZA 2NRHA 3KLEA 1L3TA 4Z4EA 3PSIA 3BP8A 1X3MA 4K41A 2G8HA 4LF9K 1JKHA 1VQNN 3VF2A 3OYBA 3QESA 3O80A 1TKTA 1YAGA 1JL2A 4RW6A 4M45A 4OX9K 3K58A 4N41A 3KVGA 1QSYA 1OH6A 2P5GA 1EO1A 1CZAN 4BWMA 1NGIA 1E3MA 2EHGA 2PAVA 1RT7A 3OYAA 2IVNA 4DQPA 4W5NA 2A6AA 1U2VB 3OYLA 5EX5A 4CZFA 3HM9A 3EZ5A 4Z0UA 1U4BA 4DV4K 2ZQBA 3DWLA 3LM9A 4DTSA 4E7HA 2X6SA 4CZIA 4BQZA 2EX3A 3MWPA 2QWPA 3K5NA 2UUCK 4CBXA 4H5RA 5EVZA 1S22A 4FWRA 2DFFA 5AZIB 3T1YK 5C12A 3ZT2A 3DLHA 1BUPA 4DR6K 3V1RA 3VQ8A 3W0LA 2HHTA 2NRTA 2Q36A 1ITGA 4J8FA 3ZX0A 2H3GX 3O9QA 4LC9B 4BDYA 2EWSA 4CVNE 3HSCA 4CJSA 3FZLA 4WQ5C 4FYDA 3ZX2A 3MXMA 2XY8A 4CGJA 1QQMA 4KTQA 1S72N 1RDAA 3LWLA 4IOAL 3T3FA 1NGAA 2VQEK 2OZSA 4IOXA 4CFCA 3O4QA 2DFEA 2QWNA 3AVHA 4FLYA 1NU0A 4CBUA 4ILHA 4BR5A 4JK8A 1HNWK 3ZSWA 3NH1A 1C0MA 3KIOA 1GLEG 1RILA 1Q18A 4I6MA 1JCEA 3S41A 4W5OA 1SKRA 4GKKK 1QQNA 3ZETB 2ZWHA 3IKMA 3W3DA 3V6DA 4BR9A 4CF1A 1RBSA 3R1XA 4QS7A 2E1YA 3WXKA 3QEVA 1XC3A 4BC2A 3EYZA 3F9KA 3D2EB 2O4GA 4H5TA 3EY1A 4DQIA 4FM2A 2ZE2A 4H0PA 1C0GA 4E7KA 2WUSA 4H0TB 3KLFA 5HRRA 4CZGA 1NGHA 4PHTX 3ISNC 2DY4A 2P9IB 3E66A 4JK7A 1EP4A 4B9LA 4OGCA 5ADXA 5LMUK 1XWLA 3CF5L 1QQCA 4HHTA 3JYTA 4H0OA 5AQRA 3C6UA 3HO1A 1EX4A 4JEPA 4CD1A 3RMDA 4M42A 1T03A 5E26A 1ESVA 3SPZA 3NE6A 2Z1IA 2ZM6K 1TYQB 3LDPA 2ZGZA 3UKUB 4ELUA 1JLGA 3DRSA 1WB9A 2ITGA 2DPNA 3TSQA 3QEIA 4CJFA 1BA0A 5EU7A 4H4MA 5AZIA 3CC4N 3MEGA 4F3OA 2HVIA 2QW9A 4B1XB 4V19S 5CYQA 2OTJN 5AR0A 4NO7A 4FCYA 1NOYA 2CGJA 3CM6A 3O9TA 3MN6A 4QAGA 3K9KA 1KAZA 1X1PA 4CIGA 4J2DA 1IKXA 2P9UA 5KGWA 2P9LA 3V9UA 1CXUA 4TSXA 4Z4HA 4DV5K 2ZJRL 3VQ6A 4BRCA 3J8AA 3U9ZA 1L3SA 3VGKA 2ZJPL 3AA4A 1Y97A 1ZBUA 4NCGA 4JRPA 5BR8K 2VYPA 4JD2A 3AA5X 3CCLN 2A40A 3O5BA 3ATUA 5BPNA 3NGZA 2YNIA 1JCFA 1VSDA 2Q31A 1NGJA 4EHUA 4R79A 5M1QA 4JI5K 3NVKA 1ATRA 2X6NA 4K8XA 3HRGA 5M1PA 2E8AA 2G8FA 2ETJA 4BR7A 2CH6A 2VQFK 3CCJN 4DQ8A 4FWOA 1NJZA 4GVEA 3TI0A 5GAEP 3VEVA 3I8BA 4DTUA 3MXIA 2YHWA 1ATNA 3J80O 3HT3A 2WFBA 3GBTA 3HXMA 4DTNA 4E3SA 2UUBK 1RBUA 4LD0A 2E88A 3P5JA 3JSMA 3ZT1A 1TVRA 5CHIA 4FM0A 1ILYA 3AY9A 5AQJA 2A3ZA 4BE0A 3BZCA 2F4VK 4CD3A 2ASMA 1V4SA 2D1KA 1J9AA 3SV4A 1TL1A 4YOWA 4BRKA 3CFOA 2NZTA 4MDBA 3NF9A 3D7EO 4AHVA 2YKMA 4KH4A 3K5LA 4BY9C 3NH0A 4DFKA 1IH7A 5KTQA 4GV6A 2YCHA 1FK9A 4RW8A 4CJTA 4B1ZA 1RT1A 3MECA 5C10A 3DLLL 1MWKA 3VQ5A 3KLIA 3OBYA 3C6TA 1NOZA 4OGEA 4RW9A 4M3RA 3I8DA 3VENA 4FW2A 4M3YA 3U3YA 4ISFA 3OJUA 4CJPA 2P5OA 3VEWA 4FZZA 4IJNA 1EWQA 3UIQA 3ZETA 5J2NA 1GOCA 3L2UA 4FLWA 1A5XA 2XY5A 3U4LA 4ID5A 3LM2A 3O08A 3LANA 2F9WA 3VQPA 4ISGA 3NDKA 1WSHA 3ULEB 3ULDA 2G8IA 1DTTA 4BC4A 1BL3A 5AFUH 1BWFO 4H5WA 3HOSA 4CI6A 2G8VA 2I5JA 2W40A 4WF9L 1OH5A 3ID6A 4C23A 2E20A 3EEQA 4FJHA 2VG5A 2R7YA 4X66K 3CM5A 2D0BA 4HCBA 1XC9A 1WBBA 3CI5A 3LL3A 1H1VA 4WE1A 2P9IA 4C1NK 3F9MA 2E2PA 3V9WA 5KPTA 1HPMA 3CERA 3V9ZA 3AVKA 3ASMA 2HMPA 4PKGA 2BANA 4Z4CA 1TK5A 4DQRA 1D9FA 3QNNA 4B9NA 4JI2K 4DFJA 1KFSA 3WQTA 1JLAA 3NGIA 1DLOA 3AGKA 2WBNA 3BDPA 3L6QA 3DLGA 4WQ5A 3IFRA 1HNIA 3HP6A 5CZ2A 3VEZA 4Y1CA 2CGKA 4M3WA 3CJBA 2HB5A 2NNWA 4FWNA 1GOBA 4CESA 2P9SB 2OTLN 1TAUA 1TKXA 4AM7A 3R8EA 1QE1A 4XIUA 3R3LA 3L2RA 4NLCA 2WONA 4KTWA 3PY8A 1GLBG 3TAQA 3LDLA 1ZBFA 1OVQA 4FLUA 1EKEA 2QWQA 3CIPA 4JV5K 2GTDA 3LZIA 4H5NA 4B3RK 3KLGA 4CE9A 1F21A 4ILJA 2E6MA 4CJRA 1N32K 1GLCG 2KHOA 1RDBA 4CIEA 4BDPA 4DSJA 4CK1A 3GL1A 4O8KA 1A5VA 3SQ0A 4CJWA 4DS5A 4M3XA 1KVBA 2BGGA 5BRFA 1EXQA 4YOTA 2HNYA 1REVA 3LDSA 4KAZA 2Y1IA 5BPLA 4FOIA 2B4JA 4FWLA 4CEOA 5AQOA 5KPZA 4IFVA 1EQYA 2Z1GA 3HYFA 3MMVA 2O8BA 2HHVA 4BC5A 1NK8A 1NK6A 3A8YA 4DTOA 3MN7A 3ULEA 3HPGA 3AVAA 2AA4A 4FWQA 2O8BB 1U48A 5MLCQ 4GV9A 4DF4A 3CD6N 3QIPA 2HNDA 2PYLA 1CLQA 4H5VA 2Z1JA 4HWIA 2D5RA 4K8ZA 3EN9A 4ICLA 1S9GA 3ZYYX 4KFBA 2FBXA 3LPTA 3VA3A 3VF4A 5J2PA 3C7NB 3WEEB 1GLJO 3HK2A 1NGCA 4AHUA 2HHWA 3AVGA 3OW2M 5C42A 5LJVA 4O5BA 1D5AA 1BCOA 3KK1A 1OH7A 3BF1A 3WUHA 3WXJA 3KZBA 3A5NC 3CXCM 4O8UA 1RDWX 1RTHA 3K59A 3HPOA 4QOZB 3RMAA 3NBPA 2HBKA 2P51A 3HVRA 3AARA 5BREA 3SYZA 1BI4B 3AO1A 3RRHA 3V9SA 4ISEA 4OKEA 4DTRA 3VEOA 1NK5A 1L3VA 1DGKN 2QKBA 3P4IA 4CF0A 3RWUA 4OVLA 4I2PA 4BVPA 1WSJA 3M8SA 2G8KA 2O8DA 3DJCA 3HL8A 3MEDA 4BQLA 3O9UA 3L4QA 2IDOA 4B9MA 4C8OA 1Q9YA 3LDNA 3N4QA 5HROA 1X9JA 1QZ6A 5EY4A 3PX4A 2YHYA 4WQ4C 2QWRA 1JL1A 3SUNA 4FJJA 1WAJA 2KTQA 2NLXA 3A5OC 1SUQA 3IG1A 5KRSA 1S1VA 3TTFA 4F8RA 1XQSC 3R6MA 1HPZA 1RGIA 5CE3A 1NK7A 4M3UA 1M1KO 3AV9A 1SS6A 4KRFA 1LOTB 3V9XA 3FZFA 3VTHA 1ZBIA 1Q7YO 3DLEA 2IAJA 3VQDA 4LF8K 1IG9A 4AHSA 1NGFA 4M63C 5AQSA 1RTDA 4CFDA 3I0RA 4R5PA 2F8TA 2HBLA 2E1ZA 3QFUA 4FJ9A 3ITHA 1VQ9N 1XI1A 3UKRB 1C0FA 1KLNA 4E1NA 1NNEA 4IJAA 4KBOA 1VQKN 4FJ7A 3I33A 1LWCA 4OPKA 4WYBA 4O44A 3LWMA 2QM1A 4FJIA 3FLCO 3GDQA 5JS1A 3OYNA 4CJLA 1X9WA 3LDOA 1VRUA 3U6FA 1C0TA 4BROA 1S3XA 5HP1A 4CECA 2G8WA 1DKGD 5I42A 1YIJN 3AVNA 1BIZA 1HKBA 4Q0BA 4BRPA 3U3GA 4QCLA 1KVCA 5FPDA 1JXBA 4EIAA 4CZEA 4CJUA 4DSEA 3HSTB 3P38A 3P31A 2WTUA 2OA8A 4JI8K 4EAHD 3ZCMA 1HYVA 5M1NA 2P1JA 2RHKA 4KPYA 4MLHA 1HJOA 1O1WA 4I6MB 2VWJA 2KZMA 3ZSXA 5D3GA 1YHQN 4E1MA 4OJRA 4QS8A 3WNGA 4XH1A 2Y1JA 3VQBA 4YY3K 3KWGA 5GADP 1VQ5N 4PQUA 1HRHA 1Q8IA 2NRVA 2P9NA 3IRXA 5JVGL 3WT0A 1NJIO 3VQQA 3OYJA 3RTVA 1KQSM 3L8BA 1WSEA 4LF7K 3SLCA 5SZTA 4CJ5A 3BUZB 2F7TA 2QEXN 3RMBA 5KQ8A 3V81A 3THWA 4BWJA 3TTCA 2D0OA 4HVJA 2UYTA 3TANA 2IOCA 2D0AA 3SUQA 4H0YB 1W7AA 4WFNL 4MFBA 3O3HA 4BRIA 1MA9B 1S1XA 1NJYA 3JAMO 3WNEA 4FPAA 4CHOA 1WBDA 3LALA 3VQ4A 2RKIA 5DM7L 3TWHA 2VG6A 3L2QA 3CCRN 4BRQA 3VTIA 1VSEA 5AQUA 4UY8O 4LF6K 3SMSA 1XUPO 3OYGA 4FXDA 1HQEA 5BRDA 3TAGA 4FVMA 3ZSVA 4J2AA 3V1QA 2E2QA 3ZSQA 3QERA 3G6EN 4JHDB 5K14A 3OYMA 4H8KA 4NLBA 1BIUA 1K8KA 4CF8A 1VAZA 3D2FA 1N36K 4B1YB 1SL1A 1FKPA 4CEAA 5IT9O 3J81O 3K9JA 1EWRA 2ZD1A 1L5UA 4IZ9A 4FO0A 5IWAK 4CGDA 4X64K 3L2WA 1HX1A 4BRFA 3TAMA 1RCHA 3SUPA 3BGRA 3OYEA 4FWPA 3LP1A 4IWVA 4F9OA 3NAEA 1D9DA 4NXNK 4FM1A 3D0PA 4AHCA 1M90O 3BY5A 1RT3A 4Z4GA 1BO5O 4CEZA 2IC3A 3OS0A 2HHSA 3K5OA 3KLHA 2O4IA 1WSGA 1O13A 2FSNA 1HNZK 2HHXA 4A62A 4H0XB 1WSIA 2X74A 4ID1A 3AGRA 3RR8A 3M8RA 1JXEA 4DHYA 3ZT3A 2O8EA 3IMXA 2CGLA 4JYAK 3VMFB 2XO7A 4KV8A 1HUXA 4YOXA 1NLVA 4N5SA 1NGDA 2HBMA 4IO9L 1J5OA 3CMAN 2FSJA 1JLBA 1IJJA 1SL0A 1NWKA 3AVCA 3L3VA 4N56A 2NUBA 1Z25A 3JS6A 1ASWA 4GNIA 3L0QA 5JS2A 3M3ZA 1Y64A 3C65A 3WXIA 2E5LK 3HM8A 1CXQA 1Z26A 1RT6A 4I7FA 5LL6Z 3VESA 4K43A 3CCSN 3CPWM 1TKZA 2Q0UA 4IO8A 1T3VA 3I56N 2IVOA 1CZ9A 3TAEA 5AQYA 1S5JA 5LMNK 1YTUA 1C0UA 4DG1A 2IGIA 4Z4IA 1WUAA 4CFAA 3NF6A 3OVNA 3CQ8A 2FXUA 2YNFA 5LJWA 3SAFA 4FW1A 4BVOA 3H1QA 3OTOK 3WNHA 2BE2A 4DU1A 2XY6A 3PV8A 4E1JA 3KK2A 3QEPA 4DUYK 2VCPA 4A59A 5B8HA 3OY9A 4IKFA 4XEIA 3M6GA 5AQLA 4ZTJA 2ASPA 2GEMA 1N34K 1UA1A 4A5AA 2Q3SA 4F2RA 4LFCK 5KI6A 2ZF5O 3HP9A 3NVMA 1VQ7N 3QETA 5GIPA 5J2QA 3AO5A 3F5TA 1SL2A 3FFIA 4MO5A 3J7YP 3P83D 5GIOA 2ZJQL 5AZJA 3QLHA 4IEIA 3B6PA 3SAGA 1SV5A 3BEXA 1YITN 4M7YA 5CY4A 4FJKA 3KK7A 2O8DB 1K8AO 2QXLA 3U8XA 4JKCA 4FPBA 3MWTA 3FE1A 1BU6O 4LF4K 4N76A 5C2DA 4RWTA 1QZ5A 4G1QA 4DV7K 2WOMA 2V52B 1QSSA 1FKOA 2YJFA 1XNRK 5JICA 2HVHA 3O4NA 5LY3A 1WLJA 2FBYA 4C8NA 1KAYA 1YXQA 3AVJA 4BRNA 4M41A 4A5BA 4DB3A 5BPMA 1KLMA 4KHUA 3OYDA 4XH5A 2HBJA 4E19A 1BCMA 3ZT0A 1VSKA 1VQ6N 3U9DA 5J2MA 4OPAA 3TAFA 4DF8A 1RNHA 3OYCA 3K0SA 4HUEA 2PY5A 3P1GA 3UKUA 3R9PA 4LH4A 4CBWA 1BDGA 4JKFA 1C1CA 4DCHA 1I39A 4JI4K 3F73A 5AQMA 4BR0A 4JI1K 4DR3K 4CJ4A 3QB0A 2OCEA 4KHQA 3O6WA 5DM6L 2FF3B 4CK2A 3C95A 4FLTA 5TKYA 4B3SK 1YVUA 5C15A 2FLOA 4CGHA 1VSMA 3PX6A 1VK0A 3C7NA 1UA0A 3O3GA 4CEFA 3FZKA 5HL7L 4IG0A 3LZJA 3ZSOA 2OPRA 5E41A 4DMNA 1NKBA 3DXMB 2A41A 1YI2N 4DTMA 2JLEA 3ATVA 2UU9K 2UUAK 3OJSA 3O9RA 2HHHK 3DRRA 1N8RO 1YT3A 3ZEUA 3EE8A 5CZ1A 1NK4A 3K5MA 1WSFA 4M3ZA 4U67L 1J5EK 5C25A 2RPIA 3SZ2A 2IS3A 1TUUA 4JNEA 3KD5E 1GLDG 1T44A 4O0IA 5ADXH 4OKKA 3E1YA 3VETA 1B9FA 5BRHA 3UKRA 2ITMA 3MCPA 5F1XA 3A0IX 4A2AA 1S1WA 4AM6A 1MWMA 2P9KB 3MN9A 1KD1O 4GMJB 1BQMA 1G15A 4PKHA 2G8UA 3Q7BA 1IBKK 1P90A 1T05A 4JKDA 4BRDA 3WEEA 2O8FB 1HJRA 3SBTA 4FWSA 2GX9A 2NRXA 3DXKB 4X62K 5C24A 4AH9A 1QHAA 3HVTA 5J1EA 5EOYA 3PLAA 4YHHK 3M8PA 4DS4A 3SBGA 3B8AX 2V7ZA 3QEXA 3A2FA 3UB5A 4DV3K 4B9UA 2O8CB 4N47A 3WXLA 3RMCA 5AQPA 2QXFA 3DOKA 5EXWA 4B3OA 4XH4A 1MU2A 1TUYA 1XMOK 2Q0RA 1RDCA 3GOIA 1IKVA 1TGOA 4CZJA 4FJXA 1KVAA 1R0AA 4JI0K 3OYHA 3MXJA 1XMQK 3K57A 4WQ4A 3D45A 3SCXA 3FFKB 2PFUA 3M5RA 2YJEA 4M3TA 5F2RA 3E9LA 4BDZA 1ZBLA 4KI6A 3SMPA 1NGEA 2VWBA 3LP2A 4PA1A 1ZYQA 3LP3A 3FR0A 3QDKA 2UXBK 3AA2A 2OANA 4CHZA 5FPMA 3ENHA 4I9LA 2PYJA 2B5JA 4BREA 4FJ8A 2P9NB 3EL2A 4GVMA 4JKHA 4CGFA 4RTFD 3A5MC 3PIPL 4ELTA 1RT5A 1NKEA 3OA9A 3RSEB 3O9SA 2P9LB 3BZKA 3LPUA 1GOAA 3S3NA 3HZ6A 1T7PA 3MEEA 4JS4A 1RFQA 3CJAA 4CHYA 4JN4A 4F2SA 2NRRA 3O1BA 4A61A 3WQUA 4FL9A 4CW7B 1R59O 1JJ2M 1DEJA 1VQ8N 2FSKA 3KWIA 1K73O 5C0YA 4EZ9A 4YDUA 1HQUA 1X9MA 4QS9A 1VQON 4KKOA 4NXMK 2UXCK 5AQQA 3LAKA 5BN8A 4FJ5A 3VQ7A 3ZEUB 3VQ9A 2O8EB 1B92A 1U2VA 3RR7A 3L3UA 2HHQA 3DM2A 4M7XA 3OS2A 3DLBA 4O55A 4BE1A 4CJQA 4FK0A 4FK2A 2GV9A 3TARA 1OH8A 1Z05A 5FRMA 3Q7CA 1LAVA 3RRGA 3ZT4A 3TSUA 3H08A 1SKSA 3G25A 2W42A 4KHNA 3D2EA 3AVMA 1ASVA 5AQKA 1ZC6A 4DWIA 3ZSZA 4BR2A 1P8ZA 2A1RA 3EE9A 3PO5A 3C6AA 3P39A 4CIFA 4I9QA 3HJFA 1D4XA 3CCVN 2GUPA 2AP1A 1KC8O 4GW6A 1BHLA 4AF1A 4UQGA 2HF3A 3SI6A 3H1VX 2YHXA 3T19A 4A57A 4YFUA 1YF5L 1J6ZA 3VN5A 4I2QA 4CFBA 5AQVA 4DV1K 4IEEA 1LW2A 2JGUA 3VGLA 1XHZA 1HNXK 5M1OA 1QQOA 3VERA 4F4KA 4DQQA 4KHWA 3PX0A 1KSPA 1Q81O 3TR8A 5AQGA 3I0SA 2E2NA 3D2FB 4AHTA 3PUFA 2XHBA 1VQMN 2V7YA 3OYKA 3NMUA 2YHBA 4YOUA 1IKYA 1I3AA 3T69A 5KRTA 4B3MK 4DQSA 5FDLA 4HTUA 4AHRA 2XY7A 3I55N 2HMIA
chains in the Genus database with same CATH topology
2G8VA 2I5JA 3QO9A 3ZT3A 2OPQA 1U49A 1FXXA 1W0HA 1RTIA 2F8SA 4FJHA 2RN2A 5HBMA 2XO7A 3NCIA 5HRNA 3LAMA 2VG5A 4KV8A 2R7YA 3SQ1A 3CM5A 2D0BA 4B8AB 3V4IA 4HCBA 4F3TA 1XC9A 4N5SA 5HRSA 4WE1A 2QKKA 1W9HA 2GBZA 2KQ2A 1J5OA 4B9TA 4IFYA 3IS9A 4J2EA 4W5RA 3V9WA 1JLBA 1SL0A 4DSKA 3AVCA 3L3VA 1C1AA 4N56A 3NF8A 2NUBA 1Z25A 3AA3A 1ASWA 3L2VA 3V9ZA 3AVKA 5JS2A 3ASMA 1LV5A 4RW7A 2BANA 4Z4CA 4DFMA 4ZTFA 4DQRA 4IDKA 1TK5A 3CFPA 1D9FA 3QNNA 4B9NA 4DFJA 1CXQA 1KFSA 2KFNA 1Z26A 1RT6A 4I7FA 3SV3A 1U45A 1NJXA 4OPJA 1JLAA 3NGIA 4DU3A 1NK0A 4PUOA 1DLOA 1TKZA 5HRPA 2BDPA 1CZ9A 5FROA 3TAEA 1S5JA 4E7LA 3BDPA 1YTUA 4RG8A 3DLGA 2OYQA 1C0UA 4DG1A 2IGIA 4Z4IA 1HNIA 4CFAA 2YKNA 3U6FA 3HP6A 3DLKA 3NF6A 1HNVA 5CZ2A 4Y1CA 1JLCA 3OVNA 3CQ8A 4M3WA 2YNFA 3SQ4A 2HB5A 4CF9A 3OS1A 4FW1A 1TK0A 5T7BA 3T1AA 4B8CA 3ALYA 1GOBA 3CYMA 4CESA 3WNHA 2E4LA 4HUGA 1VSHA 1WAFA 1TAUA 1TKXA 2BE2A 4DU1A 2XY6A 3PV8A 1QE1A 3G10A 4XIUA 3KK2A 3L2RA 3QEPA 4FK4A 2KZZA 1VSFA 2WONA 4KTWA 3AO4A 1KFDA 2DFHA 3PY8A 1JLFA 3OY9A 4DSLA 1N5YA 4IKFA 3TAQA 1U04A 4CHQA 4LSNA 3DMJA 1ZBFA 4W5QA 4ZTJA 4FLUA 3O3FA 4FZXC 1HYZA 4B9VA 1EKEA 3CG7A 4DFPA 2FC0A 4CGIA 1RDDA 3C94A 1UA1A 4C8LA 3NH2A 4NCBA 3LZIA 3NFAA 3KLGA 3KD1E 3VQAA 4KHYA 2Q3SA 4F2RA 4CE9A 1F21A 1L3UA 2PZSA 5KI6A 4EP4A 3HP9A 2E6MA 4E0DA 1BGXT 4CEDA 1D8YA 4CJRA 4KB1A 2XRIA 3AVBA 3QETA 1RBRA 5J2QA 1RBVA 1RDBA 3AO5A 4CJEA 4CIEA 1SL2A 4BDPA 2KFZA 3FFIA 4DSJA 4AILC 4CK1A 3OYIA 1A5VA 3P83D 4JLHA 3SQ0A 4CJWA 3S3MA 4DS5A 3QLHA 4M3XA 3IAYA 3B6PA 2OPSA 1KVBA 3LP0A 1HMVA 1SV5A 4CJKA 3QNOA 1KRPA 2BGGA 2OPPA 5CY4A 1EXQA 1VSJA 4FJKA 4E7JA 2HNYA 1REVA 4ELVA 3AVLA 3QINA 3V1OA 3LDSA 4KAZA 4H4OA 2Y1IA 1TAQA 2B4JA 4CEOA 4KTZA 4IFVA 4EP5A 3KLEA 1L3TA 2Z1GA 3HYFA 4Z4EA 1J53A 2VWKA 2HHVA 1NK8A 1S1UA 4HUFA 4N76A 3KK3A 4G1QA 2G8HA 1NK6A 4DLEA 1JKHA 4DTOA 3OYBA 3QESA 2WOMA 1TKTA 3HPGA 3AVAA 1QSSA 1JL2A 1FKOA 2HVHA 1QHTA 3O4NA 1WLJA 4KREA 2FBYA 4C8NA 4RW6A 4M45A 3K58A 4N41A 1QSYA 4IG3A 3AVJA 2P5GA 4Y1DA 1U48A 3M8QA 4M41A 1QTMA 4BWMA 4DF4A 2EHGA 1KLMA 4KHUA 3OYDA 4FLVA 1RT7A 1S6QA 3OYAA 4DQPA 4E19A 1X9SA 3QIPA 1BCMA 4W5NA 3ZT0A 3OYLA 1JLQA 1VSKA 2HNDA 2PYLA 1CLQA 5J2MA 3CFRA 2Z1JA 2D5RA 3HM9A 4K8ZA 3TAFA 4ICLA 1S9GA 3EZ5A 4KFBA 2FBXA 4Z0UA 3VQCA 1LW0A 1RNHA 3LPTA 4O4GA 3OYCA 4DF8A 1QS4A 1U4BA 4HUEA 3VA3A 2ZQBA 2PY5A 3P1GA 4DTSA 4E7HA 2X6SA 4LH4A 4OLBA 4CGGA 5SWMA 5J2PA 1C1CA 3K2PA 2EX3A 3K5NA 1J54A 1I39A 3F73A 2DFFA 3HK2A 3G0ZA 4AHUA 2HHWA 3AVGA 2YNGA 5C42A 3VA0A 2FBTA 4FJMA 3ZT2A 3DLHA 4CJ4A 4O5BA 1CZBA 1D5AA 1NKCA 1JLEA 4KHQA 1BCOA 3KK1A 3V1RA 1LAWA 3VQ8A 4CF2A 4CCHA 4CK2A 4DSIA 2HHTA 3C95A 4CEBA 1RTHA 3K59A 4FLTA 3HPOA 1ITGA 4QOZB 3RMAA 4L8RB 3NBPA 2P51A 3HVRA 3DRPA 4OLAA 4BDYA 1YVUA 1UOCA 3SYZA 3KTQA 1RBTA 1BI4B 1Q9XA 4CGHA 1VSMA 4CJSA 3PX6A 1VK0A 1UA0A 3O3GA 3SJJA 3HPHA 3AO1A 4CEFA 4FYDA 3RRHA 3V9SA 3MXMA 4CEQA 2XY8A 4CGJA 4OKEA 4DTRA 4KTQA 4KB0A 4NCAA 1NK5A 1L3VA 4IG0A 1RDAA 3LWLA 4DSFA 2QKBA 4CF0A 3LZJA 4DLGA 3ZSOA 3T3FA 2OPRA 3S9HA 4FJGA 5E41A 4W5TA 4OVLA 4I2PA 4DMNA 4CFCA 4JRQA 3O4QA 2YHAA 1NKBA 2DFEA 3AVHA 1WSJA 3M8SA 2G8KA 4FJLA 4FLYA 3NF7A 2JLEA 4DTMA 2GUIA 3OJSA 1ASUA 1QSLA 3DRRA 4FZYA 3HL8A 1YT3A 3MEDA 5CZ1A 4LH5A 1IO2A 3ZSWA 1NK4A 3NH1A 3WNFA 3K5MA 1C0MA 1WSFA 3KIOA 4LSLA 2HW3A 2IDOA 4M3ZA 5C25A 2ATQA 4B9MA 2RPIA 3B6OA 4C8KA 1RILA 1Q9YA 5HROA 4C8OA 3SZ2A 3PX4A 4W5OA 2QK9A 2IS3A 1SKRA 1JL1A 3ZSRA 3SUNA 3KD5E 1WAJA 4CEEA 4O0IA 4FJJA 3V6DA 2KTQA 4OKJA 4CF1A 1RBSA 3ZSYA 1YTAA 4OKKA 1SUQA 4BACA 2DTUA 1B9FA 2YNHA 4KHWA 1UWBA 3IG1A 5KRSA 3OYFA 1S1VA 3QEVA 1RTJA 3QIOA 4F8RA 1NK7A 1S1WA 1HPZA 4M3UA 4DU4A 3EYZA 3AV9A 4CHPA 3F9KA 4KRFA 4GMJB 1BQMA 4Q5VA 2O4GA 3EY1A 4DQIA 4KI4A 1G15A 2ZE2A 4FM2A 3V9XA 3S3OA 1ZBIA 2G8UA 3DLEA 2IAJA 3VQDA 1T05A 4J2BA 1KCFA 1IG9A 4AHSA 2LSNA 3DLRA 1RTDA 1LWEA 1WN7A 1HJRA 4E7KA 4CFDA 4IBNA 3I0RA 3KLFA 4R5PA 2F8TA 5HRRA 5FRNA 1ZBHA 4FJ9A 5C24A 3ITHA 4CERA 4AH9A 1XI1A 4E89A 2E6LA 3HVTA 3E01A 5J1EA 3ISNC 2DY4A 5DMRA 3M8PA 4DS4A 3QEXA 1KLNA 2X78A 1C1BA 1EP4A 4E1NA 4OGCA 3TABA 4B9LA 1XWLA 3A2FA 4B9UA 4N47A 1QQCA 4HHTA 3JYTA 3RMCA 1RT4A 1S6PA 4FJ7A 3AVFA 3SPYA 1LWCA 2QXFA 3C6UA 3DOKA 4B08A 4CHNA 1EX4A 1MU2A 4OPKA 3HO1A 4B3OA 4O44A 3RMDA 4M42A 1RDCA 3LWMA 1T03A 3SPZA 1IKVA 1TGOA 3NE6A 2Z1IA 4FJXA 4Z4FA 1KVAA 1R0AA 4FJIA 4NYFA 3OYNA 3OYHA 3MXJA 5JS1A 4CK3A 4CJLA 3K57A 3TAPA 3D45A 4ELUA 1JLGA 4C8MA 3SCXA 2AJQA 3DRSA 1X9WA 1T8EA 4HCCA 2ITGA 5KGXA 3SNNA 4M3TA 1VRUA 5DK5A 4BDZA 1C0TA 3QEIA 1VSIA 5EU7A 4CJFA 2RF2A 3LP2A 4H4MA 4CJ3A 3MEGA 4PA1A 4CECA 5HP1A 2G8WA 4F3OA 1IKWA 2HVIA 5I42A 1ZYQA 3LP3A 3QEWA 4DTPA 3AA2A 3AVNA 4CHZA 1A5WA 1BIZA 5CYQA 4I9LA 4FCYA 1NOYA 3CM6A 3U3GA 4QAGA 2PYJA 4Q0BA 4QCLA 1TK8A 2B5JA 1KVCA 1X1PA 4CIGA 1SKWA 4BE2A 4J2DA 1JXBA 1IKXA 5KGWA 3V9UA 4CJUA 4DSEA 3HSTB 1TKDA 4FJ8A 2OA8A 2KW4A 1CXUA 4TSXA 4Z4HA 3VQ6A 3ZCMA 4GVMA 1HYVA 3DOLA 2OZMA 1L3SA 1NK9A 2P1JA 3AA4A 4EZ6A 5CYMA 4KPYA 1Y97A 2B6AA 1ZBUA 4NCGA 3DYAA 4CGFA 1O1WA 5HLFA 1RT5A 1EETA 4JS5A 4ELTA 4JRPA 1NKEA 4E7IA 2VWJA 2KZMA 3ZSXA 4ZHRA 5D3GA 3LPUA 3AA5X 1GOAA 3AVIA 4E1MA 1N6QA 4OJRA 3S3NA 2HNZA 3WNGA 3NGZA 2YNIA 1T7PA 3MEEA 1BISA 4DTXA 2Y1JA 4JS4A 3VQBA 4PWDA 3SUOA 1VSDA 4CHYA 4PQUA 4F2SA 3AO2A 1HRHA 1Q8IA 3IRXA 1BQNA 3VQQA 3OYJA 3RTVA 3L8BA 1WSEA 4KI6A 4EZ9A 1WNSA 2X6NA 1HQUA 4K8XA 5SZTA 1X9MA 4CJ5A 4KKOA 3LAKA 3RMBA 2G8FA 3VQ7A 2ETJA 4FJ5A 3AO3A 3V81A 2F96A 4BWJA 3VQ9A 1RT2A 4HVJA 1B92A 3RR7A 3L3UA 3TANA 3SQ2A 5I3UA 3DM2A 2HHQA 3OS2A 3DLBA 2IOCA 4O55A 4BE1A 4CJQA 1NJZA 2D0AA 4FK0A 3SUQA 4FK2A 2GV9A 3THVA 3O3HA 4MFBA 4FLXA 3TI0A 3TARA 4YNQA 4CJVA 4DTUA 1UAXA 5FRMA 3MXIA 3VQEA 1LAVA 1S1XA 1VRTA 3ZT4A 3RRGA 3H08A 2OZSA 1SKSA 1NJYA 2W42A 4KHNA 1KTQA 3HT3A 3WNEA 3AVMA 1TV6A 1ASVA 2FBVA 3HXMA 4DTNA 4E3SA 4B9SA 1RBUA 1DTQA 4DWIA 3ZSZA 4LD0A 3DI6A 4CHOA 3P5JA 3LALA 3JSMA 2A1RA 3VQ4A 1C6VA 3ZT1A 2RKIA 3PO5A 4PY5A 1TVRA 3KJVA 2VG6A 3TWHA 3L2QA 4KO0A 2A1SA 4FM0A 4CIFA 1VSEA 4NYNA 4BE0A 4I9QA 3HJFA 2HHUA 1J9AA 1TL3A 1VSLA 3OYGA 1TL1A 3SV4A 4FXDA 1HQEA 1XHXA 4GW6A 3CFOA 1BHLA 3TAGA 4FVMA 3ZSVA 4UQGA 1BI4A 3NF9A 1ZBLA 3SI6A 4AHVA 2YKMA 4J2AA 1S1TA 3V1QA 4MQ3A 3NHGA 3ZSQA 3QERA 3T19A 3NGYA 5K14A 3OYMA 3K5LA 4H8KA 3KKRA 3NH0A 4DFKA 4KHSA 1IH7A 4YFUA 2Z1HA 1BIUA 5KTQA 3MAQA 2YV0X 3VN5A 4RW4A 4CF8A 1FK9A 4RW8A 1HYSA 4I2QA 4CJTA 4CFBA 1RT1A 3MECA 1SL1A 3VQ5A 3KLIA 1FKPA 1NOZA 3C6TA 4OGEA 4RW9A 4M3RA 4CEAA 1LW2A 2JGUA 3I8DA 4FW2A 4M3YA 4LY7A 3U3YA 2ZD1A 1L5UA 3OJUA 4CJPA 2P5OA 1XHZA 4FZZA 4CGDA 3KKSA 1LWFA 3L2WA 1U47A 3UIQA 1S9EA 4FLZA 5J2NA 4F4KA 4DQQA 1GOCA 3L2UA 4FLWA 3TAMA 1A5XA 4DTJA 2XY5A 3PX0A 1KSPA 1RCHA 4ID5A 3SUPA 3BGRA 4O0JA 3TR8A 3LP1A 3OYEA 2D0CA 3NAEA 1D9DA 4FJNA 4FM1A 3D0PA 4AHCA 3I0SA 3LANA 4Z4GA 1RT3A 3VQPA 2XHBA 4AHTA 3PUFA 4CEZA 1B9DA 2IC3A 3OS0A 2HHSA 3K5OA 1WSHA 2YHBA 3OYKA 3KLHA 3NDKA 3RWUA 1IKYA 1WSGA 2O4IA 1I3AA 1NJWA 3ULDA 2VG7A 2G8IA 2HHXA 1DTTA 1BL3A 1K6YA 1WSIA 2X74A 4ID1A 5KRTA 5FDLA 4DQSA 4HTUA 4AHRA 2XY7A 2HMIA 3PO4A 3RR8A 3M8RA 1JXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8V A;  2I5J A;  3QO9 A;  3ZT3 A;  2OPQ A;  1U49 A;  1FXX A;  1W0H A;  1RTI A;  2F8S A;  4FJH A;  2RN2 A;  5HBM A;  2XO7 A;  3NCI A;  5HRN A;  3LAM A;  2VG5 A;  4KV8 A;  2R7Y A;  3SQ1 A;  3CM5 A;  2D0B A;  4B8A B;  3V4I A;  4HCB A;  4F3T A;  1XC9 A;  4N5S A;  5HRS A;  4WE1 A;  2QKK A;  1W9H A;  2GBZ A;  2KQ2 A;  1J5O A;  4B9T A;  4IFY A;  3IS9 A;  4J2E A;  4W5R A;  3V9W A;  1JLB A;  1SL0 A;  4DSK A;  3AVC A;  3L3V A;  1C1A A;  4N56 A;  3NF8 A;  2NUB A;  1Z25 A;  3AA3 A;  1ASW A;  3L2V A;  3V9Z A;  3AVK A;  5JS2 A;  3ASM A;  1LV5 A;  4RW7 A;  2BAN A;  4Z4C A;  4DFM A;  4ZTF A;  4DQR A;  4IDK A;  1TK5 A;  3CFP A;  1D9F A;  3QNN A;  4B9N A;  4DFJ A;  1CXQ A;  1KFS A;  2KFN A;  1Z26 A;  1RT6 A;  4I7F A;  3SV3 A;  1U45 A;  1NJX A;  4OPJ A;  1JLA A;  3NGI A;  4DU3 A;  1NK0 A;  4PUO A;  1DLO A;  1TKZ A;  5HRP A;  2BDP A;  1CZ9 A;  5FRO A;  3TAE A;  1S5J A;  4E7L A;  3BDP A;  1YTU A;  4RG8 A;  3DLG A;  2OYQ A;  1C0U A;  4DG1 A;  2IGI A;  4Z4I A;  1HNI A;  4CFA A;  2YKN A;  3U6F A;  3HP6 A;  3DLK A;  3NF6 A;  1HNV A;  5CZ2 A;  4Y1C A;  1JLC A;  3OVN A;  3CQ8 A;  4M3W A;  2YNF A;  3SQ4 A;  2HB5 A;  4CF9 A;  3OS1 A;  4FW1 A;  1TK0 A;  5T7B A;  3T1A A;  4B8C A;  3ALY A;  1GOB A;  3CYM A;  4CES A;  3WNH A;  2E4L A;  4HUG A;  1VSH A;  1WAF A;  1TAU A;  1TKX A;  2BE2 A;  4DU1 A;  2XY6 A;  3PV8 A;  1QE1 A;  3G10 A;  4XIU A;  3KK2 A;  3L2R A;  3QEP A;  4FK4 A;  2KZZ A;  1VSF A;  2WON A;  4KTW A;  3AO4 A;  1KFD A;  2DFH A;  3PY8 A;  1JLF A;  3OY9 A;  4DSL A;  1N5Y A;  4IKF A;  3TAQ A;  1U04 A;  4CHQ A;  4LSN A;  3DMJ A;  1ZBF A;  4W5Q A;  4ZTJ A;  4FLU A;  3O3F A;  4FZX C;  1HYZ A;  4B9V A;  1EKE A;  3CG7 A;  4DFP A;  2FC0 A;  4CGI A;  1RDD A;  3C94 A;  1UA1 A;  4C8L A;  3NH2 A;  4NCB A;  3LZI A;  3NFA A;  3KLG A;  3KD1 E;  3VQA A;  4KHY A;  2Q3S A;  4F2R A;  4CE9 A;  1F21 A;  1L3U A;  2PZS A;  5KI6 A;  4EP4 A;  3HP9 A;  2E6M A;  4E0D A;  1BGX T;  4CED A;  1D8Y A;  4CJR A;  4KB1 A;  2XRI A;  3AVB A;  3QET A;  1RBR A;  5J2Q A;  1RBV A;  1RDB A;  3AO5 A;  4CJE A;  4CIE A;  1SL2 A;  4BDP A;  2KFZ A;  3FFI A;  4DSJ A;  4AIL C;  4CK1 A;  3OYI A;  1A5V A;  3P83 D;  4JLH A;  3SQ0 A;  4CJW A;  3S3M A;  4DS5 A;  3QLH A;  4M3X A;  3IAY A;  3B6P A;  2OPS A;  1KVB A;  3LP0 A;  1HMV A;  1SV5 A;  4CJK A;  3QNO A;  1KRP A;  2BGG A;  2OPP A;  5CY4 A;  1EXQ A;  1VSJ A;  4FJK A;  4E7J A;  2HNY A;  1REV A;  4ELV A;  3AVL A;  3QIN A;  3V1O A;  3LDS A;  4KAZ A;  4H4O A;  2Y1I A;  1TAQ A;  2B4J A;  4CEO A;  4KTZ A;  4IFV A;  4EP5 A;  3KLE A;  1L3T A;  2Z1G A;  3HYF A;  4Z4E A;  1J53 A;  2VWK A;  2HHV A;  1NK8 A;  1S1U A;  4HUF A;  4N76 A;  3KK3 A;  4G1Q A;  2G8H A;  1NK6 A;  4DLE A;  1JKH A;  4DTO A;  3OYB A;  3QES A;  2WOM A;  1TKT A;  3HPG A;  3AVA A;  1QSS A;  1JL2 A;  1FKO A;  2HVH A;  1QHT A;  3O4N A;  1WLJ A;  4KRE A;  2FBY A;  4C8N A;  4RW6 A;  4M45 A;  3K58 A;  4N41 A;  1QSY A;  4IG3 A;  3AVJ A;  2P5G A;  4Y1D A;  1U48 A;  3M8Q A;  4M41 A;  1QTM A;  4BWM A;  4DF4 A;  2EHG A;  1KLM A;  4KHU A;  3OYD A;  4FLV A;  1RT7 A;  1S6Q A;  3OYA A;  4DQP A;  4E19 A;  1X9S A;  3QIP A;  1BCM A;  4W5N A;  3ZT0 A;  3OYL A;  1JLQ A;  1VSK A;  2HND A;  2PYL A;  1CLQ A;  5J2M A;  3CFR A;  2Z1J A;  2D5R A;  3HM9 A;  4K8Z A;  3TAF A;  4ICL A;  1S9G A;  3EZ5 A;  4KFB A;  2FBX A;  4Z0U A;  3VQC A;  1LW0 A;  1RNH A;  3LPT A;  4O4G A;  3OYC A;  4DF8 A;  1QS4 A;  1U4B A;  4HUE A;  3VA3 A;  2ZQB A;  2PY5 A;  3P1G A;  4DTS A;  4E7H A;  2X6S A;  4LH4 A;  4OLB A;  4CGG A;  5SWM A;  5J2P A;  1C1C A;  3K2P A;  2EX3 A;  3K5N A;  1J54 A;  1I39 A;  3F73 A;  2DFF A;  3HK2 A;  3G0Z A;  4AHU A;  2HHW A;  3AVG A;  2YNG A;  5C42 A;  3VA0 A;  2FBT A;  4FJM A;  3ZT2 A;  3DLH A;  4CJ4 A;  4O5B A;  1CZB A;  1D5A A;  1NKC A;  1JLE A;  4KHQ A;  1BCO A;  3KK1 A;  3V1R A;  1LAW A;  3VQ8 A;  4CF2 A;  4CCH A;  4CK2 A;  4DSI A;  2HHT A;  3C95 A;  4CEB A;  1RTH A;  3K59 A;  4FLT A;  3HPO A;  1ITG A;  4QOZ B;  3RMA A;  4L8R B;  3NBP A;  2P51 A;  3HVR A;  3DRP A;  4OLA A;  4BDY A;  1YVU A;  1UOC A;  3SYZ A;  3KTQ A;  1RBT A;  1BI4 B;  1Q9X A;  4CGH A;  1VSM A;  4CJS A;  3PX6 A;  1VK0 A;  1UA0 A;  3O3G A;  3SJJ A;  3HPH A;  3AO1 A;  4CEF A;  4FYD A;  3RRH A;  3V9S A;  3MXM A;  4CEQ A;  2XY8 A;  4CGJ A;  4OKE A;  4DTR A;  4KTQ A;  4KB0 A;  4NCA A;  1NK5 A;  1L3V A;  4IG0 A;  1RDA A;  3LWL A;  4DSF A;  2QKB A;  4CF0 A;  3LZJ A;  4DLG A;  3ZSO A;  3T3F A;  2OPR A;  3S9H A;  4FJG A;  5E41 A;  4W5T A;  4OVL A;  4I2P A;  4DMN A;  4CFC A;  4JRQ A;  3O4Q A;  2YHA A;  1NKB A;  2DFE A;  3AVH A;  1WSJ A;  3M8S A;  2G8K A;  4FJL A;  4FLY A;  3NF7 A;  2JLE A;  4DTM A;  2GUI A;  3OJS A;  1ASU A;  1QSL A;  3DRR A;  4FZY A;  3HL8 A;  1YT3 A;  3MED A;  5CZ1 A;  4LH5 A;  1IO2 A;  3ZSW A;  1NK4 A;  3NH1 A;  3WNF A;  3K5M A;  1C0M A;  1WSF A;  3KIO A;  4LSL A;  2HW3 A;  2IDO A;  4M3Z A;  5C25 A;  2ATQ A;  4B9M A;  2RPI A;  3B6O A;  4C8K A;  1RIL A;  1Q9Y A;  5HRO A;  4C8O A;  3SZ2 A;  3PX4 A;  4W5O A;  2QK9 A;  2IS3 A;  1SKR A;  1JL1 A;  3ZSR A;  3SUN A;  3KD5 E;  1WAJ A;  4CEE A;  4O0I A;  4FJJ A;  3V6D A;  2KTQ A;  4OKJ A;  4CF1 A;  1RBS A;  3ZSY A;  1YTA A;  4OKK A;  1SUQ A;  4BAC A;  2DTU A;  1B9F A;  2YNH A;  4KHW A;  1UWB A;  3IG1 A;  5KRS A;  3OYF A;  1S1V A;  3QEV A;  1RTJ A;  3QIO A;  4F8R A;  1NK7 A;  1S1W A;  1HPZ A;  4M3U A;  4DU4 A;  3EYZ A;  3AV9 A;  4CHP A;  3F9K A;  4KRF A;  4GMJ B;  1BQM A;  4Q5V A;  2O4G A;  3EY1 A;  4DQI A;  4KI4 A;  1G15 A;  2ZE2 A;  4FM2 A;  3V9X A;  3S3O A;  1ZBI A;  2G8U A;  3DLE A;  2IAJ A;  3VQD A;  1T05 A;  4J2B A;  1KCF A;  1IG9 A;  4AHS A;  2LSN A;  3DLR A;  1RTD A;  1LWE A;  1WN7 A;  1HJR A;  4E7K A;  4CFD A;  4IBN A;  3I0R A;  3KLF A;  4R5P A;  2F8T A;  5HRR A;  5FRN A;  1ZBH A;  4FJ9 A;  5C24 A;  3ITH A;  4CER A;  4AH9 A;  1XI1 A;  4E89 A;  2E6L A;  3HVT A;  3E01 A;  5J1E A;  3ISN C;  2DY4 A;  5DMR A;  3M8P A;  4DS4 A;  3QEX A;  1KLN A;  2X78 A;  1C1B A;  1EP4 A;  4E1N A;  4OGC A;  3TAB A;  4B9L A;  1XWL A;  3A2F A;  4B9U A;  4N47 A;  1QQC A;  4HHT A;  3JYT A;  3RMC A;  1RT4 A;  1S6P A;  4FJ7 A;  3AVF A;  3SPY A;  1LWC A;  2QXF A;  3C6U A;  3DOK A;  4B08 A;  4CHN A;  1EX4 A;  1MU2 A;  4OPK A;  3HO1 A;  4B3O A;  4O44 A;  3RMD A;  4M42 A;  1RDC A;  3LWM A;  1T03 A;  3SPZ A;  1IKV A;  1TGO A;  3NE6 A;  2Z1I A;  4FJX A;  4Z4F A;  1KVA A;  1R0A A;  4FJI A;  4NYF A;  3OYN A;  3OYH A;  3MXJ A;  5JS1 A;  4CK3 A;  4CJL A;  3K57 A;  3TAP A;  3D45 A;  4ELU A;  1JLG A;  4C8M A;  3SCX A;  2AJQ A;  3DRS A;  1X9W A;  1T8E A;  4HCC A;  2ITG A;  5KGX A;  3SNN A;  4M3T A;  1VRU A;  5DK5 A;  4BDZ A;  1C0T A;  3QEI A;  1VSI A;  5EU7 A;  4CJF A;  2RF2 A;  3LP2 A;  4H4M A;  4CJ3 A;  3MEG A;  4PA1 A;  4CEC A;  5HP1 A;  2G8W A;  4F3O A;  1IKW A;  2HVI A;  5I42 A;  1ZYQ A;  3LP3 A;  3QEW A;  4DTP A;  3AA2 A;  3AVN A;  4CHZ A;  1A5W A;  1BIZ A;  5CYQ A;  4I9L A;  4FCY A;  1NOY A;  3CM6 A;  3U3G A;  4QAG A;  2PYJ A;  4Q0B A;  4QCL A;  1TK8 A;  2B5J A;  1KVC A;  1X1P A;  4CIG A;  1SKW A;  4BE2 A;  4J2D A;  1JXB A;  1IKX A;  5KGW A;  3V9U A;  4CJU A;  4DSE A;  3HST B;  1TKD A;  4FJ8 A;  2OA8 A;  2KW4 A;  1CXU A;  4TSX A;  4Z4H A;  3VQ6 A;  3ZCM A;  4GVM A;  1HYV A;  3DOL A;  2OZM A;  1L3S A;  1NK9 A;  2P1J A;  3AA4 A;  4EZ6 A;  5CYM A;  4KPY A;  1Y97 A;  2B6A A;  1ZBU A;  4NCG A;  3DYA A;  4CGF A;  1O1W A;  5HLF A;  1RT5 A;  1EET A;  4JS5 A;  4ELT A;  4JRP A;  1NKE A;  4E7I A;  2VWJ A;  2KZM A;  3ZSX A;  4ZHR A;  5D3G A;  3LPU A;  3AA5 X;  1GOA A;  3AVI A;  4E1M A;  1N6Q A;  4OJR A;  3S3N A;  2HNZ A;  3WNG A;  3NGZ A;  2YNI A;  1T7P A;  3MEE A;  1BIS A;  4DTX A;  2Y1J A;  4JS4 A;  3VQB A;  4PWD A;  3SUO A;  1VSD A;  4CHY A;  4PQU A;  4F2S A;  3AO2 A;  1HRH A;  1Q8I A;  3IRX A;  1BQN A;  3VQQ A;  3OYJ A;  3RTV A;  3L8B A;  1WSE A;  4KI6 A;  4EZ9 A;  1WNS A;  2X6N A;  1HQU A;  4K8X A;  5SZT A;  1X9M A;  4CJ5 A;  4KKO A;  3LAK A;  3RMB A;  2G8F A;  3VQ7 A;  2ETJ A;  4FJ5 A;  3AO3 A;  3V81 A;  2F96 A;  4BWJ A;  3VQ9 A;  1RT2 A;  4HVJ A;  1B92 A;  3RR7 A;  3L3U A;  3TAN A;  3SQ2 A;  5I3U A;  3DM2 A;  2HHQ A;  3OS2 A;  3DLB A;  2IOC A;  4O55 A;  4BE1 A;  4CJQ A;  1NJZ A;  2D0A A;  4FK0 A;  3SUQ A;  4FK2 A;  2GV9 A;  3THV A;  3O3H A;  4MFB A;  4FLX A;  3TI0 A;  3TAR A;  4YNQ A;  4CJV A;  4DTU A;  1UAX A;  5FRM A;  3MXI A;  3VQE A;  1LAV A;  1S1X A;  1VRT A;  3ZT4 A;  3RRG A;  3H08 A;  2OZS A;  1SKS A;  1NJY A;  2W42 A;  4KHN A;  1KTQ A;  3HT3 A;  3WNE A;  3AVM A;  1TV6 A;  1ASV A;  2FBV A;  3HXM A;  4DTN A;  4E3S A;  4B9S A;  1RBU A;  1DTQ A;  4DWI A;  3ZSZ A;  4LD0 A;  3DI6 A;  4CHO A;  3P5J A;  3LAL A;  3JSM A;  2A1R A;  3VQ4 A;  1C6V A;  3ZT1 A;  2RKI A;  3PO5 A;  4PY5 A;  1TVR A;  3KJV A;  2VG6 A;  3TWH A;  3L2Q A;  4KO0 A;  2A1S A;  4FM0 A;  4CIF A;  1VSE A;  4NYN A;  4BE0 A;  4I9Q A;  3HJF A;  2HHU A;  1J9A A;  1TL3 A;  1VSL A;  3OYG A;  1TL1 A;  3SV4 A;  4FXD A;  1HQE A;  1XHX A;  4GW6 A;  3CFO A;  1BHL A;  3TAG A;  4FVM A;  3ZSV A;  4UQG A;  1BI4 A;  3NF9 A;  1ZBL A;  3SI6 A;  4AHV A;  2YKM A;  4J2A A;  1S1T A;  3V1Q A;  4MQ3 A;  3NHG A;  3ZSQ A;  3QER A;  3T19 A;  3NGY A;  5K14 A;  3OYM A;  3K5L A;  4H8K A;  3KKR A;  3NH0 A;  4DFK A;  4KHS A;  1IH7 A;  4YFU A;  2Z1H A;  1BIU A;  5KTQ A;  3MAQ A;  2YV0 X;  3VN5 A;  4RW4 A;  4CF8 A;  1FK9 A;  4RW8 A;  1HYS A;  4I2Q A;  4CJT A;  4CFB A;  1RT1 A;  3MEC A;  1SL1 A;  3VQ5 A;  3KLI A;  1FKP A;  1NOZ A;  3C6T A;  4OGE A;  4RW9 A;  4M3R A;  4CEA A;  1LW2 A;  2JGU A;  3I8D A;  4FW2 A;  4M3Y A;  4LY7 A;  3U3Y A;  2ZD1 A;  1L5U A;  3OJU A;  4CJP A;  2P5O A;  1XHZ A;  4FZZ A;  4CGD A;  3KKS A;  1LWF A;  3L2W A;  1U47 A;  3UIQ A;  1S9E A;  4FLZ A;  5J2N A;  4F4K A;  4DQQ A;  1GOC A;  3L2U A;  4FLW A;  3TAM A;  1A5X A;  4DTJ A;  2XY5 A;  3PX0 A;  1KSP A;  1RCH A;  4ID5 A;  3SUP A;  3BGR A;  4O0J A;  3TR8 A;  3LP1 A;  3OYE A;  2D0C A;  3NAE A;  1D9D A;  4FJN A;  4FM1 A;  3D0P A;  4AHC A;  3I0S A;  3LAN A;  4Z4G A;  1RT3 A;  3VQP A;  2XHB A;  4AHT A;  3PUF A;  4CEZ A;  1B9D A;  2IC3 A;  3OS0 A;  2HHS A;  3K5O A;  1WSH A;  2YHB A;  3OYK A;  3KLH A;  3NDK A;  3RWU A;  1IKY A;  1WSG A;  2O4I A;  1I3A A;  1NJW A;  3ULD A;  2VG7 A;  2G8I A;  2HHX A;  1DTT A;  1BL3 A;  1K6Y A;  1WSI A;  2X74 A;  4ID1 A;  5KRT A;  5FDL A;  4DQS A;  4HTU A;  4AHR A;  2XY7 A;  2HMI A;  3PO4 A;  3RR8 A;  3M8R A;  1JXE A; 
#chains in the Genus database with same CATH topology
 3QO9 A;  3ENB A;  3ENO A;  2OPQ A;  1NGB A;  1FXX A;  2I7N A;  1RTI A;  3MCA B;  2F8S A;  5AQN A;  5HRN A;  3LAM A;  3SQ1 A;  4B8A B;  3EZW A;  4X65 K;  4CZM A;  3FZH A;  4JD2 B;  2QKK A;  2GBZ A;  2KQ2 A;  5GIN A;  4IFY A;  5E84 A;  4J2E A;  3CPE A;  3H3N O;  4YOY A;  4BGB A;  1DT9 A;  1MDU B;  5F0X A;  5I9E B;  3L2V A;  2YI1 A;  2JWL A;  2V51 B;  4RW7 A;  4DFM A;  4BC3 A;  4ZTF A;  3CFP A;  2HST A;  4B9Q A;  3H3O B;  3SV3 A;  4OPJ A;  4PUO A;  1NK0 A;  2UXD K;  4DV0 K;  1HKG A;  2HOE A;  4MO4 A;  4FWK A;  1KAX A;  1Q82 O;  2ASO A;  5FRO A;  4RG8 A;  3QFP A;  2FF6 A;  4DR4 K;  1T6D A;  1HNV A;  5AQT A;  1JLC A;  4DR7 K;  4CF9 A;  1WOQ A;  1YVN A;  4C1N I;  4WFA L;  4G9Z A;  5T7B A;  1Z6R A;  4B8C A;  4DKW A;  3C6H A;  2NRZ A;  4JKG B;  4CZH A;  1VSH A;  4PL7 A;  3CCM N;  5JLH A;  2KZZ A;  3THY B;  1KFD A;  3VGM A;  1N5Y A;  4LSN A;  4H0V B;  5M1K A;  1BOT O;  1YJW N;  3CCQ N;  4W5Q A;  1FJG K;  3HTV A;  4JAX A;  1VQL N;  4B9V A;  3CJ1 A;  4LFB K;  4CGI A;  3C94 A;  4C8L A;  3TU5 A;  4NCB A;  2YX6 A;  3VQA A;  2PZS A;  2Q97 A;  1W2B M;  5H1S Q;  5ELZ A;  1E4G T;  3VPZ A;  4E0D A;  1BGX T;  4CED A;  4KB1 A;  2XRI A;  1NMD A;  3AVB A;  1QVF M;  1RBR A;  2KFZ A;  4JI7 K;  4FOE A;  4PL8 A;  3OYI A;  3IAY A;  2OPS A;  3LDQ A;  4CJK A;  3ZLJ A;  1LCU A;  1Q86 O;  4E7J A;  4ELV A;  3AVL A;  3QIN A;  3VEX A;  3CQX A;  1TAQ A;  3C0B A;  4EP5 A;  4K42 A;  1J53 A;  2VWK A;  2ZGY A;  4YOV A;  3MN5 A;  3VEY A;  1S1U A;  4IFE A;  4HUF A;  3KK3 A;  4DLE A;  5TKW A;  2J4R A;  2GEL A;  1QHT A;  2PBD A;  4KRE A;  4IG3 A;  3HI0 A;  4BRA A;  4Y1D A;  1IBL K;  3PIO L;  3M8Q A;  4DV2 K;  1QTM A;  1I94 K;  4A2B A;  4FLV A;  1S6Q A;  1X9S A;  3RVC A;  1JLQ A;  3CFR A;  3VQC A;  3E9P A;  1LW0 A;  4O4G A;  1QS4 A;  3SAH A;  3FZM A;  3H46 O;  4OLB A;  4CGG A;  1E4F T;  4B1V A;  1X3N A;  5SWM A;  3K2P A;  1J54 A;  3MDQ A;  1G99 A;  3G0Z A;  5AQH A;  5BN9 A;  2YNG A;  4FJM A;  3VA0 A;  2FBT A;  4MLE A;  1CZB A;  1NKC A;  4PKI A;  1JLE A;  2O8C A;  1HLU A;  4CF2 A;  1LAW A;  3A5L C;  4CCH A;  4DSI A;  4CEB A;  4L8R B;  3QIC A;  4EFH A;  3DRP A;  4OLA A;  2P9P A;  1UOC A;  3KTQ A;  1RBT A;  3T7Z A;  1Q9X A;  2NRW A;  4BG8 A;  4U7B A;  3SJJ A;  3HPH A;  3IDH A;  5C2F A;  3TTD A;  4CEQ A;  4DR1 K;  4K25 A;  4KH5 A;  3QBX A;  4KB0 A;  4NCA A;  4GKJ K;  4NB4 A;  4DSF A;  3S9H A;  4DLG A;  3DAW A;  4FJG A;  3QBW A;  4W5T A;  4JRQ A;  2YHA A;  4YOR A;  4FJL A;  3NF7 A;  3EKU A;  2GUI A;  1QSL A;  1ASU A;  4FZY A;  1SAZ A;  1IV0 A;  4Y0W A;  5KQD A;  3THW B;  4LH5 A;  3HOT A;  1IO2 A;  3WNF A;  4LSL A;  2HW3 A;  2WC9 A;  3SJH A;  2ATQ A;  4C8K A;  3B6O A;  3H45 C;  3FGU A;  1IG8 A;  2QK9 A;  3ZSR A;  4CEE A;  4Z94 A;  4OKJ A;  5JLF A;  2QWO A;  3ZSY A;  1YTA A;  3SK3 A;  4BAC A;  2DTU A;  2YNH A;  1UWB A;  3OYF A;  1RTJ A;  3QIO A;  1OKJ A;  4DU4 A;  4CHP A;  1BA1 A;  5FPE A;  4Q5V A;  4KI4 A;  3S3O A;  3AAQ A;  4IXC A;  1IBM K;  4J2B A;  1KCF A;  1VHX A;  2LSN A;  3DLR A;  1LWE A;  1WN7 A;  5KPR A;  4IBN A;  5FRN A;  1ZBH A;  4CER A;  5HOO A;  3CHW A;  4E89 A;  2E6L A;  3E01 A;  1NG9 A;  4OPH A;  4RCH A;  5DMR A;  4JI3 K;  2X78 A;  1C1B A;  2QWM A;  3TAB A;  2VGN A;  1RT4 A;  1S6P A;  3AVF A;  3SPY A;  4B08 A;  4CHN A;  4JI6 K;  4OO1 J;  2BUP A;  4Z4F A;  4NYF A;  4CK3 A;  4BRH A;  3TAP A;  5AQF A;  4C8M A;  2AJQ A;  1T8E A;  4HCC A;  1K9M O;  5KGX A;  3SNN A;  5FLX O;  5DK5 A;  2VGM A;  1VSI A;  2RF2 A;  4CJ3 A;  1IKW A;  3GE1 A;  4B1U B;  3QEW A;  4DTP A;  1NBW A;  1A5W A;  5AQX A;  3ID8 A;  3CJ7 A;  1NM1 A;  1TK8 A;  1SKW A;  4BE2 A;  3E9O A;  1TKD A;  4B3T K;  2KW4 A;  1BG3 A;  3CC2 N;  4DR5 K;  4KHP K;  2OZM A;  3DOL A;  4BR4 A;  2BTF A;  1NK9 A;  4EZ6 A;  5CYM A;  2B6A A;  3DYA A;  5HLF A;  4BRL A;  1EET A;  4JS5 A;  1VQ4 N;  4E7I A;  4ZHR A;  1GLA G;  3AVI A;  2P9K A;  3THX B;  1N6Q A;  5BR9 A;  2HNZ A;  5CR4 A;  3MX2 A;  1BIS A;  4DTX A;  4CZK A;  3L4I A;  4PWD A;  4BRG A;  4WFB L;  3SUO A;  3AO2 A;  4O5F A;  3ZX3 A;  3OHR A;  1BQN A;  3CC7 N;  1W97 L;  3THX A;  3DXK A;  1WNS A;  2W41 A;  3H6E A;  2O8F A;  4EHT A;  3AO3 A;  4H03 B;  4YDU C;  2F96 A;  4HTL A;  1RT2 A;  1GLL O;  2Q1N A;  3SQ2 A;  4BRM A;  1HKC A;  5I3U A;  2QI2 A;  1YJN N;  3THV A;  4FLX A;  2W6L A;  4YNQ A;  2D0P A;  4CJV A;  1UAX A;  3G4S N;  3VQE A;  4CZL A;  1VRT A;  3N4P A;  4L3Q A;  4JKB A;  4JK9 A;  5A2Q O;  1KTQ A;  1TV6 A;  2FBV A;  3JXU A;  3UE5 A;  4B9S A;  3WXM B;  1DTQ A;  3DI6 A;  1C6V A;  4PY5 A;  3KJV A;  2E2O A;  4KO0 A;  2A1S A;  3KHY A;  3M1F A;  4NYN A;  5JMV A;  4JKE A;  3EO3 A;  2HHU A;  1JCG A;  4FWM A;  1SQK A;  1TL3 A;  1VSL A;  1XHX A;  2QTD A;  2P9U B;  4LF5 K;  1BI4 A;  1S1T A;  3MK6 A;  4GY2 B;  4MQ3 A;  3NHG A;  4DUZ K;  3NGY A;  3OBW A;  3AAP A;  1YJ9 N;  3KKR A;  2KKZ A;  4KHS A;  2Z1H A;  3MAQ A;  2YV0 X;  4JKA A;  3CQY A;  4RW4 A;  3F2K A;  1HYS A;  3RSE A;  2F9T A;  3PSF A;  4WCE L;  3CCU N;  2P9S A;  4LY7 A;  3VF6 A;  3O8M A;  5FPN A;  3G71 N;  1HR0 K;  3THY A;  3KKS A;  1LWF A;  5AZJ B;  1U47 A;  1S9E A;  4FLZ A;  2RE2 A;  4DTJ A;  3GG4 A;  2QA4 N;  4O0J A;  4FJN A;  2D0C A;  1VQP N;  1B9D A;  3MX5 A;  2GWK A;  1NJW A;  2VG7 A;  4B1W B;  1K6Y A;  2GWJ A;  1NGG A;  3PO4 A;  2I7P A;  3DXM A;  1U6Z A;  4DV6 K;  1U49 A;  1W0H A;  3CME N;  5M1F A;  2RN2 A;  5HBM A;  3NCI A;  4FVU A;  5AQW A;  3V4I A;  4F3T A;  1ZXO A;  5HRS A;  1W9H A;  4B9T A;  3IS9 A;  1QVG M;  4W5R A;  2IVP A;  3BF3 A;  4DSK A;  4LFA K;  3EKS A;  5AQI A;  1C1A A;  3NF8 A;  3AA3 A;  3CCE N;  1LV5 A;  1XNQ K;  2QWL A;  5GAG P;  4IDK A;  2HF4 A;  1SZ2 A;  2KFN A;  1ZBS A;  3QML A;  1U45 A;  1NJX A;  4DU3 A;  4GV3 A;  5HRP A;  2BDP A;  4E7L A;  2OYQ A;  5AJ3 K;  2YKN A;  1KXP A;  3DLK A;  2A42 A;  3SQ4 A;  4IDH A;  3OS1 A;  1V4T A;  4KH6 A;  5AFU A;  1TK0 A;  3T1A A;  3ALY A;  3HBT A;  3O4W A;  1GLF O;  1T6C A;  2D4W A;  3CYM A;  2IIR A;  2E4L A;  4HUG A;  1WAF A;  4DR2 K;  2CH5 A;  2W6K A;  3T1H K;  3TPQ A;  3G10 A;  4FK4 A;  3J7A P;  3CJC A;  1VSF A;  4BGA A;  5JVH L;  3AO4 A;  2DFH A;  1JLF A;  4DSL A;  3CJ9 A;  1U04 A;  4CHQ A;  3DMJ A;  1TYQ A;  3O1W A;  3TSP A;  4BG9 A;  2KLA A;  3O3F A;  4FZX C;  1HYZ A;  4K0K K;  3IUC A;  4DFP A;  3CG7 A;  2FC0 A;  1K8K B;  3J7Z O;  1RDD A;  3NH2 A;  4JKG A;  2P9P B;  4IOC L;  3NFA A;  5GAH P;  3KD1 E;  4KHY A;  4JHD A;  4AQY K;  1L3U A;  1FW6 A;  4EP4 A;  5AQZ A;  3VOV A;  4MDA A;  1D8Y A;  3CET A;  2JWK A;  1RBV A;  4CJE A;  3D6R A;  4AIL C;  1N33 K;  4JLH A;  2A5X A;  1NMN A;  3S3M A;  2BH1 A;  4ILG B;  1YUW A;  4CJ7 A;  3LP0 A;  1HMV A;  3QNO A;  1KRP A;  1OVY A;  2OPP A;  1VSJ A;  4FSV A;  1ATS A;  3V1O A;  1RDU A;  4H4O A;  2Q2R A;  4KTZ A;  2NRH A;  3KLE A;  1L3T A;  4Z4E A;  3PSI A;  3BP8 A;  1X3M A;  4K41 A;  2G8H A;  4LF9 K;  1JKH A;  1VQN N;  3VF2 A;  3OYB A;  3QES A;  3O80 A;  1TKT A;  1YAG A;  1JL2 A;  4RW6 A;  4M45 A;  4OX9 K;  3K58 A;  4N41 A;  3KVG A;  1QSY A;  1OH6 A;  2P5G A;  1EO1 A;  1CZA N;  4BWM A;  1NGI A;  1E3M A;  2EHG A;  2PAV A;  1RT7 A;  3OYA A;  2IVN A;  4DQP A;  4W5N A;  2A6A A;  1U2V B;  3OYL A;  5EX5 A;  4CZF A;  3HM9 A;  3EZ5 A;  4Z0U A;  1U4B A;  4DV4 K;  2ZQB A;  3DWL A;  3LM9 A;  4DTS A;  4E7H A;  2X6S A;  4CZI A;  4BQZ A;  2EX3 A;  3MWP A;  2QWP A;  3K5N A;  2UUC K;  4CBX A;  4H5R A;  5EVZ A;  1S22 A;  4FWR A;  2DFF A;  5AZI B;  3T1Y K;  5C12 A;  3ZT2 A;  3DLH A;  1BUP A;  4DR6 K;  3V1R A;  3VQ8 A;  3W0L A;  2HHT A;  2NRT A;  2Q36 A;  1ITG A;  4J8F A;  3ZX0 A;  2H3G X;  3O9Q A;  4LC9 B;  4BDY A;  2EWS A;  4CVN E;  3HSC A;  4CJS A;  3FZL A;  4WQ5 C;  4FYD A;  3ZX2 A;  3MXM A;  2XY8 A;  4CGJ A;  1QQM A;  4KTQ A;  1S72 N;  1RDA A;  3LWL A;  4IOA L;  3T3F A;  1NGA A;  2VQE K;  2OZS A;  4IOX A;  4CFC A;  3O4Q A;  2DFE A;  2QWN A;  3AVH A;  4FLY A;  1NU0 A;  4CBU A;  4ILH A;  4BR5 A;  4JK8 A;  1HNW K;  3ZSW A;  3NH1 A;  1C0M A;  3KIO A;  1GLE G;  1RIL A;  1Q18 A;  4I6M A;  1JCE A;  3S41 A;  4W5O A;  1SKR A;  4GKK K;  1QQN A;  3ZET B;  2ZWH A;  3IKM A;  3W3D A;  3V6D A;  4BR9 A;  4CF1 A;  1RBS A;  3R1X A;  4QS7 A;  2E1Y A;  3WXK A;  3QEV A;  1XC3 A;  4BC2 A;  3EYZ A;  3F9K A;  3D2E B;  2O4G A;  4H5T A;  3EY1 A;  4DQI A;  4FM2 A;  2ZE2 A;  4H0P A;  1C0G A;  4E7K A;  2WUS A;  4H0T B;  3KLF A;  5HRR A;  4CZG A;  1NGH A;  4PHT X;  3ISN C;  2DY4 A;  2P9I B;  3E66 A;  4JK7 A;  1EP4 A;  4B9L A;  4OGC A;  5ADX A;  5LMU K;  1XWL A;  3CF5 L;  1QQC A;  4HHT A;  3JYT A;  4H0O A;  5AQR A;  3C6U A;  3HO1 A;  1EX4 A;  4JEP A;  4CD1 A;  3RMD A;  4M42 A;  1T03 A;  5E26 A;  1ESV A;  3SPZ A;  3NE6 A;  2Z1I A;  2ZM6 K;  1TYQ B;  3LDP A;  2ZGZ A;  3UKU B;  4ELU A;  1JLG A;  3DRS A;  1WB9 A;  2ITG A;  2DPN A;  3TSQ A;  3QEI A;  4CJF A;  1BA0 A;  5EU7 A;  4H4M A;  5AZI A;  3CC4 N;  3MEG A;  4F3O A;  2HVI A;  2QW9 A;  4B1X B;  4V19 S;  5CYQ A;  2OTJ N;  5AR0 A;  4NO7 A;  4FCY A;  1NOY A;  2CGJ A;  3CM6 A;  3O9T A;  3MN6 A;  4QAG A;  3K9K A;  1KAZ A;  1X1P A;  4CIG A;  4J2D A;  1IKX A;  2P9U A;  5KGW A;  2P9L A;  3V9U A;  1CXU A;  4TSX A;  4Z4H A;  4DV5 K;  2ZJR L;  3VQ6 A;  4BRC A;  3J8A A;  3U9Z A;  1L3S A;  3VGK A;  2ZJP L;  3AA4 A;  1Y97 A;  1ZBU A;  4NCG A;  4JRP A;  5BR8 K;  2VYP A;  4JD2 A;  3AA5 X;  3CCL N;  2A40 A;  3O5B A;  3ATU A;  5BPN A;  3NGZ A;  2YNI A;  1JCF A;  1VSD A;  2Q31 A;  1NGJ A;  4EHU A;  4R79 A;  5M1Q A;  4JI5 K;  3NVK A;  1ATR A;  2X6N A;  4K8X A;  3HRG A;  5M1P A;  2E8A A;  2G8F A;  2ETJ A;  4BR7 A;  2CH6 A;  2VQF K;  3CCJ N;  4DQ8 A;  4FWO A;  1NJZ A;  4GVE A;  3TI0 A;  5GAE P;  3VEV A;  3I8B A;  4DTU A;  3MXI A;  2YHW A;  1ATN A;  3J80 O;  3HT3 A;  2WFB A;  3GBT A;  3HXM A;  4DTN A;  4E3S A;  2UUB K;  1RBU A;  4LD0 A;  2E88 A;  3P5J A;  3JSM A;  3ZT1 A;  1TVR A;  5CHI A;  4FM0 A;  1ILY A;  3AY9 A;  5AQJ A;  2A3Z A;  4BE0 A;  3BZC A;  2F4V K;  4CD3 A;  2ASM A;  1V4S A;  2D1K A;  1J9A A;  3SV4 A;  1TL1 A;  4YOW A;  4BRK A;  3CFO A;  2NZT A;  4MDB A;  3NF9 A;  3D7E O;  4AHV A;  2YKM A;  4KH4 A;  3K5L A;  4BY9 C;  3NH0 A;  4DFK A;  1IH7 A;  5KTQ A;  4GV6 A;  2YCH A;  1FK9 A;  4RW8 A;  4CJT A;  4B1Z A;  1RT1 A;  3MEC A;  5C10 A;  3DLL L;  1MWK A;  3VQ5 A;  3KLI A;  3OBY A;  3C6T A;  1NOZ A;  4OGE A;  4RW9 A;  4M3R A;  3I8D A;  3VEN A;  4FW2 A;  4M3Y A;  3U3Y A;  4ISF A;  3OJU A;  4CJP A;  2P5O A;  3VEW A;  4FZZ A;  4IJN A;  1EWQ A;  3UIQ A;  3ZET A;  5J2N A;  1GOC A;  3L2U A;  4FLW A;  1A5X A;  2XY5 A;  3U4L A;  4ID5 A;  3LM2 A;  3O08 A;  3LAN A;  2F9W A;  3VQP A;  4ISG A;  3NDK A;  1WSH A;  3ULE B;  3ULD A;  2G8I A;  1DTT A;  4BC4 A;  1BL3 A;  5AFU H;  1BWF O;  4H5W A;  3HOS A;  4CI6 A;  2G8V A;  2I5J A;  2W40 A;  4WF9 L;  1OH5 A;  3ID6 A;  4C23 A;  2E20 A;  3EEQ A;  4FJH A;  2VG5 A;  2R7Y A;  4X66 K;  3CM5 A;  2D0B A;  4HCB A;  1XC9 A;  1WBB A;  3CI5 A;  3LL3 A;  1H1V A;  4WE1 A;  2P9I A;  4C1N K;  3F9M A;  2E2P A;  3V9W A;  5KPT A;  1HPM A;  3CER A;  3V9Z A;  3AVK A;  3ASM A;  2HMP A;  4PKG A;  2BAN A;  4Z4C A;  1TK5 A;  4DQR A;  1D9F A;  3QNN A;  4B9N A;  4JI2 K;  4DFJ A;  1KFS A;  3WQT A;  1JLA A;  3NGI A;  1DLO A;  3AGK A;  2WBN A;  3BDP A;  3L6Q A;  3DLG A;  4WQ5 A;  3IFR A;  1HNI A;  3HP6 A;  5CZ2 A;  3VEZ A;  4Y1C A;  2CGK A;  4M3W A;  3CJB A;  2HB5 A;  2NNW A;  4FWN A;  1GOB A;  4CES A;  2P9S B;  2OTL N;  1TAU A;  1TKX A;  4AM7 A;  3R8E A;  1QE1 A;  4XIU A;  3R3L A;  3L2R A;  4NLC A;  2WON A;  4KTW A;  3PY8 A;  1GLB G;  3TAQ A;  3LDL A;  1ZBF A;  1OVQ A;  4FLU A;  1EKE A;  2QWQ A;  3CIP A;  4JV5 K;  2GTD A;  3LZI A;  4H5N A;  4B3R K;  3KLG A;  4CE9 A;  1F21 A;  4ILJ A;  2E6M A;  4CJR A;  1N32 K;  1GLC G;  2KHO A;  1RDB A;  4CIE A;  4BDP A;  4DSJ A;  4CK1 A;  3GL1 A;  4O8K A;  1A5V A;  3SQ0 A;  4CJW A;  4DS5 A;  4M3X A;  1KVB A;  2BGG A;  5BRF A;  1EXQ A;  4YOT A;  2HNY A;  1REV A;  3LDS A;  4KAZ A;  2Y1I A;  5BPL A;  4FOI A;  2B4J A;  4FWL A;  4CEO A;  5AQO A;  5KPZ A;  4IFV A;  1EQY A;  2Z1G A;  3HYF A;  3MMV A;  2O8B A;  2HHV A;  4BC5 A;  1NK8 A;  1NK6 A;  3A8Y A;  4DTO A;  3MN7 A;  3ULE A;  3HPG A;  3AVA A;  2AA4 A;  4FWQ A;  2O8B B;  1U48 A;  5MLC Q;  4GV9 A;  4DF4 A;  3CD6 N;  3QIP A;  2HND A;  2PYL A;  1CLQ A;  4H5V A;  2Z1J A;  4HWI A;  2D5R A;  4K8Z A;  3EN9 A;  4ICL A;  1S9G A;  3ZYY X;  4KFB A;  2FBX A;  3LPT A;  3VA3 A;  3VF4 A;  5J2P A;  3C7N B;  3WEE B;  1GLJ O;  3HK2 A;  1NGC A;  4AHU A;  2HHW A;  3AVG A;  3OW2 M;  5C42 A;  5LJV A;  4O5B A;  1D5A A;  1BCO A;  3KK1 A;  1OH7 A;  3BF1 A;  3WUH A;  3WXJ A;  3KZB A;  3A5N C;  3CXC M;  4O8U A;  1RDW X;  1RTH A;  3K59 A;  3HPO A;  4QOZ B;  3RMA A;  3NBP A;  2HBK A;  2P51 A;  3HVR A;  3AAR A;  5BRE A;  3SYZ A;  1BI4 B;  3AO1 A;  3RRH A;  3V9S A;  4ISE A;  4OKE A;  4DTR A;  3VEO A;  1NK5 A;  1L3V A;  1DGK N;  2QKB A;  3P4I A;  4CF0 A;  3RWU A;  4OVL A;  4I2P A;  4BVP A;  1WSJ A;  3M8S A;  2G8K A;  2O8D A;  3DJC A;  3HL8 A;  3MED A;  4BQL A;  3O9U A;  3L4Q A;  2IDO A;  4B9M A;  4C8O A;  1Q9Y A;  3LDN A;  3N4Q A;  5HRO A;  1X9J A;  1QZ6 A;  5EY4 A;  3PX4 A;  2YHY A;  4WQ4 C;  2QWR A;  1JL1 A;  3SUN A;  4FJJ A;  1WAJ A;  2KTQ A;  2NLX A;  3A5O C;  1SUQ A;  3IG1 A;  5KRS A;  1S1V A;  3TTF A;  4F8R A;  1XQS C;  3R6M A;  1HPZ A;  1RGI A;  5CE3 A;  1NK7 A;  4M3U A;  1M1K O;  3AV9 A;  1SS6 A;  4KRF A;  1LOT B;  3V9X A;  3FZF A;  3VTH A;  1ZBI A;  1Q7Y O;  3DLE A;  2IAJ A;  3VQD A;  4LF8 K;  1IG9 A;  4AHS A;  1NGF A;  4M63 C;  5AQS A;  1RTD A;  4CFD A;  3I0R A;  4R5P A;  2F8T A;  2HBL A;  2E1Z A;  3QFU A;  4FJ9 A;  3ITH A;  1VQ9 N;  1XI1 A;  3UKR B;  1C0F A;  1KLN A;  4E1N A;  1NNE A;  4IJA A;  4KBO A;  1VQK N;  4FJ7 A;  3I33 A;  1LWC A;  4OPK A;  4WYB A;  4O44 A;  3LWM A;  2QM1 A;  4FJI A;  3FLC O;  3GDQ A;  5JS1 A;  3OYN A;  4CJL A;  1X9W A;  3LDO A;  1VRU A;  3U6F A;  1C0T A;  4BRO A;  1S3X A;  5HP1 A;  4CEC A;  2G8W A;  1DKG D;  5I42 A;  1YIJ N;  3AVN A;  1BIZ A;  1HKB A;  4Q0B A;  4BRP A;  3U3G A;  4QCL A;  1KVC A;  5FPD A;  1JXB A;  4EIA A;  4CZE A;  4CJU A;  4DSE A;  3HST B;  3P38 A;  3P31 A;  2WTU A;  2OA8 A;  4JI8 K;  4EAH D;  3ZCM A;  1HYV A;  5M1N A;  2P1J A;  2RHK A;  4KPY A;  4MLH A;  1HJO A;  1O1W A;  4I6M B;  2VWJ A;  2KZM A;  3ZSX A;  5D3G A;  1YHQ N;  4E1M A;  4OJR A;  4QS8 A;  3WNG A;  4XH1 A;  2Y1J A;  3VQB A;  4YY3 K;  3KWG A;  5GAD P;  1VQ5 N;  4PQU A;  1HRH A;  1Q8I A;  2NRV A;  2P9N A;  3IRX A;  5JVG L;  3WT0 A;  1NJI O;  3VQQ A;  3OYJ A;  3RTV A;  1KQS M;  3L8B A;  1WSE A;  4LF7 K;  3SLC A;  5SZT A;  4CJ5 A;  3BUZ B;  2F7T A;  2QEX N;  3RMB A;  5KQ8 A;  3V81 A;  3THW A;  4BWJ A;  3TTC A;  2D0O A;  4HVJ A;  2UYT A;  3TAN A;  2IOC A;  2D0A A;  3SUQ A;  4H0Y B;  1W7A A;  4WFN L;  4MFB A;  3O3H A;  4BRI A;  1MA9 B;  1S1X A;  1NJY A;  3JAM O;  3WNE A;  4FPA A;  4CHO A;  1WBD A;  3LAL A;  3VQ4 A;  2RKI A;  5DM7 L;  3TWH A;  2VG6 A;  3L2Q A;  3CCR N;  4BRQ A;  3VTI A;  1VSE A;  5AQU A;  4UY8 O;  4LF6 K;  3SMS A;  1XUP O;  3OYG A;  4FXD A;  1HQE A;  5BRD A;  3TAG A;  4FVM A;  3ZSV A;  4J2A A;  3V1Q A;  2E2Q A;  3ZSQ A;  3QER A;  3G6E N;  4JHD B;  5K14 A;  3OYM A;  4H8K A;  4NLB A;  1BIU A;  1K8K A;  4CF8 A;  1VAZ A;  3D2F A;  1N36 K;  4B1Y B;  1SL1 A;  1FKP A;  4CEA A;  5IT9 O;  3J81 O;  3K9J A;  1EWR A;  2ZD1 A;  1L5U A;  4IZ9 A;  4FO0 A;  5IWA K;  4CGD A;  4X64 K;  3L2W A;  1HX1 A;  4BRF A;  3TAM A;  1RCH A;  3SUP A;  3BGR A;  3OYE A;  4FWP A;  3LP1 A;  4IWV A;  4F9O A;  3NAE A;  1D9D A;  4NXN K;  4FM1 A;  3D0P A;  4AHC A;  1M90 O;  3BY5 A;  1RT3 A;  4Z4G A;  1BO5 O;  4CEZ A;  2IC3 A;  3OS0 A;  2HHS A;  3K5O A;  3KLH A;  2O4I A;  1WSG A;  1O13 A;  2FSN A;  1HNZ K;  2HHX A;  4A62 A;  4H0X B;  1WSI A;  2X74 A;  4ID1 A;  3AGR A;  3RR8 A;  3M8R A;  1JXE A;  4DHY A;  3ZT3 A;  2O8E A;  3IMX A;  2CGL A;  4JYA K;  3VMF B;  2XO7 A;  4KV8 A;  1HUX A;  4YOX A;  1NLV A;  4N5S A;  1NGD A;  2HBM A;  4IO9 L;  1J5O A;  3CMA N;  2FSJ A;  1JLB A;  1IJJ A;  1SL0 A;  1NWK A;  3AVC A;  3L3V A;  4N56 A;  2NUB A;  1Z25 A;  3JS6 A;  1ASW A;  4GNI A;  3L0Q A;  5JS2 A;  3M3Z A;  1Y64 A;  3C65 A;  3WXI A;  2E5L K;  3HM8 A;  1CXQ A;  1Z26 A;  1RT6 A;  4I7F A;  5LL6 Z;  3VES A;  4K43 A;  3CCS N;  3CPW M;  1TKZ A;  2Q0U A;  4IO8 A;  1T3V A;  3I56 N;  2IVO A;  1CZ9 A;  3TAE A;  5AQY A;  1S5J A;  5LMN K;  1YTU A;  1C0U A;  4DG1 A;  2IGI A;  4Z4I A;  1WUA A;  4CFA A;  3NF6 A;  3OVN A;  3CQ8 A;  2FXU A;  2YNF A;  5LJW A;  3SAF A;  4FW1 A;  4BVO A;  3H1Q A;  3OTO K;  3WNH A;  2BE2 A;  4DU1 A;  2XY6 A;  3PV8 A;  4E1J A;  3KK2 A;  3QEP A;  4DUY K;  2VCP A;  4A59 A;  5B8H A;  3OY9 A;  4IKF A;  4XEI A;  3M6G A;  5AQL A;  4ZTJ A;  2ASP A;  2GEM A;  1N34 K;  1UA1 A;  4A5A A;  2Q3S A;  4F2R A;  4LFC K;  5KI6 A;  2ZF5 O;  3HP9 A;  3NVM A;  1VQ7 N;  3QET A;  5GIP A;  5J2Q A;  3AO5 A;  3F5T A;  1SL2 A;  3FFI A;  4MO5 A;  3J7Y P;  3P83 D;  5GIO A;  2ZJQ L;  5AZJ A;  3QLH A;  4IEI A;  3B6P A;  3SAG A;  1SV5 A;  3BEX A;  1YIT N;  4M7Y A;  5CY4 A;  4FJK A;  3KK7 A;  2O8D B;  1K8A O;  2QXL A;  3U8X A;  4JKC A;  4FPB A;  3MWT A;  3FE1 A;  1BU6 O;  4LF4 K;  4N76 A;  5C2D A;  4RWT A;  1QZ5 A;  4G1Q A;  4DV7 K;  2WOM A;  2V52 B;  1QSS A;  1FKO A;  2YJF A;  1XNR K;  5JIC A;  2HVH A;  3O4N A;  5LY3 A;  1WLJ A;  2FBY A;  4C8N A;  1KAY A;  1YXQ A;  3AVJ A;  4BRN A;  4M41 A;  4A5B A;  4DB3 A;  5BPM A;  1KLM A;  4KHU A;  3OYD A;  4XH5 A;  2HBJ A;  4E19 A;  1BCM A;  3ZT0 A;  1VSK A;  1VQ6 N;  3U9D A;  5J2M A;  4OPA A;  3TAF A;  4DF8 A;  1RNH A;  3OYC A;  3K0S A;  4HUE A;  2PY5 A;  3P1G A;  3UKU A;  3R9P A;  4LH4 A;  4CBW A;  1BDG A;  4JKF A;  1C1C A;  4DCH A;  1I39 A;  4JI4 K;  3F73 A;  5AQM A;  4BR0 A;  4JI1 K;  4DR3 K;  4CJ4 A;  3QB0 A;  2OCE A;  4KHQ A;  3O6W A;  5DM6 L;  2FF3 B;  4CK2 A;  3C95 A;  4FLT A;  5TKY A;  4B3S K;  1YVU A;  5C15 A;  2FLO A;  4CGH A;  1VSM A;  3PX6 A;  1VK0 A;  3C7N A;  1UA0 A;  3O3G A;  4CEF A;  3FZK A;  5HL7 L;  4IG0 A;  3LZJ A;  3ZSO A;  2OPR A;  5E41 A;  4DMN A;  1NKB A;  3DXM B;  2A41 A;  1YI2 N;  4DTM A;  2JLE A;  3ATV A;  2UU9 K;  2UUA K;  3OJS A;  3O9R A;  2HHH K;  3DRR A;  1N8R O;  1YT3 A;  3ZEU A;  3EE8 A;  5CZ1 A;  1NK4 A;  3K5M A;  1WSF A;  4M3Z A;  4U67 L;  1J5E K;  5C25 A;  2RPI A;  3SZ2 A;  2IS3 A;  1TUU A;  4JNE A;  3KD5 E;  1GLD G;  1T44 A;  4O0I A;  5ADX H;  4OKK A;  3E1Y A;  3VET A;  1B9F A;  5BRH A;  3UKR A;  2ITM A;  3MCP A;  5F1X A;  3A0I X;  4A2A A;  1S1W A;  4AM6 A;  1MWM A;  2P9K B;  3MN9 A;  1KD1 O;  4GMJ B;  1BQM A;  1G15 A;  4PKH A;  2G8U A;  3Q7B A;  1IBK K;  1P90 A;  1T05 A;  4JKD A;  4BRD A;  3WEE A;  2O8F B;  1HJR A;  3SBT A;  4FWS A;  2GX9 A;  2NRX A;  3DXK B;  4X62 K;  5C24 A;  4AH9 A;  1QHA A;  3HVT A;  5J1E A;  5EOY A;  3PLA A;  4YHH K;  3M8P A;  4DS4 A;  3SBG A;  3B8A X;  2V7Z A;  3QEX A;  3A2F A;  3UB5 A;  4DV3 K;  4B9U A;  2O8C B;  4N47 A;  3WXL A;  3RMC A;  5AQP A;  2QXF A;  3DOK A;  5EXW A;  4B3O A;  4XH4 A;  1MU2 A;  1TUY A;  1XMO K;  2Q0R A;  1RDC A;  3GOI A;  1IKV A;  1TGO A;  4CZJ A;  4FJX A;  1KVA A;  1R0A A;  4JI0 K;  3OYH A;  3MXJ A;  1XMQ K;  3K57 A;  4WQ4 A;  3D45 A;  3SCX A;  3FFK B;  2PFU A;  3M5R A;  2YJE A;  4M3T A;  5F2R A;  3E9L A;  4BDZ A;  1ZBL A;  4KI6 A;  3SMP A;  1NGE A;  2VWB A;  3LP2 A;  4PA1 A;  1ZYQ A;  3LP3 A;  3FR0 A;  3QDK A;  2UXB K;  3AA2 A;  2OAN A;  4CHZ A;  5FPM A;  3ENH A;  4I9L A;  2PYJ A;  2B5J A;  4BRE A;  4FJ8 A;  2P9N B;  3EL2 A;  4GVM A;  4JKH A;  4CGF A;  4RTF D;  3A5M C;  3PIP L;  4ELT A;  1RT5 A;  1NKE A;  3OA9 A;  3RSE B;  3O9S A;  2P9L B;  3BZK A;  3LPU A;  1GOA A;  3S3N A;  3HZ6 A;  1T7P A;  3MEE A;  4JS4 A;  1RFQ A;  3CJA A;  4CHY A;  4JN4 A;  4F2S A;  2NRR A;  3O1B A;  4A61 A;  3WQU A;  4FL9 A;  4CW7 B;  1R59 O;  1JJ2 M;  1DEJ A;  1VQ8 N;  2FSK A;  3KWI A;  1K73 O;  5C0Y A;  4EZ9 A;  4YDU A;  1HQU A;  1X9M A;  4QS9 A;  1VQO N;  4KKO A;  4NXM K;  2UXC K;  5AQQ A;  3LAK A;  5BN8 A;  4FJ5 A;  3VQ7 A;  3ZEU B;  3VQ9 A;  2O8E B;  1B92 A;  1U2V A;  3RR7 A;  3L3U A;  2HHQ A;  3DM2 A;  4M7X A;  3OS2 A;  3DLB A;  4O55 A;  4BE1 A;  4CJQ A;  4FK0 A;  4FK2 A;  2GV9 A;  3TAR A;  1OH8 A;  1Z05 A;  5FRM A;  3Q7C A;  1LAV A;  3RRG A;  3ZT4 A;  3TSU A;  3H08 A;  1SKS A;  3G25 A;  2W42 A;  4KHN A;  3D2E A;  3AVM A;  1ASV A;  5AQK A;  1ZC6 A;  4DWI A;  3ZSZ A;  4BR2 A;  1P8Z A;  2A1R A;  3EE9 A;  3PO5 A;  3C6A A;  3P39 A;  4CIF A;  4I9Q A;  3HJF A;  1D4X A;  3CCV N;  2GUP A;  2AP1 A;  1KC8 O;  4GW6 A;  1BHL A;  4AF1 A;  4UQG A;  2HF3 A;  3SI6 A;  3H1V X;  2YHX A;  3T19 A;  4A57 A;  4YFU A;  1YF5 L;  1J6Z A;  3VN5 A;  4I2Q A;  4CFB A;  5AQV A;  4DV1 K;  4IEE A;  1LW2 A;  2JGU A;  3VGL A;  1XHZ A;  1HNX K;  5M1O A;  1QQO A;  3VER A;  4F4K A;  4DQQ A;  4KHW A;  3PX0 A;  1KSP A;  1Q81 O;  3TR8 A;  5AQG A;  3I0S A;  2E2N A;  3D2F B;  4AHT A;  3PUF A;  2XHB A;  1VQM N;  2V7Y A;  3OYK A;  3NMU A;  2YHB A;  4YOU A;  1IKY A;  1I3A A;  3T69 A;  5KRT A;  4B3M K;  4DQS A;  5FDL A;  4HTU A;  4AHR A;  2XY7 A;  3I55 N;  2HMI A; 
#chains in the Genus database with same CATH homology
 2G8V A;  2I5J A;  3QO9 A;  3ZT3 A;  2OPQ A;  1U49 A;  1FXX A;  1W0H A;  1RTI A;  2F8S A;  4FJH A;  2RN2 A;  5HBM A;  2XO7 A;  3NCI A;  5HRN A;  3LAM A;  2VG5 A;  4KV8 A;  2R7Y A;  3SQ1 A;  3CM5 A;  2D0B A;  4B8A B;  3V4I A;  4HCB A;  4F3T A;  1XC9 A;  4N5S A;  5HRS A;  4WE1 A;  2QKK A;  1W9H A;  2GBZ A;  2KQ2 A;  1J5O A;  4B9T A;  4IFY A;  3IS9 A;  4J2E A;  4W5R A;  3V9W A;  1JLB A;  1SL0 A;  4DSK A;  3AVC A;  3L3V A;  1C1A A;  4N56 A;  3NF8 A;  2NUB A;  1Z25 A;  3AA3 A;  1ASW A;  3L2V A;  3V9Z A;  3AVK A;  5JS2 A;  3ASM A;  1LV5 A;  4RW7 A;  2BAN A;  4Z4C A;  4DFM A;  4ZTF A;  4DQR A;  4IDK A;  1TK5 A;  3CFP A;  1D9F A;  3QNN A;  4B9N A;  4DFJ A;  1CXQ A;  1KFS A;  2KFN A;  1Z26 A;  1RT6 A;  4I7F A;  3SV3 A;  1U45 A;  1NJX A;  4OPJ A;  1JLA A;  3NGI A;  4DU3 A;  1NK0 A;  4PUO A;  1DLO A;  1TKZ A;  5HRP A;  2BDP A;  1CZ9 A;  5FRO A;  3TAE A;  1S5J A;  4E7L A;  3BDP A;  1YTU A;  4RG8 A;  3DLG A;  2OYQ A;  1C0U A;  4DG1 A;  2IGI A;  4Z4I A;  1HNI A;  4CFA A;  2YKN A;  3U6F A;  3HP6 A;  3DLK A;  3NF6 A;  1HNV A;  5CZ2 A;  4Y1C A;  1JLC A;  3OVN A;  3CQ8 A;  4M3W A;  2YNF A;  3SQ4 A;  2HB5 A;  4CF9 A;  3OS1 A;  4FW1 A;  1TK0 A;  5T7B A;  3T1A A;  4B8C A;  3ALY A;  1GOB A;  3CYM A;  4CES A;  3WNH A;  2E4L A;  4HUG A;  1VSH A;  1WAF A;  1TAU A;  1TKX A;  2BE2 A;  4DU1 A;  2XY6 A;  3PV8 A;  1QE1 A;  3G10 A;  4XIU A;  3KK2 A;  3L2R A;  3QEP A;  4FK4 A;  2KZZ A;  1VSF A;  2WON A;  4KTW A;  3AO4 A;  1KFD A;  2DFH A;  3PY8 A;  1JLF A;  3OY9 A;  4DSL A;  1N5Y A;  4IKF A;  3TAQ A;  1U04 A;  4CHQ A;  4LSN A;  3DMJ A;  1ZBF A;  4W5Q A;  4ZTJ A;  4FLU A;  3O3F A;  4FZX C;  1HYZ A;  4B9V A;  1EKE A;  3CG7 A;  4DFP A;  2FC0 A;  4CGI A;  1RDD A;  3C94 A;  1UA1 A;  4C8L A;  3NH2 A;  4NCB A;  3LZI A;  3NFA A;  3KLG A;  3KD1 E;  3VQA A;  4KHY A;  2Q3S A;  4F2R A;  4CE9 A;  1F21 A;  1L3U A;  2PZS A;  5KI6 A;  4EP4 A;  3HP9 A;  2E6M A;  4E0D A;  1BGX T;  4CED A;  1D8Y A;  4CJR A;  4KB1 A;  2XRI A;  3AVB A;  3QET A;  1RBR A;  5J2Q A;  1RBV A;  1RDB A;  3AO5 A;  4CJE A;  4CIE A;  1SL2 A;  4BDP A;  2KFZ A;  3FFI A;  4DSJ A;  4AIL C;  4CK1 A;  3OYI A;  1A5V A;  3P83 D;  4JLH A;  3SQ0 A;  4CJW A;  3S3M A;  4DS5 A;  3QLH A;  4M3X A;  3IAY A;  3B6P A;  2OPS A;  1KVB A;  3LP0 A;  1HMV A;  1SV5 A;  4CJK A;  3QNO A;  1KRP A;  2BGG A;  2OPP A;  5CY4 A;  1EXQ A;  1VSJ A;  4FJK A;  4E7J A;  2HNY A;  1REV A;  4ELV A;  3AVL A;  3QIN A;  3V1O A;  3LDS A;  4KAZ A;  4H4O A;  2Y1I A;  1TAQ A;  2B4J A;  4CEO A;  4KTZ A;  4IFV A;  4EP5 A;  3KLE A;  1L3T A;  2Z1G A;  3HYF A;  4Z4E A;  1J53 A;  2VWK A;  2HHV A;  1NK8 A;  1S1U A;  4HUF A;  4N76 A;  3KK3 A;  4G1Q A;  2G8H A;  1NK6 A;  4DLE A;  1JKH A;  4DTO A;  3OYB A;  3QES A;  2WOM A;  1TKT A;  3HPG A;  3AVA A;  1QSS A;  1JL2 A;  1FKO A;  2HVH A;  1QHT A;  3O4N A;  1WLJ A;  4KRE A;  2FBY A;  4C8N A;  4RW6 A;  4M45 A;  3K58 A;  4N41 A;  1QSY A;  4IG3 A;  3AVJ A;  2P5G A;  4Y1D A;  1U48 A;  3M8Q A;  4M41 A;  1QTM A;  4BWM A;  4DF4 A;  2EHG A;  1KLM A;  4KHU A;  3OYD A;  4FLV A;  1RT7 A;  1S6Q A;  3OYA A;  4DQP A;  4E19 A;  1X9S A;  3QIP A;  1BCM A;  4W5N A;  3ZT0 A;  3OYL A;  1JLQ A;  1VSK A;  2HND A;  2PYL A;  1CLQ A;  5J2M A;  3CFR A;  2Z1J A;  2D5R A;  3HM9 A;  4K8Z A;  3TAF A;  4ICL A;  1S9G A;  3EZ5 A;  4KFB A;  2FBX A;  4Z0U A;  3VQC A;  1LW0 A;  1RNH A;  3LPT A;  4O4G A;  3OYC A;  4DF8 A;  1QS4 A;  1U4B A;  4HUE A;  3VA3 A;  2ZQB A;  2PY5 A;  3P1G A;  4DTS A;  4E7H A;  2X6S A;  4LH4 A;  4OLB A;  4CGG A;  5SWM A;  5J2P A;  1C1C A;  3K2P A;  2EX3 A;  3K5N A;  1J54 A;  1I39 A;  3F73 A;  2DFF A;  3HK2 A;  3G0Z A;  4AHU A;  2HHW A;  3AVG A;  2YNG A;  5C42 A;  3VA0 A;  2FBT A;  4FJM A;  3ZT2 A;  3DLH A;  4CJ4 A;  4O5B A;  1CZB A;  1D5A A;  1NKC A;  1JLE A;  4KHQ A;  1BCO A;  3KK1 A;  3V1R A;  1LAW A;  3VQ8 A;  4CF2 A;  4CCH A;  4CK2 A;  4DSI A;  2HHT A;  3C95 A;  4CEB A;  1RTH A;  3K59 A;  4FLT A;  3HPO A;  1ITG A;  4QOZ B;  3RMA A;  4L8R B;  3NBP A;  2P51 A;  3HVR A;  3DRP A;  4OLA A;  4BDY A;  1YVU A;  1UOC A;  3SYZ A;  3KTQ A;  1RBT A;  1BI4 B;  1Q9X A;  4CGH A;  1VSM A;  4CJS A;  3PX6 A;  1VK0 A;  1UA0 A;  3O3G A;  3SJJ A;  3HPH A;  3AO1 A;  4CEF A;  4FYD A;  3RRH A;  3V9S A;  3MXM A;  4CEQ A;  2XY8 A;  4CGJ A;  4OKE A;  4DTR A;  4KTQ A;  4KB0 A;  4NCA A;  1NK5 A;  1L3V A;  4IG0 A;  1RDA A;  3LWL A;  4DSF A;  2QKB A;  4CF0 A;  3LZJ A;  4DLG A;  3ZSO A;  3T3F A;  2OPR A;  3S9H A;  4FJG A;  5E41 A;  4W5T A;  4OVL A;  4I2P A;  4DMN A;  4CFC A;  4JRQ A;  3O4Q A;  2YHA A;  1NKB A;  2DFE A;  3AVH A;  1WSJ A;  3M8S A;  2G8K A;  4FJL A;  4FLY A;  3NF7 A;  2JLE A;  4DTM A;  2GUI A;  3OJS A;  1ASU A;  1QSL A;  3DRR A;  4FZY A;  3HL8 A;  1YT3 A;  3MED A;  5CZ1 A;  4LH5 A;  1IO2 A;  3ZSW A;  1NK4 A;  3NH1 A;  3WNF A;  3K5M A;  1C0M A;  1WSF A;  3KIO A;  4LSL A;  2HW3 A;  2IDO A;  4M3Z A;  5C25 A;  2ATQ A;  4B9M A;  2RPI A;  3B6O A;  4C8K A;  1RIL A;  1Q9Y A;  5HRO A;  4C8O A;  3SZ2 A;  3PX4 A;  4W5O A;  2QK9 A;  2IS3 A;  1SKR A;  1JL1 A;  3ZSR A;  3SUN A;  3KD5 E;  1WAJ A;  4CEE A;  4O0I A;  4FJJ A;  3V6D A;  2KTQ A;  4OKJ A;  4CF1 A;  1RBS A;  3ZSY A;  1YTA A;  4OKK A;  1SUQ A;  4BAC A;  2DTU A;  1B9F A;  2YNH A;  4KHW A;  1UWB A;  3IG1 A;  5KRS A;  3OYF A;  1S1V A;  3QEV A;  1RTJ A;  3QIO A;  4F8R A;  1NK7 A;  1S1W A;  1HPZ A;  4M3U A;  4DU4 A;  3EYZ A;  3AV9 A;  4CHP A;  3F9K A;  4KRF A;  4GMJ B;  1BQM A;  4Q5V A;  2O4G A;  3EY1 A;  4DQI A;  4KI4 A;  1G15 A;  2ZE2 A;  4FM2 A;  3V9X A;  3S3O A;  1ZBI A;  2G8U A;  3DLE A;  2IAJ A;  3VQD A;  1T05 A;  4J2B A;  1KCF A;  1IG9 A;  4AHS A;  2LSN A;  3DLR A;  1RTD A;  1LWE A;  1WN7 A;  1HJR A;  4E7K A;  4CFD A;  4IBN A;  3I0R A;  3KLF A;  4R5P A;  2F8T A;  5HRR A;  5FRN A;  1ZBH A;  4FJ9 A;  5C24 A;  3ITH A;  4CER A;  4AH9 A;  1XI1 A;  4E89 A;  2E6L A;  3HVT A;  3E01 A;  5J1E A;  3ISN C;  2DY4 A;  5DMR A;  3M8P A;  4DS4 A;  3QEX A;  1KLN A;  2X78 A;  1C1B A;  1EP4 A;  4E1N A;  4OGC A;  3TAB A;  4B9L A;  1XWL A;  3A2F A;  4B9U A;  4N47 A;  1QQC A;  4HHT A;  3JYT A;  3RMC A;  1RT4 A;  1S6P A;  4FJ7 A;  3AVF A;  3SPY A;  1LWC A;  2QXF A;  3C6U A;  3DOK A;  4B08 A;  4CHN A;  1EX4 A;  1MU2 A;  4OPK A;  3HO1 A;  4B3O A;  4O44 A;  3RMD A;  4M42 A;  1RDC A;  3LWM A;  1T03 A;  3SPZ A;  1IKV A;  1TGO A;  3NE6 A;  2Z1I A;  4FJX A;  4Z4F A;  1KVA A;  1R0A A;  4FJI A;  4NYF A;  3OYN A;  3OYH A;  3MXJ A;  5JS1 A;  4CK3 A;  4CJL A;  3K57 A;  3TAP A;  3D45 A;  4ELU A;  1JLG A;  4C8M A;  3SCX A;  2AJQ A;  3DRS A;  1X9W A;  1T8E A;  4HCC A;  2ITG A;  5KGX A;  3SNN A;  4M3T A;  1VRU A;  5DK5 A;  4BDZ A;  1C0T A;  3QEI A;  1VSI A;  5EU7 A;  4CJF A;  2RF2 A;  3LP2 A;  4H4M A;  4CJ3 A;  3MEG A;  4PA1 A;  4CEC A;  5HP1 A;  2G8W A;  4F3O A;  1IKW A;  2HVI A;  5I42 A;  1ZYQ A;  3LP3 A;  3QEW A;  4DTP A;  3AA2 A;  3AVN A;  4CHZ A;  1A5W A;  1BIZ A;  5CYQ A;  4I9L A;  4FCY A;  1NOY A;  3CM6 A;  3U3G A;  4QAG A;  2PYJ A;  4Q0B A;  4QCL A;  1TK8 A;  2B5J A;  1KVC A;  1X1P A;  4CIG A;  1SKW A;  4BE2 A;  4J2D A;  1JXB A;  1IKX A;  5KGW A;  3V9U A;  4CJU A;  4DSE A;  3HST B;  1TKD A;  4FJ8 A;  2OA8 A;  2KW4 A;  1CXU A;  4TSX A;  4Z4H A;  3VQ6 A;  3ZCM A;  4GVM A;  1HYV A;  3DOL A;  2OZM A;  1L3S A;  1NK9 A;  2P1J A;  3AA4 A;  4EZ6 A;  5CYM A;  4KPY A;  1Y97 A;  2B6A A;  1ZBU A;  4NCG A;  3DYA A;  4CGF A;  1O1W A;  5HLF A;  1RT5 A;  1EET A;  4JS5 A;  4ELT A;  4JRP A;  1NKE A;  4E7I A;  2VWJ A;  2KZM A;  3ZSX A;  4ZHR A;  5D3G A;  3LPU A;  3AA5 X;  1GOA A;  3AVI A;  4E1M A;  1N6Q A;  4OJR A;  3S3N A;  2HNZ A;  3WNG A;  3NGZ A;  2YNI A;  1T7P A;  3MEE A;  1BIS A;  4DTX A;  2Y1J A;  4JS4 A;  3VQB A;  4PWD A;  3SUO A;  1VSD A;  4CHY A;  4PQU A;  4F2S A;  3AO2 A;  1HRH A;  1Q8I A;  3IRX A;  1BQN A;  3VQQ A;  3OYJ A;  3RTV A;  3L8B A;  1WSE A;  4KI6 A;  4EZ9 A;  1WNS A;  2X6N A;  1HQU A;  4K8X A;  5SZT A;  1X9M A;  4CJ5 A;  4KKO A;  3LAK A;  3RMB A;  2G8F A;  3VQ7 A;  2ETJ A;  4FJ5 A;  3AO3 A;  3V81 A;  2F96 A;  4BWJ A;  3VQ9 A;  1RT2 A;  4HVJ A;  1B92 A;  3RR7 A;  3L3U A;  3TAN A;  3SQ2 A;  5I3U A;  3DM2 A;  2HHQ A;  3OS2 A;  3DLB A;  2IOC A;  4O55 A;  4BE1 A;  4CJQ A;  1NJZ A;  2D0A A;  4FK0 A;  3SUQ A;  4FK2 A;  2GV9 A;  3THV A;  3O3H A;  4MFB A;  4FLX A;  3TI0 A;  3TAR A;  4YNQ A;  4CJV A;  4DTU A;  1UAX A;  5FRM A;  3MXI A;  3VQE A;  1LAV A;  1S1X A;  1VRT A;  3ZT4 A;  3RRG A;  3H08 A;  2OZS A;  1SKS A;  1NJY A;  2W42 A;  4KHN A;  1KTQ A;  3HT3 A;  3WNE A;  3AVM A;  1TV6 A;  1ASV A;  2FBV A;  3HXM A;  4DTN A;  4E3S A;  4B9S A;  1RBU A;  1DTQ A;  4DWI A;  3ZSZ A;  4LD0 A;  3DI6 A;  4CHO A;  3P5J A;  3LAL A;  3JSM A;  2A1R A;  3VQ4 A;  1C6V A;  3ZT1 A;  2RKI A;  3PO5 A;  4PY5 A;  1TVR A;  3KJV A;  2VG6 A;  3TWH A;  3L2Q A;  4KO0 A;  2A1S A;  4FM0 A;  4CIF A;  1VSE A;  4NYN A;  4BE0 A;  4I9Q A;  3HJF A;  2HHU A;  1J9A A;  1TL3 A;  1VSL A;  3OYG A;  1TL1 A;  3SV4 A;  4FXD A;  1HQE A;  1XHX A;  4GW6 A;  3CFO A;  1BHL A;  3TAG A;  4FVM A;  3ZSV A;  4UQG A;  1BI4 A;  3NF9 A;  1ZBL A;  3SI6 A;  4AHV A;  2YKM A;  4J2A A;  1S1T A;  3V1Q A;  4MQ3 A;  3NHG A;  3ZSQ A;  3QER A;  3T19 A;  3NGY A;  5K14 A;  3OYM A;  3K5L A;  4H8K A;  3KKR A;  3NH0 A;  4DFK A;  4KHS A;  1IH7 A;  4YFU A;  2Z1H A;  1BIU A;  5KTQ A;  3MAQ A;  2YV0 X;  3VN5 A;  4RW4 A;  4CF8 A;  1FK9 A;  4RW8 A;  1HYS A;  4I2Q A;  4CJT A;  4CFB A;  1RT1 A;  3MEC A;  1SL1 A;  3VQ5 A;  3KLI A;  1FKP A;  1NOZ A;  3C6T A;  4OGE A;  4RW9 A;  4M3R A;  4CEA A;  1LW2 A;  2JGU A;  3I8D A;  4FW2 A;  4M3Y A;  4LY7 A;  3U3Y A;  2ZD1 A;  1L5U A;  3OJU A;  4CJP A;  2P5O A;  1XHZ A;  4FZZ A;  4CGD A;  3KKS A;  1LWF A;  3L2W A;  1U47 A;  3UIQ A;  1S9E A;  4FLZ A;  5J2N A;  4F4K A;  4DQQ A;  1GOC A;  3L2U A;  4FLW A;  3TAM A;  1A5X A;  4DTJ A;  2XY5 A;  3PX0 A;  1KSP A;  1RCH A;  4ID5 A;  3SUP A;  3BGR A;  4O0J A;  3TR8 A;  3LP1 A;  3OYE A;  2D0C A;  3NAE A;  1D9D A;  4FJN A;  4FM1 A;  3D0P A;  4AHC A;  3I0S A;  3LAN A;  4Z4G A;  1RT3 A;  3VQP A;  2XHB A;  4AHT A;  3PUF A;  4CEZ A;  1B9D A;  2IC3 A;  3OS0 A;  2HHS A;  3K5O A;  1WSH A;  2YHB A;  3OYK A;  3KLH A;  3NDK A;  3RWU A;  1IKY A;  1WSG A;  2O4I A;  1I3A A;  1NJW A;  3ULD A;  2VG7 A;  2G8I A;  2HHX A;  1DTT A;  1BL3 A;  1K6Y A;  1WSI A;  2X74 A;  4ID1 A;  5KRT A;  5FDL A;  4DQS A;  4HTU A;  4AHR A;  2XY7 A;  2HMI A;  3PO4 A;  3RR8 A;  3M8R A;  1JXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...