3G10A

Structure of s. pombe pop2p - mg2+ and mn2+ bound form
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
SPIRDVWSTNLQQEMNLIMSLIERYPVVSMDTEFPGVVARPLGVFKSSDDYHYQTLRANVDSLKIIQIGLALSDEEGNAPVEACTWQFNFTFNLQDDMYAPESIELLTKSGIDFKKHQEVGIEPADFAELLIGSGLVLQEEVTWITFHSGYDFAYLLKAMTQIPLPAEYEEFYKILCIYFPKNYDIKYIMKSVLNNSKGLQDIADDLQIHRIGPQHQAGSDALLTARIFFEIRSRYFDGSIDSRMLNQLYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCR4-Not complex subunit Caf1
publication title The activity and selectivity of fission yeast Pop2p are affected by a high affinity for Zn2+ and Mn2+ in the active site
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase, gene regulation
total genus 85
structure length 252
sequence length 252
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3g10A00
2G8IA 4FLYA 1RCHA 2YNHA 3AVHA 3LALA 5JS2A 1RTIA 4Z4HA 2X6NA 3OYFA 2Y1IA 1NK0A 3NFAA 1UAXA 3QO9A 1RDAA 1IO2A 1BGXT 4B9UA 1ASWA 1HQEA 3ZT3A 1A5WA 3EZ5A 4OGEA 4N41A 1G15A 2D5RA 2HB5A 2BANA 1BIZA 1S6PA 3THVA 4FM1A 4NCGA 3OJSA 4C8OA 3HK2A 1TKZA 1FKPA 3V9ZA 4W5NA 1K6YA 2YHAA 4KHUA 1B92A 1KLNA 3U3GA 3S3OA 1VSEA 1IKXA 4IG0A 1BCMA 3HPGA 4DS4A 4B8AB 1NK9A 4FJKA 4BE0A 4M3WA 5FROA 3O3GA 4IKFA 3PY8A 4CFAA 4Y1DA 5J2QA 3NF9A 3SQ4A 2BDPA 3LP2A 1U49A 4L8RB 3TAMA 3P5JA 1XWLA 4H8KA 4W5RA 4E7IA 1RTDA 3DLEA 4FJNA 4DTJA 1C0UA 5SWMA 5HROA 4CGDA 2R7YA 3V1RA 1NKBA 1S9GA 2HVIA 3PO4A 3F9KA 1XHXA 3HL8A 4CJTA 2ZE2A 4C8LA 5CZ2A 3KK3A 4C8KA 4DQPA 3OYCA 4M3TA 3LPUA 3LAKA 4PA1A 4CJFA 3O3HA 1SKWA 3RRHA 4DF4A 4FXDA 2HNYA 4KI6A 1RDDA 3VA0A 4Z4FA 3F73A 4CEQA 1D9FA 1TK0A 4O0JA 1U4BA 3K5NA 3CFPA 2G8VA 5HRPA 4JRQA 2X78A 5J2PA 2PYJA 3IS9A 4CJPA 4DQRA 2PY5A 4PQUA 4J2AA 4FK0A 3OS1A 3B6PA 3I0RA 2KW4A 3I8DA 2NUBA 3AO1A 1VSFA 4KTWA 4N47A 4F4KA 3QINA 1Z26A 2Z1JA 4FK2A 1VSMA 3O4QA 2P51A 3ZSRA 3VQ4A 1S6QA 1CLQA 2DFEA 4OKJA 4OPKA 2OZSA 2XY8A 5J2MA 2KFNA 1Q9YA 3O3FA 1RTJA 4W5QA 4AILC 4KB0A 2ITGA 4IFVA 1L5UA 4CHQA 3V9XA 2HW3A 1BI4A 4DFKA 3DOLA 3EY1A 1LW2A 1J9AA 2ATQA 3KD1E 2VWJA 1YTAA 3PV8A 1FK9A 1EP4A 5CYQA 2IOCA 3PUFA 5FRNA 4I2QA 1L3UA 1T03A 1NK7A 4CIFA 1ASVA 4FJ7A 4B3OA 3VN5A 3RMBA 4Q5VA 2RF2A 3TAEA 4NCAA 4E7HA 4Z4EA 2G8KA 4OKEA 2HMIA 3AVNA 3LZJA 4E19A 3AVGA 3NHGA 4DG1A 1B9FA 5KRSA 3OY9A 3KLHA 3SUOA 4CE9A 3VQBA 4CJKA 4FM2A 4DFMA 4LD0A 3AO4A 1RTHA 1WAFA 4EP4A 1ZYQA 3UIQA 3FFIA 2KQ2A 1BCOA 4CEEA 4BDYA 3SUNA 1FXXA 2JGUA 3OYEA 2XY5A 3DM2A 5I42A 1SV5A 3HPHA 1JXBA 1MU2A 1NOYA 3C94A 1UA0A 3AVBA 1TKXA 2EHGA 4GW6A 4M3RA 5T7BA 2W42A 1XI1A 1QSSA 2P5OA 4FJHA 1EXQA 1RT3A 4FZZA 4KFBA 4M3UA 2O4IA 1TL3A 1VSLA 3MEEA 3NH0A 3K5MA 3OYJA 4C8NA 1HNVA 3QIPA 3SUQA 3DLHA 4K8XA 5J2NA 4FZXC 4EZ9A 1BI4B 4DF8A 3SQ2A 1WSIA 4E3SA 3OYIA 4IDKA 3HSTB 3ULDA 2ETJA 4FYDA 1C1CA 4DSJA 4BE2A 2AJQA 4IFYA 4N76A 3ZSVA 2HNDA 2B4JA 2ZQBA 2VWKA 3MECA 1NK8A 4CGJA 1WN7A 4CECA 4CHNA 4ELVA 3SNNA 1NK4A 3OYKA 3NF7A 3RR8A 3C95A 4FVMA 3OJUA 1HYSA 4KHQA 3MAQA 2OZMA 1JLBA 3ZT2A 4KV8A 1EETA 4CJLA 1BHLA 3S3MA 5C42A 2Z1IA 4W5TA 1ZBLA 4CEZA 1VSJA 1GOCA 5SZTA 2VG7A 1WSHA 3DYAA 1HMVA 1NKCA 4RW4A 1IH7A 1JLGA 4BWJA 3QEWA 4Y1CA 3AVKA 4DSEA 4N5SA 4FJGA 2OPQA 2IAJA 1C0MA 1TGOA 3CYMA 1CXQA 3V9UA 3ZSOA 4ZTFA 1A5VA 4XIUA 4DU4A 5I3UA 3SV4A 3TABA 5HLFA 2HHVA 3OYLA 2VG6A 4ID1A 2E6LA 1HJRA 4MFBA 4DFPA 4CFDA 1JLEA 5HP1A 3TANA 1JXEA 1EKEA 4CIGA 3DI6A 4UQGA 3O4NA 4Q0BA 1LW0A 5DK5A 3QESA 3DRSA 3MXJA 3V4IA 2FBVA 1WNSA 3KK1A 3CM6A 1LAWA 1JLFA 2FBTA 3ISNC 3K57A 3LP3A 3WNFA 3NF6A 1X9MA 1YT3A 5HBMA 3KLFA 3OYHA 3SPZA 4CIEA 1HYVA 1QS4A 3HO1A 1KSPA 1Z25A 2D0CA 4NYFA 4FZYA 2FBYA 4CJEA 4DTNA 3M8RA 1WAJA 4C8MA 4CJWA 4OLAA 4KHYA 3RMDA 4KB1A 2HHWA 3OS0A 3AVLA 2D0AA 2X74A 4H4OA 4M45A 3ZT4A 3U3YA 2XRIA 3AVAA 4J2EA 4MQ3A 1HNIA 4CHPA 4I9LA 3V81A 1JL1A 3AVCA 4NYNA 4FJMA 3RTVA 4F2RA 4AHVA 1KFSA 1WSJA 4FW1A 4O55A 1NK6A 2G8WA 5E41A 2Y1JA 3KLIA 1B9DA 3ZT0A 2HHTA 4JLHA 3OYAA 3SZ2A 1IG9A 4GMJB 3JSMA 1UWBA 3VA3A 4Z4GA 4WE1A 4DWIA 1VRUA 1ZBFA 3LZIA 2YV0X 3OYMA 3SJJA 3TAFA 1BIUA 3QIOA 3NDKA 3ZSXA 4QCLA 2RPIA 3KTQA 3VQ5A 1C6VA 1S1WA 4LSLA 5EU7A 3SV3A 2OPRA 2B5JA 1L3TA 1KLMA 3L3UA 1RBVA 3M8PA 4DTSA 4ZTJA 4AHSA 2YNFA 3PX0A 2DY4A 2HHXA 4DSIA 4RW7A 2YNIA 3VQ8A 1NK5A 1YVUA 3HVTA 3DLKA 1T7PA 3BDPA 3QEXA 1W0HA 1FKOA 1WSGA 4R5PA 3HT3A 3S3NA 3AA2A 3AA3A 4CF2A 4FJIA 1I39A 4KTZA 1D8YA 4OVLA 2YKMA 4LH4A 4B9VA 1ZBHA 1KTQA 2P1JA 1SUQA 2KFZA 4JRPA 1NJWA 2DTUA 4O0IA 2QXFA 5K14A 4RG8A 4W5OA 3IRXA 1JKHA 1JLAA 4BACA 4FLUA 1RBUA 3VQAA 3ALYA 1LV5A 1ZBUA 1RDCA 2E6MA 1QE1A 1VSDA 2Z1GA 2VG5A 5FDLA 1GOBA 1IKYA 4CGHA 4YFUA 4N56A 3NAEA 3SI6A 1IKWA 3C6UA 3TR8A 3IAYA 4DSFA 2I5JA 3AA4A 2RN2A 4FLWA 1F21A 4KREA 1VSKA 3P1GA 4F3OA 3QNNA 4JS4A 2WOMA 4JS5A 4CJ5A 2A1RA 4CCHA 3HP6A 3QERA 4FJXA 3AVFA 4G1QA 2BGGA 3AV9A 4DQIA 1A5XA 1J53A 1S1XA 3T19A 3HPOA 4CK2A 4GVMA 3V6DA 4CGGA 1KFDA 3SPYA 3HJFA 1LWCA 3VQPA 3TAQA 5KI6A 4YNQA 1TKDA 3BGRA 3LP1A 4EP5A 5KGXA 1HYZA 3WNGA 5D3GA 3U6FA 2KTQA 3VQEA 3KK2A 2O4GA 3RMCA 1DTTA 2FBXA 5CZ1A 4DQSA 4CEOA 1RT2A 3OYDA 5KTQA 2WONA 3NCIA 5JS1A 3HVRA 4LSNA 3KLGA 3ZSQA 1TVRA 2OPPA 3AA5X 3OYNA 2RKIA 2YKNA 4FCYA 4E7KA 3MXIA 4CEBA 1TAUA 4NCBA 1Q9XA 4FJ9A 4ICLA 3NGZA 3V9SA 4FJ5A 2IC3A 4KO0A 1RDBA 4CJUA 4CGFA 3VQ7A 1TV6A 1JL2A 1T8EA 2XY6A 1JLCA 4KAZA 5DMRA 4CERA 3KD5E 1TK5A 4E1MA 1U04A 2QKKA 4E0DA 2F8TA 1T05A 4F3TA 5HRRA 3DRPA 2QKBA 1C0TA 3KKSA 4FLVA 4KHNA 3H08A 2FC0A 5HRSA 1C1AA 4DSKA 2ZD1A 4BDPA 1DTQA 5CY4A 4FLTA 2GBZA 4Z4CA 3AO3A 2EX3A 4CFBA 3AVMA 4OPJA 3T3FA 4E7LA 1QSYA 2DFFA 3C6TA 3QEPA 4QOZB 1TAQA 4HCCA 2GV9A 3A2FA 4Z4IA 2OPSA 4B8CA 4AHCA 1X1PA 2B6AA 1BQNA 2G8UA 2HNZA 5C24A 3OYBA 1TL1A 1NJXA 3CFOA 3LPTA 2X6SA 1Y97A 3NGYA 4CF8A 5C25A 1VSIA 1S1VA 3CFRA 4CJVA 4HHTA 1NOZA 3HYFA 4RW6A 3AO2A 4K8ZA 1RILA 3B6OA 1S5JA 1NKEA 3RR7A 4B9SA 4KI4A 4PWDA 1HRHA 4KKOA 4CJ3A 4OKKA 4BE1A 4FLXA 1KVCA 3G10A 1U48A 1N6QA 1ITGA 4HUFA 4DTPA 2Q3SA 3V1QA 4CEFA 3SUPA 4CHYA 3K5LA 4DTXA 2P5GA 1SL1A 4I9QA 4KTQA 3M8SA 4ID5A 4TSXA 1C1BA 4CFCA 4FK4A 2IS3A 2LSNA 3JYTA 3L2VA 2KZZA 1S1TA 1BISA 3HXMA 2F8SA 3E01A 5KGWA 4E89A 4DFJA 1SL2A 4FJ8A 4I2PA 3VQQA 3ZSWA 3I0SA 3SYZA 1R0AA 4FJLA 4DMNA 3AVIA 4CJ4A 1YTUA 1D5AA 3WNHA 2XHBA 3PX6A 4OGCA 4DLEA 1X9SA 2GUIA 1HQUA 3PO5A 3L2RA 2BE2A 2DFHA 4FJJA 4FW2A 1REVA 3NH1A 4KHWA 4DU1A 1WLJA 3CG7A 3ITHA 3CQ8A 1TK8A 4F8RA 1HPZA 4PUOA 4CHOA 3SQ0A 4PY5A 3MEDA 1DLOA 1W9HA 2YNGA 3QNOA 3QETA 1SL0A 4B9LA 4E7JA 3VQ6A 1I3AA 4HUGA 3EYZA 2G8HA 2XY7A 3DMJA 3ZCMA 4B08A 3RWUA 3ZT1A 5KRTA 1QQCA 3K5OA 4DTRA 4O4GA 3NGIA 4DTOA 2OYQA 4HCBA 4CF0A 1KRPA 3PX4A 1S9EA 4CF9A 1QTMA 1U45A 1BL3A 3RRGA 1CZ9A 3DOKA 4DSLA 1LWFA 1QSLA 1CXUA 4ELTA 4OLBA 1XC9A 3LWMA 1LWEA 4IBNA 4DU3A 3DRRA 1QHTA 3S9HA 4CK3A 1RBTA 1UA1A 2HVHA 4AHUA 3HP9A 5CYMA 1VSHA 3TAPA 4M3YA 4KPYA 1EX4A 2G8FA 3LWLA 4I7FA 3NF8A 1J5OA 3IG1A 1IKVA 4M42A 3OYGA 1VRTA 4DTMA 2PYLA 3LP0A 3SCXA 1RNHA 3TI0A 4F2SA 4Z0UA 3HM9A 4ELUA 3M8QA 3TARA 4M41A 3AO5A 3CM5A 1BQMA 3RMAA 4IG3A 3NBPA 4AHTA 1VK0A 3L3VA 3QLHA 3VQCA 4FLZA 4O44A 1SKRA 3KIOA 1RT6A 1UOCA 3NH2A 2IDOA 1X9WA 2HHQA 3D45A 2JLEA 3LDSA 2KZMA 4CK1A 4LH5A 3VQDA 4CJRA 4CHZA 3OS2A 3TWHA 4CJQA 3ZSZA 4AH9A 1NJZA 4EZ6A 3G0ZA 3SQ1A 4J2DA 4KHSA 3KLEA 2XO7A 3DLBA 4M3ZA 1RBSA 4ZHRA 4AHRA 1LAVA 4RW8A 4B9TA 5FRMA 1JLQA 1ZBIA 2OA8A 4HVJA 4CJSA 1L3VA 1S1UA 4M3XA 1NJYA 1CZBA 1N5YA 2F96A 1J54A 3VQ9A 4FM0A 4HTUA 2IGIA 3V1OA 4DLGA 3OVNA 3L2WA 4CEAA 4CGIA 3K2PA 1Q8IA 4RW9A 3ZSYA 1RT4A 5HRNA 3D0PA 3NE6A 1KVAA 2Z1HA 4QAGA 4LY7A 3L2UA 3QEVA 3KKRA 3QEIA 4B9MA 4DQQA 1U47A 3MEGA 3KJVA 4J2BA 2D0BA 2HHSA 3T1AA 3K59A 3V9WA 1SKSA 1RT1A 1TKTA 4O5BA 1RBRA 3K58A 3P83D 1KCFA 2QK9A 1WSEA 1ASUA 3MXMA 4CEDA 4DS5A 2PZSA 1RT7A 2YHBA 4CESA 1KVBA 3DLGA 3LANA 1GOAA 1WSFA 3TAGA 1D9DA 2E4LA 4DTUA 1RT5A 4HUEA 4CF1A 2HHUA 3L8BA 1O1WA 3DLRA 5J1EA 1L3SA 4BDZA 4B9NA 3AVJA 2A1SA 3ASMA 3LAMA 4E1NA 4OJRA 3L2QA 1XHZA 3WNEA 4H4MA 4KRFA 4BWMA
chains in the Genus database with same CATH superfamily
2G8IA 1NBWA 4FLYA 1NK0A 2QKKA 4DKWA 1RTIA 3OYFA 5GAGP 1QVGM 1BGXT 2NRWA 1A5WA 5M1KA 3CPWM 1G15A 2Q0UA 4GNIA 1BIZA 3CCVN 4DR1K 3THVA 2HHHK 3J81O 1FKPA 3V9ZA 3J8AA 4KHUA 1B92A 3MN5A 1IKXA 4IG0A 4DS4A 1OH6A 4FJKA 4IKFA 3JXUA 4BVOA 4CFAA 5J2QA 3NF9A 1T44A 4L8RB 4H8KA 3FR0A 4FJNA 2QA4N 4YOYA 5SWMA 5JVHL 2E2PA 2NRTA 2QWNA 2HVIA 2ZE2A 4DQPA 3OYCA 1QQNA 4BR9A 4CJFA 1SKWA 3K9JA 2Q97A 4X66K 4LF5K 4FXDA 2HF4A 3F73A 3IKMA 1D9FA 4JK9A 3WXIA 5HRPA 5J2PA 2PYJA 2O8DB 4WQ5C 4DQRA 4CBWA 2PY5A 3I56N 4PQUA 4J2AA 3B6PA 4LF4K 4XH5A 1Q81O 4N47A 3CI5A 1Z26A 2Z1JA 3ZYYX 4FK2A 1VSMA 3CJ7A 2W40A 4QS8A 3VQ4A 1S6QA 1CLQA 2OZSA 1JCEA 1Q9YA 4W5QA 2ITGA 4IFVA 3ZLJA 3DOLA 3KD1E 2ATQA 1YIJN 3MCPA 5FRNA 1L3UA 1NK7A 1QHAA 4YOTA 3TAEA 2FSNA 3TSUA 1B9FA 5KRSA 3O1WA 2GEMA 3SBGA 2ZJQL 3NMUA 2QEXN 3FFIA 3NVMA 1BCOA 3THXB 1H1VA 1MU2A 2P5OA 1TKXA 4FJHA 1U6ZA 2O4IA 3ZEUB 1VSLA 4JI0K 3MEEA 3UB5A 3SUQA 1YF5L 1YXQA 4DF8A 1WSIA 3ENOA 4E3SA 2WFBA 3HSTB 1C1CA 3MECA 1NK8A 4CBUA 2WBNA 1NK4A 4FOEA 4ILGB 3NF7A 4BRGA 5AZJB 3KWIA 3LM2A 3C95A 3LDOA 4ISGA 4KHQA 3MAQA 1HX1A 2BH1A 4CEZA 3DYAA 3UKUA 4X65K 3O4WA 4WCEL 1TYQA 5AQVA 1TGOA 1YITN 3GG4A 3CMAN 4ZTFA 3SV4A 2HHVA 2IVPA 1HJRA 4DV2K 4UQGA 3VEXA 5DK5A 3DRSA 2O8EA 1IJJA 5DM6L 3KK1A 1LAWA 1JLFA 2FBTA 3LP3A 3WNFA 1X9MA 1YT3A 5HBMA 3SPZA 3OYHA 3UE5A 1RDUA 1KSPA 1GLJO 4IOAL 3KVGA 4DTNA 3FFKB 4KHYA 2V51B 5CE3A 4J8FA 3U3YA 2A5XA 4J2EA 3H1QA 2ZJRL 2ASPA 2Q36A 4FW1A 2P9IB 3CC4N 1B9DA 1N32K 4JLHA 3JSMA 1UWBA 3VA3A 4DWIA 2GTDA 1HNWK 1ZBFA 4FOIA 5C15A 3TAFA 3NDKA 3IMXA 2RPIA 2EWSA 1K9MO 2ASOA 4LF7K 3R8EA 1L3TA 4X62K 3L3UA 1Z05A 3M8PA 4AHSA 2DY4A 1NGIA 4KH6A 1XMQK 2RE2A 1NMNA 4JKDA 1YVUA 3DLKA 3FZMA 3AGKA 1W0HA 4R5PA 3HT3A 3S3NA 4CF2A 4KTZA 3TTCA 4OVLA 3SK3A 2YKMA 4LH4A 4B9VA 1KTQA 4JRPA 1NJWA 4O0IA 5K14A 2NRVA 3IRXA 4IOXA 4CZKA 4YOXA 4FLUA 1MA9B 4CZMA 1VSDA 2YCHA 4CGHA 4YFUA 3NAEA 3CCQN 2HBLA 3SI6A 3TR8A 3IAYA 2UXBK 2RN2A 4FLWA 2A1RA 2I7PA 3HP6A 3AVFA 4G1QA 4YOVA 4E1JA 4CVNE 2PAVA 3VGLA 3HPOA 1LWCA 4IXCA 4QS9A 4A62A 2A41A 3BGRA 3LP1A 3UKRB 5TKWA 3WNGA 4FPBA 4CZLA 3VQEA 2KTQA 3KK2A 3RMCA 1K8KA 1T6DA 2D0OA 3KLGA 5JS1A 3AA5X 2RKIA 2YKNA 3G25A 4DR3K 5ELZA 1EWRA 4H0XB 2BUPA 4LF9K 1RDBA 3BEXA 1TV6A 4FWRA 3TU5A 3VGKA 4CERA 1TK5A 3O1BA 4PKGA 4E0DA 3DXKA 3ULEB 2FSJA 2F8TA 3HRGA 4CBXA 2QKBA 1C0TA 4FLVA 1W97L 4AM7A 4Z4CA 3OHRA 4E7LA 2DFFA 2P9LB 4QOZB 2GV9A 4WQ4A 4B8CA 2B6AA 2HNZA 1N8RO 5C24A 1NJXA 3SMSA 4AM6A 2X6SA 1Y97A 4CF8A 3CCLN 1VSIA 1XMOK 4RW6A 4KI4A 1RILA 1WOQA 1S5JA 3B6OA 4B9SA 1QVFM 3ZETA 1KVCA 1N6QA 1U48A 1OH5A 1ITGA 2HBMA 4RCHA 5AQHA 3THWA 4CHYA 4DTXA 3G71N 2O8FA 2NZTA 1NGBA 2HBJA 1GLDG 2CH6A 1SL2A 4L3QA 4FJ8A 4I2PA 2FXUA 3VQQA 1R0AA 3I0SA 4XH4A 3WNHA 2GUIA 3PO5A 1REVA 5C12A 3P4IA 3CG7A 1TK8A 5GINA 4PUOA 1HPZA 4NB4A 4CHOA 3THYB 4NXMK 2YNGA 1W9HA 3QNOA 1SL0A 1I3AA 3F5TA 2XY7A 1HKGA 2HMPA 3CQYA 5AQLA 5C2DA 3ZT1A 3P31A 3FZKA 2UUAK 2VQFK 3NGIA 1M90O 1KRPA 1QTMA 3QMLA 5AQZA 4CD3A 3RSEB 4DU3A 2UU9K 3DRRA 1QHTA 3CXCM 3CJAA 3AARA 4B3TK 4BRCA 1IKVA 1VRTA 3TI0A 3HI0A 3TARA 3AO5A 1BQMA 4JKGB 3L3VA 3O5BA 3KIOA 1RT6A 2YHYA 1X9WA 2JLEA 1VQNN 4LH5A 3VQDA 1NJZA 2YI1A 4FWKA 3SQ1A 3EZWA 3W3DA 1RBSA 1LAVA 1SQKA 4RW8A 4B9TA 1JLQA 3CETA 3EO3A 4CJSA 1L3VA 1NJYA 1N5YA 3IDHA 4PL8A 4HTUA 3VTHA 2IGIA 4WQ5A 1Q18A 4XH1A 3VERA 1TUUA 3ZSYA 1KVAA 3L2UA 2HF3A 1U47A 1DKGD 1VQKN 2D0BA 3T1AA 4FO0A 4LC9B 1BUPA 4IZ9A 4BQLA 1GLCG 1RBRA 4JKFA 4AF1A 2E2NA 1GOAA 1WSFA 2P9SA 5KPRA 2E4LA 4DTUA 4HUEA 1O1WA 3DLRA 5LMUK 4BDZA 4B9NA 5A2QO 1BO5O 4OJRA 1VQ4N 4F9OA 3R3LA 3RVCA 3AVHA 5JS2A 3LALA 4Z4HA 2X6NA 2E88A 3VGMA 4WFAL 3QO9A 4B9UA 1ASWA 1HQEA 3ZT3A 4DV5K 4OGEA 4N41A 2UXDK 3A8YA 2HB5A 2O8CB 2BANA 1S6PA 5BPMA 3TTFA 3OJSA 1ZXOA 4C8OA 3HK2A 1K6YA 1NM1A 3U3GA 1VSEA 4X64K 4BE0A 5FROA 3O3GA 3I33A 3PSFA 3SQ4A 3LP2A 4WFBL 4W5RA 4E7IA 4I6MB 1O13A 3DLEA 1C0UA 1GLBG 4MDBA 2R7YA 1S9GA 2Q31A 3F9KA 1XHXA 3HL8A 4B1UB 5JMVA 3KK3A 3EEQA 4PA1A 3ID8A 4FWQA 2F7TA 1OVYA 4Z4FA 1YAGA 3ATVA 3VPZA 3WXJA 4A59A 1U4BA 3K5NA 4IFEA 1Z6RA 3M3ZA 2G8VA 3EL2A 2FF3B 2X78A 3J7YP 3L0QA 4FK0A 2KW4A 1VSFA 3TPQA 1G99A 4H5RA 3QINA 1P8ZA 3ZSRA 4JI6K 2DFEA 2XY8A 5AFUA 3O3FA 4JI1K 4AILC 2VCPA 1TUYA 2HW3A 4DFKA 1VQLN 2VWJA 1EP4A 2QTDA 4B1XB 5JLFA 4DR2K 1OH8A 1ASVA 1ATRA 1GLEG 4C1NK 2CGJA 1MWMA 4DUYK 4BG8A 4Q5VA 1BA0A 3OBWA 4BRLA 4E7HA 4Z4EA 5B8HA 3NHGA 3DAWA 3CIPA 5F1XA 4DFMA 3CMEN 1Q86O 4IEEA 3CCJN 1E4GT 4FWMA 2QWRA 5ADXH 3E9OA 4BDYA 1FXXA 3SUNA 3OYEA 5C10A 1SV5A 3HPHA 4AQYK 1JXBA 4MO4A 3I8BA 3C94A 5EX5A 3AVBA 5BR8K 2EHGA 4M3RA 2W42A 1NOYA 4EFHA 5AQJA 5GIOA 1QQOA 2CGKA 3WXKA 4C8NA 1HNVA 3QIPA 3DLHA 3T69A 4EZ9A 4PL7A 1SZ2A 3VMFB 3SQ2A 3DJCA 3OYIA 3ULDA 3IFRA 3VEOA 1QZ6A 4FYDA 2AJQA 4JHDA 2FLOA 4BRDA 2B4JA 3EE8A 4ELVA 1N36K 3M1FA 3MK6A 4CJLA 5MLCQ 4BG9A 3LM9A 1WSHA 3ATUA 1IH7A 1JLGA 4Y1CA 3E9LA 4JKCA 3V9UA 3VEYA 1W2BM 2JWKA 5HLFA 3OYLA 2VG6A 4ID1A 4DFPA 4MFBA 4BQZA 4BVPA 3TANA 1JXEA 4CIGA 1ESVA 3DI6A 4LFCK 4Q0BA 4FSVA 5FLXO 1OVQA 2YJEA 3MX2A 3ISNC 4A5BA 3VESA 4JI2K 3NF6A 1BU6O 3KLFA 4CIEA 1HYVA 3HO1A 1NGEA 1Z25A 1KAYA 2D0CA 4NYFA 4FZYA 3M8RA 1WAJA 4GVEA 3RMDA 3HOTA 3OS0A 2X74A 1ILYA 5LJVA 5KPTA 3EE9A 4IWVA 1WSJA 1NK6A 3KLIA 3ZT0A 3UKUB 2HHTA 5TKYA 3OYAA 3SZ2A 4GMJB 3Q7CA 4EHTA 3K9KA 1TYQB 4BROA 2NNWA 3T1HK 4MDAA 3OYMA 3VEWA 3SJJA 3VOVA 3QIOA 4QCLA 3VQ5A 1FW6A 4MLEA 2OPRA 2B5JA 2QM1A 3WQUA 3O9QA 1KLMA 2P9UA 2O8EB 2VGMA 4ZTJA 2HHXA 4DSIA 3HVTA 1KXPA 2UYTA 3FZFA 1T7PA 3BDPA 4K25A 4K41A 1WSGA 1VQPN 2FSKA 4IOCL 3EKUA 4YY3K 2IVNA 1D4XA 2VGNA 2DTUA 4IDHA 5KQDA 5BPLA 3H45C 2QWQA 4A5AA 1JKHA 4BACA 1RBUA 4CJ7A 4BR0A 1RGIA 3Q7BA 2ZJPL 3P38A 4CW7B 3JAMO 1IKWA 3M5RA 4DSFA 4A2BA 5BN8A 3H6EA 4CZFA 3QNNA 4JS4A 2BTFA 2BGGA 3QFPA 4O5FA 4BR2A 4G9ZA 1A5XA 1S1XA 3T19A 3ID6A 4CK2A 4GVMA 1XNQK 5KI6A 4YNQA 1TKDA 2P9KA 4WFNL 5KGXA 3CCMN 4BGAA 5AQYA 4DQSA 1RT2A 3OYDA 2WONA 3HVRA 4LSNA 4FWOA 2OPPA 3ZSQA 3OYNA 3MXIA 3LDLA 4E7KA 4CEBA 4BREA 4FJ9A 4ICLA 5EVZA 3V9SA 2ZGYA 4CGFA 3CCEN 1JLCA 1JJ2M 4CD1A 5DMRA 2YHXA 1EWQA 1T05A 5HRRA 3KKSA 4KHNA 1J6ZA 3O6WA 2FC0A 1IBLK 5AZIA 2GELA 1DTQA 3T1YK 2GBZA 1XQSC 3AVMA 2FF6A 2QWPA 4BR4A 3D2FA 3QEPA 2E20A 4YORA 2O8BA 3A2FA 2OPSA 4AHCA 1X1PA 2V7ZA 3OYBA 4B9LA 5BRFA 4B3SK 1S1VA 1V4SA 2QWLA 1NOZA 4M7YA 4K8ZA 1K8KB 2QW9A 3O8MA 1HRHA 4OKKA 4FLXA 4FWLA 3U9DA 3G10A 2A6AA 3SUPA 3U9ZA 1SL1A 4KTQA 1C1BA 3N4PA 1EO1A 3DXKB 4CZEA 3CCRN 3E01A 4LF8K 2WUSA 5KGWA 5CR4A 2XHBA 3PX6A 1X9SA 1HQUA 2KHOA 1NGHA 2DFHA 1WLJA 4F8RA 3SQ0A 5BRHA 5AQRA 4ILHA 4H0OA 3VQ6A 2CH5A 4HUGA 3EYZA 4B08A 4DB3A 3CC2N 3CQXA 3K5OA 4O4GA 3ZETB 4CF0A 4JD2A 5LY3A 5IT9O 4JKHA 5H1SQ 3DOKA 3THWB 4OLBA 1XC9A 3LWMA 4IBNA 3S9HA 2O8FB 3TAPA 1VSHA 2YHWA 4KPYA 1EX4A 4I7FA 4YDUC 2W41A 3IG1A 1E3MA 3L4IA 4DR4K 2PYLA 3SCXA 1RNHA 4Z0UA 3MN7A 1RDWX 3CM5A 1NG9A 1VK0A 3VQCA 4Z94A 1UOCA 3NH2A 2HHQA 3D45A 3LDSA 3TWHA 4CHZA 4KHSA 4AH9A 2UUCK 3KLEA 2XO7A 4HWIA 5FRMA 3BZCA 4IO8A 5GAHP 2OA8A 1CZBA 3E1YA 3V1OA 4LFAK 3DWLA 4CEAA 1VQ5N 2P9NA 5FPEA 1RT4A 5HRNA 3D0PA 2Z1HA 4LY7A 2QWMA 3KJVA 4CZHA 3FZHA 1SKSA 3GBTA 2HBKA 3P83D 2QK9A 1ASUA 3HSCA 4DS5A 1XC3A 1RT7A 2YHBA 4CESA 1YVNA 2ITMA 4H5WA 3QBXA 4NO7A 2HHUA 3L8BA 4H5VA 5J1EA 1L3SA 3DLLL 2A1SA 1XHZA 3WNEA 4BRIA 4KRFA 3M6GA 1NKCA 5FPNA 3R1XA 1IO2A 3EZ5A 3SMPA 4DCHA 3MMVA 3D2EA 3O9RA 3HBTA 4JI7K 4FVUA 4W5NA 2YHAA 2VQEK 4DR5K 3S3OA 4JN4A 1BCMA 3HPGA 1SAZA 2Q2RA 4M3WA 1RFQA 2D4WA 3FZLA 2A42A 5AQQA 3P39A 3A0IX 4Y1DA 3GDQA 3L6QA 1U49A 1U2VA 3TAMA 3P5JA 2P9SB 1EQYA 1R59O 4JKBA 1RTDA 3L4QA 4DTJA 5HROA 1NU0A 5CHIA 3V1RA 1NKBA 3PO4A 4GV3A 5CZ2A 3ZX3A 4C8KA 4M3TA 3LAKA 3CERA 5BPNA 5KPZA 1XUPO 4O8UA 3G4SN 3MCAB 1BA1A 3RRHA 1ZC6A 4CEQA 1VQMN 4KH4A 3CFPA 4FWSA 1C0FA 4JRQA 1J5EK 1S3XA 3C6HA 3OTOK 3CCSN 3ZX0A 4CJPA 3OS1A 3I0RA 3I8DA 4KTWA 4F4KA 4KBOA 3ZX2A 2KFNA 5J2MA 1RTJA 4KB0A 4JNEA 3O80A 4CHQA 1BI4A 3EY1A 1LW2A 4M7XA 3PV8A 5JLHA 1HLUA 4JV5K 4I2QA 1CZAN 2E1ZA 4EIAA 3AAQA 4FJ7A 3ENHA 2RF2A 4NCAA 2G8KA 4OKEA 3AVNA 4E19A 1X3MA 3AVGA 3CJCA 4DG1A 1C0GA 2E1YA 3KLHA 3SUOA 4CE9A 3AO4A 1WAFA 1FJGK 4EP4A 1ZYQA 1VQ8N 2JWLA 4CEEA 3WXMB 4BRKA 1NMDA 2JGUA 3DM2A 4BGBA 5M1QA 1UA0A 1K73O 3G6EN 4FZZA 2PFUA 1WBBA 2DPNA 4M3UA 3BY5A 4B3MK 3K5MA 3OYJA 4K8XA 5J2NA 4FZXC 1HNXK 4H0VB 4IDKA 1IG8A 2ETJA 4DSJA 3A5MC 3BUZB 2ZQBA 3SNNA 3OYKA 3RR8A 1QZ5A 3F9MA 2OTLN 2OZMA 4KV8A 1EETA 2P9PA 3S3MA 2Z1IA 4W5TA 1ZBLA 1VSJA 5SZTA 4RW4A 4BWJA 3QEWA 1I94K 3AVKA 4FJGA 3CYMA 1CXQA 3ZSOA 5AJ3K 4XIUA 4DU4A 3E66A 3TABA 4DR7K 2E6LA 1KD1O 1BOTO 4CFDA 4BRMA 1EKEA 4BRHA 3V4IA 3MXJA 4DV1K 2FBVA 1WNSA 4JHDB 3K57A 1MWKA 1YI2N 1QS4A 3O9UA 4C1NI 1VAZA 2FBYA 4CJEA 1OKJA 4WF9L 4CJWA 1HPMA 4KB1A 2HHWA 3AVLA 4M45A 3AGRA 2XRIA 3AVAA 4MQ3A 1HNIA 4CHPA 3V81A 1JL1A 3AVCA 4NYNA 4H5NA 4BC3A 4DR6K 4H03B 5E41A 2Y1JA 1HJOA 1IG9A 5AQXA 1VQ7N 3AAPA 3LZIA 3EKSA 4LSLA 3SV3A 2Q1NA 4GY2B 2CGLA 5EOYA 4R79A 2YNFA 3PX0A 2F4VK 3F2KA 4RW7A 1HKCA 4H0YB 3QEXA 1FKOA 3AA2A 3AA3A 1D8YA 3QDKA 3WUHA 1ZBHA 3VEVA 3J80O 1VQON 3CJBA 2QXFA 4W5OA 5AQKA 1N34K 2GX9A 1ATSA 3ALYA 1LV5A 1RDCA 3C7NB 3SBTA 4RTFD 1IKYA 4N56A 3LL3A 5AQGA 4YHHK 4A2AA 4KREA 1VSKA 4BRAA 4BRFA 3QERA 4IJNA 2P9UB 4JI8K 4DQIA 1VQ6N 4EHUA 3PLAA 3SPYA 5LL6Z 3TAQA 2RHKA 2AA4A 4EP5A 1HYZA 1ZBSA 2OCEA 2QI2A 4JI5K 1DTTA 2FBXA 3TSQA 4EAHD 4CZJA 3NCIA 3T7ZA 4DUZK 1WUAA 4JEPA 4FCYA 4NCBA 1Q9XA 3NGZA 3ENBA 3S41A 5M1FA 4KAZA 2XY6A 4YDUA 3WQTA 3KD5E 4E1MA 4JAXA 4JI4K 4F3TA 5LMNK 1HNZK 3NVKA 3H08A 1C1AA 5M1NA 4DSKA 5ADXA 5CY4A 4FLTA 1NJIO 2EX3A 4OPJA 3T3FA 2UUBK 1QSYA 1TAQA 4HCCA 4Z4IA 3D6RA 2P9KB 2G8UA 4KHPK 2OANA 1TL1A 2YX6A 3A5LC 3LPTA 3NGYA 5C25A 3CFRA 2Q0RA 4B1YB 3HYFA 3AO2A 1NKEA 4DV0K 2KKZA 3RR7A 4KKOA 5F2RA 4DQ8A 5BRDA 3J7ZO 4XEIA 3PIPL 3LDNA 4I9QA 5AQTA 3M8SA 4ID5A 4TSXA 4CFCA 2VYPA 4FK4A 2IS3A 4B3RK 3HXMA 3C7NA 3C0BA 4E89A 5JICA 5AZIB 4DV7K 4FJLA 1YTUA 3EN9A 4IJAA 4DLEA 3MWTA 3L2RA 5BR9A 3D2FB 2O8BB 1KQSM 4KHWA 4DU1A 3MEDA 4JK8A 1DLOA 1HUXA 2YJFA 4E7JA 3MX5A 2G8HA 2VWBA 3WEEA 4K0KK 2W6KA 3C6AA 3W0LA 4DTOA 2OYQA 1ATNA 3PSIA 1U45A 1CZ9A 4DSLA 1LWFA 5M1OA 4ELTA 3K0SA 1UA1A 3HP9A 5CYMA 5C0YA 2AP1A 5AQUA 1J5OA 3TTDA 4CZGA 4B9QA 4A57A 4DTMA 4M42A 3SAFA 3CHWA 3HM9A 4ELUA 1XNRK 4M41A 3RMAA 3DXMA 4IG3A 3NBPA 4AHTA 3QLHA 4FLZA 1SKRA 4BR5A 3JS6A 2IDOA 2KZMA 4CJRA 4CJQA 5HOOA 4HVJA 4M3XA 2F96A 1J54A 4FM0A 4DLGA 4JD2B 3AY9A 1Q8IA 4RW9A 4BDPA 4CZIA 3NE6A 3QEVA 1GLAG 3KKRA 4B9MA 4DQQA 3MEGA 4J2BA 2HHSA 5AQSA 1TKTA 4O5BA 5GADP 4HTLA 2ZM6K 3MN6A 1WSEA 2ZGZA 4NXNK 1KVBA 1K8AO 3TAGA 1D9DA 1RT5A 4RWTA 4CF1A 4NLBA 3AVJA 3BF3A 2QXLA 3ASMA 3LAMA 4E1NA 5AQPA 3VETA 1NGCA 4H4MA 4BWMA 1LOTB 1RCHA 2YNHA 2Y1IA 3BF1A 4JYAK 1OH7A 3NFAA 1UAXA 1RDAA 3IUCA 2D5RA 2O8DA 4FM1A 4NCGA 2P9NB 5AQIA 1TKZA 4A61A 2D0PA 4JKAA 1KLNA 1Y64A 1JCFA 4B8AB 1NK9A 3BP8A 1YJNN 3PY8A 4DV4K 3FGUA 2BDPA 1XWLA 3FE1A 5JVGL 3OA9A 4CGDA 2D1KA 5AQOA 4C8LA 4CJTA 3U8XA 3LPUA 3CPEA 1NGGA 4YOWA 3O3HA 3GE1A 4DF4A 2HNYA 4UY8O 4KI6A 2NRRA 2NRZA 1RDDA 3VA0A 1YHQN 1TK0A 4O0JA 3IS9A 1NLVA 3D2EB 2A40A 3U4LA 3A5NC 1T3VA 3THXA 2NUBA 3AO1A 1IBKK 1S72N 3SAGA 2E5LK 1WBDA 3R9PA 3O9SA 3O4QA 3H1VX 2P51A 4OKJA 4OPKA 3ZEUA 5GIPA 4O8KA 1U2VB 5AQWA 3TSPA 4DV3K 1L5UA 2F9WA 3V9XA 3C65A 3HZ6A 1J9AA 3WXLA 1YTAA 1FK9A 5CYQA 1KC8O 2IOCA 4OO1J 3PUFA 3CF5L 1NWKA 1T03A 4CIFA 4B3OA 3VN5A 3RMBA 5AZJA 1JCGA 2HMIA 3LZJA 4FPAA 2GWKA 3MN9A 3OY9A 5KQ8A 3VQBA 4CJKA 2V52B 4FM2A 4LD0A 1RTHA 3VTIA 3UIQA 2KQ2A 2XY5A 5I42A 2ASMA 3HTVA 4GW6A 5T7BA 1QSSA 1DT9A 3HM8A 1XI1A 1EXQA 4FWPA 1RT3A 4KFBA 1TL3A 3NH0A 5AQMA 4M63C 1Q82O 1BI4B 1SS6A 1BG3A 2HOEA 1NGDA 4BE2A 4IFYA 4N76A 3ZSVA 2HNDA 4BY9C 2VWKA 4CGJA 4MO5A 1WN7A 4CECA 4CHNA 5DM7L 4FVMA 3OJUA 1HYSA 4OX9K 3BZKA 1JLBA 3ZT2A 1BHLA 1BDGA 5C42A 3CJ1A 4IO9L 4V19S 1GOCA 2VG7A 2P9IA 2GWJA 1HMVA 4ISFA 4B1ZA 4DSEA 4N5SA 5HL7L 2OPQA 2IAJA 1C0MA 2HSTA 3OW2M 1A5VA 5I3UA 2W6LA 2GUPA 1JLEA 5HP1A 2NLXA 3J7AP 4BRNA 3O4NA 1LW0A 3QESA 5BN9A 3O08A 3CM6A 5E26A 3WT0A 3I55N 1W7AA 1NNEA 4C8MA 4OLAA 3LDQA 4H4OA 2D0AA 4BC4A 3H3OB 2A3ZA 3ZT4A 4I9LA 2P9PB 4FJMA 3RTVA 4F2RA 4AHVA 4NLCA 1KFSA 4K42A 4O55A 4Y0WA 3VENA 2G8WA 4BC2A 4GKJK 4Z4GA 4WE1A 1VRUA 2YV0X 4OPAA 1BIUA 3H3NO 3ZSXA 3KTQA 1C6VA 1S1WA 5EU7A 5AR0A 4PKHA 1RBVA 4DTSA 3QBWA 3LDPA 2YNIA 3VQ8A 1NK5A 3UKRA 5AQFA 4WYBA 4FJIA 1I39A 2E2QA 4ILJA 2P1JA 4FWNA 1SUQA 2KFZA 5E84A 4FL9A 3CC7N 4RG8A 5I9EB 1JLAA 3VQAA 1DGKN 3PIOL 1ZBUA 2E6MA 1QE1A 4GV6A 2Z1GA 2VG5A 5FDLA 1GOBA 5EY4A 3C6UA 3ULEA 1NGAA 4PHTX 1IV0A 2I5JA 3AA4A 1F21A 3P1GA 4F3OA 3GL1A 2WOMA 4JS5A 4CJ5A 4CCHA 4FJXA 3AV9A 1X9JA 1J53A 3V6DA 4CGGA 1KFDA 1T6CA 2P9LA 3HJFA 1VHXA 3VQPA 1QQMA 3SLCA 5D3GA 3U6FA 1M1KO 4H0PA 5FPDA 2O4GA 1NGFA 5CZ1A 4CEOA 3OBYA 1IBMK 1YJ9N 5KTQA 3CJ9A 4C23A 3QB0A 1TVRA 3R6MA 4BR7A 1TAUA 5F0XA 4FJ5A 2IC3A 4KO0A 3SAHA 4CJUA 4H0TB 3VQ7A 1JL2A 3GOIA 1T8EA 1X3NA 1HR0K 1U04A 2NRHA 3DRPA 5HRSA 3HOSA 2OTJN 4QS7A 2ZD1A 3B8AX 3SJHA 3AO3A 4H5TA 4CFBA 3CCUN 2UXCK 4PKIA 3C6TA 2QWOA 1LCUA 4JK7A 4U7BA 1BQNA 3THYA 3MDQA 3CFOA 5LJWA 4HHTA 2ZWHA 4LFBK 4CJVA 1Q7YO 4PWDA 1DEJA 2J4RA 1P90A 5GAEP 4CJ3A 4BE1A 3VF4A 4B1VA 4CI6A 4LF6K 4YOUA 4HUFA 4DTPA 3QFUA 1KAZA 2Q3SA 5AFUH 3V1QA 4CEFA 3K5LA 3VF6A 3RSEA 2P5GA 4JI3K 1KAXA 2LSNA 5FPMA 3L2VA 3JYTA 1S1TA 1BISA 2F8SA 2KZZA 2E8AA 2H3GX 4DFJA 4BC5A 3KZBA 3ZSWA 3SYZA 4DMNA 3AVIA 4CJ4A 1N33K 1D5AA 4OPHA 4OGCA 2F9TA 1BWFO 4JKGA 2BE2A 4FJJA 4FW2A 3NH1A 5IWAK 3ITHA 3CQ8A 4PY5A 3QETA 1V4TA 2V7YA 3DMJA 3ZCMA 3RWUA 4U67L 5KRTA 1QQCA 2I7NA 1NGJA 3KWGA 4DTRA 4HCBA 2PBDA 3PX4A 1S9EA 4CF9A 3RRGA 1BL3A 4DV6K 1QSLA 1CXUA 1LWEA 4BRQA 1E4FT 5AQNA 4CK3A 1RBTA 3D7EO 5BREA 2HVHA 4AHUA 2WTUA 4M3YA 2G8FA 3LWLA 1MDUB 3NF8A 3O9TA 2IVOA 3KK7A 4IEIA 3OYGA 3LP0A 4F2SA 3M8QA 3FLCO 2KLAA 5EXWA 3VEZA 2WC9A 4O44A 2ZF5O 4CK1A 3OS2A 4WQ4C 3ZSZA 4MLHA 4EZ6A 3G0ZA 4K43A 4J2DA 4M3ZA 3DLBA 4ZHRA 4AHRA 3WEEB 2IIRA 3KHYA 3E9PA 1ZBIA 1S1UA 1S22A 3QICA 3VQ9A 3H46O 1WB9A 4DHYA 3OVNA 4GKKK 3L2WA 4CGIA 2O8CA 5C2FA 3K2PA 4JKEA 3VF2A 1YJWN 3CD6N 1HKBA 4QAGA 4B1WB 3QEIA 3K59A 3V9WA 1RT1A 3K58A 5M1PA 1KCFA 3MXMA 4CEDA 2PZSA 1GLFO 3DLGA 4GV9A 3LANA 1GLLO 3MWPA 4I6MA 4KH5A 3DXMB 2E2OA 4ISEA 3L2QA 1YUWA 4BRPA 3A5OC 3N4QA 2NRXA 1VQ9N
chains in the Genus database with same CATH topology
2G8IA 4FLYA 1RCHA 2YNHA 3AVHA 3LALA 5JS2A 1RTIA 4Z4HA 2X6NA 3OYFA 2Y1IA 1NK0A 3NFAA 1UAXA 3QO9A 1RDAA 1IO2A 1BGXT 4B9UA 1ASWA 1HQEA 3ZT3A 1A5WA 3EZ5A 4OGEA 4N41A 1G15A 2D5RA 2HB5A 2BANA 1BIZA 1S6PA 3THVA 4FM1A 4NCGA 3OJSA 4C8OA 3HK2A 1TKZA 1FKPA 3V9ZA 4W5NA 1K6YA 2YHAA 4KHUA 1B92A 1KLNA 3U3GA 3S3OA 1VSEA 1IKXA 4IG0A 1BCMA 3HPGA 4DS4A 4B8AB 1NK9A 4FJKA 4BE0A 4M3WA 5FROA 3O3GA 4IKFA 3PY8A 4CFAA 4Y1DA 5J2QA 3NF9A 3SQ4A 2BDPA 3LP2A 1U49A 4L8RB 3TAMA 3P5JA 1XWLA 4H8KA 4W5RA 4E7IA 1RTDA 3DLEA 4FJNA 4DTJA 1C0UA 5SWMA 5HROA 4CGDA 2R7YA 3V1RA 1NKBA 1S9GA 2HVIA 3PO4A 3F9KA 1XHXA 3HL8A 4CJTA 2ZE2A 4C8LA 5CZ2A 3KK3A 4C8KA 4DQPA 3OYCA 4M3TA 3LPUA 3LAKA 4PA1A 4CJFA 3O3HA 1SKWA 3RRHA 4DF4A 4FXDA 2HNYA 4KI6A 1RDDA 3VA0A 4Z4FA 3F73A 4CEQA 1D9FA 1TK0A 4O0JA 1U4BA 3K5NA 3CFPA 2G8VA 5HRPA 4JRQA 2X78A 5J2PA 2PYJA 3IS9A 4CJPA 4DQRA 2PY5A 4PQUA 4J2AA 4FK0A 3OS1A 3B6PA 3I0RA 2KW4A 3I8DA 2NUBA 3AO1A 1VSFA 4KTWA 4N47A 4F4KA 3QINA 1Z26A 2Z1JA 4FK2A 1VSMA 3O4QA 2P51A 3ZSRA 3VQ4A 1S6QA 1CLQA 2DFEA 4OKJA 4OPKA 2OZSA 2XY8A 5J2MA 2KFNA 1Q9YA 3O3FA 1RTJA 4W5QA 4AILC 4KB0A 2ITGA 4IFVA 1L5UA 4CHQA 3V9XA 2HW3A 1BI4A 4DFKA 3DOLA 3EY1A 1LW2A 1J9AA 2ATQA 3KD1E 2VWJA 1YTAA 3PV8A 1FK9A 1EP4A 5CYQA 2IOCA 3PUFA 5FRNA 4I2QA 1L3UA 1T03A 1NK7A 4CIFA 1ASVA 4FJ7A 4B3OA 3VN5A 3RMBA 4Q5VA 2RF2A 3TAEA 4NCAA 4E7HA 4Z4EA 2G8KA 4OKEA 2HMIA 3AVNA 3LZJA 4E19A 3AVGA 3NHGA 4DG1A 1B9FA 5KRSA 3OY9A 3KLHA 3SUOA 4CE9A 3VQBA 4CJKA 4FM2A 4DFMA 4LD0A 3AO4A 1RTHA 1WAFA 4EP4A 1ZYQA 3UIQA 3FFIA 2KQ2A 1BCOA 4CEEA 4BDYA 3SUNA 1FXXA 2JGUA 3OYEA 2XY5A 3DM2A 5I42A 1SV5A 3HPHA 1JXBA 1MU2A 1NOYA 3C94A 1UA0A 3AVBA 1TKXA 2EHGA 4GW6A 4M3RA 5T7BA 2W42A 1XI1A 1QSSA 2P5OA 4FJHA 1EXQA 1RT3A 4FZZA 4KFBA 4M3UA 2O4IA 1TL3A 1VSLA 3MEEA 3NH0A 3K5MA 3OYJA 4C8NA 1HNVA 3QIPA 3SUQA 3DLHA 4K8XA 5J2NA 4FZXC 4EZ9A 1BI4B 4DF8A 3SQ2A 1WSIA 4E3SA 3OYIA 4IDKA 3HSTB 3ULDA 2ETJA 4FYDA 1C1CA 4DSJA 4BE2A 2AJQA 4IFYA 4N76A 3ZSVA 2HNDA 2B4JA 2ZQBA 2VWKA 3MECA 1NK8A 4CGJA 1WN7A 4CECA 4CHNA 4ELVA 3SNNA 1NK4A 3OYKA 3NF7A 3RR8A 3C95A 4FVMA 3OJUA 1HYSA 4KHQA 3MAQA 2OZMA 1JLBA 3ZT2A 4KV8A 1EETA 4CJLA 1BHLA 3S3MA 5C42A 2Z1IA 4W5TA 1ZBLA 4CEZA 1VSJA 1GOCA 5SZTA 2VG7A 1WSHA 3DYAA 1HMVA 1NKCA 4RW4A 1IH7A 1JLGA 4BWJA 3QEWA 4Y1CA 3AVKA 4DSEA 4N5SA 4FJGA 2OPQA 2IAJA 1C0MA 1TGOA 3CYMA 1CXQA 3V9UA 3ZSOA 4ZTFA 1A5VA 4XIUA 4DU4A 5I3UA 3SV4A 3TABA 5HLFA 2HHVA 3OYLA 2VG6A 4ID1A 2E6LA 1HJRA 4MFBA 4DFPA 4CFDA 1JLEA 5HP1A 3TANA 1JXEA 1EKEA 4CIGA 3DI6A 4UQGA 3O4NA 4Q0BA 1LW0A 5DK5A 3QESA 3DRSA 3MXJA 3V4IA 2FBVA 1WNSA 3KK1A 3CM6A 1LAWA 1JLFA 2FBTA 3ISNC 3K57A 3LP3A 3WNFA 3NF6A 1X9MA 1YT3A 5HBMA 3KLFA 3OYHA 3SPZA 4CIEA 1HYVA 1QS4A 3HO1A 1KSPA 1Z25A 2D0CA 4NYFA 4FZYA 2FBYA 4CJEA 4DTNA 3M8RA 1WAJA 4C8MA 4CJWA 4OLAA 4KHYA 3RMDA 4KB1A 2HHWA 3OS0A 3AVLA 2D0AA 2X74A 4H4OA 4M45A 3ZT4A 3U3YA 2XRIA 3AVAA 4J2EA 4MQ3A 1HNIA 4CHPA 4I9LA 3V81A 1JL1A 3AVCA 4NYNA 4FJMA 3RTVA 4F2RA 4AHVA 1KFSA 1WSJA 4FW1A 4O55A 1NK6A 2G8WA 5E41A 2Y1JA 3KLIA 1B9DA 3ZT0A 2HHTA 4JLHA 3OYAA 3SZ2A 1IG9A 4GMJB 3JSMA 1UWBA 3VA3A 4Z4GA 4WE1A 4DWIA 1VRUA 1ZBFA 3LZIA 2YV0X 3OYMA 3SJJA 3TAFA 1BIUA 3QIOA 3NDKA 3ZSXA 4QCLA 2RPIA 3KTQA 3VQ5A 1C6VA 1S1WA 4LSLA 5EU7A 3SV3A 2OPRA 2B5JA 1L3TA 1KLMA 3L3UA 1RBVA 3M8PA 4DTSA 4ZTJA 4AHSA 2YNFA 3PX0A 2DY4A 2HHXA 4DSIA 4RW7A 2YNIA 3VQ8A 1NK5A 1YVUA 3HVTA 3DLKA 1T7PA 3BDPA 3QEXA 1W0HA 1FKOA 1WSGA 4R5PA 3HT3A 3S3NA 3AA2A 3AA3A 4CF2A 4FJIA 1I39A 4KTZA 1D8YA 4OVLA 2YKMA 4LH4A 4B9VA 1ZBHA 1KTQA 2P1JA 1SUQA 2KFZA 4JRPA 1NJWA 2DTUA 4O0IA 2QXFA 5K14A 4RG8A 4W5OA 3IRXA 1JKHA 1JLAA 4BACA 4FLUA 1RBUA 3VQAA 3ALYA 1LV5A 1ZBUA 1RDCA 2E6MA 1QE1A 1VSDA 2Z1GA 2VG5A 5FDLA 1GOBA 1IKYA 4CGHA 4YFUA 4N56A 3NAEA 3SI6A 1IKWA 3C6UA 3TR8A 3IAYA 4DSFA 2I5JA 3AA4A 2RN2A 4FLWA 1F21A 4KREA 1VSKA 3P1GA 4F3OA 3QNNA 4JS4A 2WOMA 4JS5A 4CJ5A 2A1RA 4CCHA 3HP6A 3QERA 4FJXA 3AVFA 4G1QA 2BGGA 3AV9A 4DQIA 1A5XA 1J53A 1S1XA 3T19A 3HPOA 4CK2A 4GVMA 3V6DA 4CGGA 1KFDA 3SPYA 3HJFA 1LWCA 3VQPA 3TAQA 5KI6A 4YNQA 1TKDA 3BGRA 3LP1A 4EP5A 5KGXA 1HYZA 3WNGA 5D3GA 3U6FA 2KTQA 3VQEA 3KK2A 2O4GA 3RMCA 1DTTA 2FBXA 5CZ1A 4DQSA 4CEOA 1RT2A 3OYDA 5KTQA 2WONA 3NCIA 5JS1A 3HVRA 4LSNA 3KLGA 3ZSQA 1TVRA 2OPPA 3AA5X 3OYNA 2RKIA 2YKNA 4FCYA 4E7KA 3MXIA 4CEBA 1TAUA 4NCBA 1Q9XA 4FJ9A 4ICLA 3NGZA 3V9SA 4FJ5A 2IC3A 4KO0A 1RDBA 4CJUA 4CGFA 3VQ7A 1TV6A 1JL2A 1T8EA 2XY6A 1JLCA 4KAZA 5DMRA 4CERA 3KD5E 1TK5A 4E1MA 1U04A 2QKKA 4E0DA 2F8TA 1T05A 4F3TA 5HRRA 3DRPA 2QKBA 1C0TA 3KKSA 4FLVA 4KHNA 3H08A 2FC0A 5HRSA 1C1AA 4DSKA 2ZD1A 4BDPA 1DTQA 5CY4A 4FLTA 2GBZA 4Z4CA 3AO3A 2EX3A 4CFBA 3AVMA 4OPJA 3T3FA 4E7LA 1QSYA 2DFFA 3C6TA 3QEPA 4QOZB 1TAQA 4HCCA 2GV9A 3A2FA 4Z4IA 2OPSA 4B8CA 4AHCA 1X1PA 2B6AA 1BQNA 2G8UA 2HNZA 5C24A 3OYBA 1TL1A 1NJXA 3CFOA 3LPTA 2X6SA 1Y97A 3NGYA 4CF8A 5C25A 1VSIA 1S1VA 3CFRA 4CJVA 4HHTA 1NOZA 3HYFA 4RW6A 3AO2A 4K8ZA 1RILA 3B6OA 1S5JA 1NKEA 3RR7A 4B9SA 4KI4A 4PWDA 1HRHA 4KKOA 4CJ3A 4OKKA 4BE1A 4FLXA 1KVCA 3G10A 1U48A 1N6QA 1ITGA 4HUFA 4DTPA 2Q3SA 3V1QA 4CEFA 3SUPA 4CHYA 3K5LA 4DTXA 2P5GA 1SL1A 4I9QA 4KTQA 3M8SA 4ID5A 4TSXA 1C1BA 4CFCA 4FK4A 2IS3A 2LSNA 3JYTA 3L2VA 2KZZA 1S1TA 1BISA 3HXMA 2F8SA 3E01A 5KGWA 4E89A 4DFJA 1SL2A 4FJ8A 4I2PA 3VQQA 3ZSWA 3I0SA 3SYZA 1R0AA 4FJLA 4DMNA 3AVIA 4CJ4A 1YTUA 1D5AA 3WNHA 2XHBA 3PX6A 4OGCA 4DLEA 1X9SA 2GUIA 1HQUA 3PO5A 3L2RA 2BE2A 2DFHA 4FJJA 4FW2A 1REVA 3NH1A 4KHWA 4DU1A 1WLJA 3CG7A 3ITHA 3CQ8A 1TK8A 4F8RA 1HPZA 4PUOA 4CHOA 3SQ0A 4PY5A 3MEDA 1DLOA 1W9HA 2YNGA 3QNOA 3QETA 1SL0A 4B9LA 4E7JA 3VQ6A 1I3AA 4HUGA 3EYZA 2G8HA 2XY7A 3DMJA 3ZCMA 4B08A 3RWUA 3ZT1A 5KRTA 1QQCA 3K5OA 4DTRA 4O4GA 3NGIA 4DTOA 2OYQA 4HCBA 4CF0A 1KRPA 3PX4A 1S9EA 4CF9A 1QTMA 1U45A 1BL3A 3RRGA 1CZ9A 3DOKA 4DSLA 1LWFA 1QSLA 1CXUA 4ELTA 4OLBA 1XC9A 3LWMA 1LWEA 4IBNA 4DU3A 3DRRA 1QHTA 3S9HA 4CK3A 1RBTA 1UA1A 2HVHA 4AHUA 3HP9A 5CYMA 1VSHA 3TAPA 4M3YA 4KPYA 1EX4A 2G8FA 3LWLA 4I7FA 3NF8A 1J5OA 3IG1A 1IKVA 4M42A 3OYGA 1VRTA 4DTMA 2PYLA 3LP0A 3SCXA 1RNHA 3TI0A 4F2SA 4Z0UA 3HM9A 4ELUA 3M8QA 3TARA 4M41A 3AO5A 3CM5A 1BQMA 3RMAA 4IG3A 3NBPA 4AHTA 1VK0A 3L3VA 3QLHA 3VQCA 4FLZA 4O44A 1SKRA 3KIOA 1RT6A 1UOCA 3NH2A 2IDOA 1X9WA 2HHQA 3D45A 2JLEA 3LDSA 2KZMA 4CK1A 4LH5A 3VQDA 4CJRA 4CHZA 3OS2A 3TWHA 4CJQA 3ZSZA 4AH9A 1NJZA 4EZ6A 3G0ZA 3SQ1A 4J2DA 4KHSA 3KLEA 2XO7A 3DLBA 4M3ZA 1RBSA 4ZHRA 4AHRA 1LAVA 4RW8A 4B9TA 5FRMA 1JLQA 1ZBIA 2OA8A 4HVJA 4CJSA 1L3VA 1S1UA 4M3XA 1NJYA 1CZBA 1N5YA 2F96A 1J54A 3VQ9A 4FM0A 4HTUA 2IGIA 3V1OA 4DLGA 3OVNA 3L2WA 4CEAA 4CGIA 3K2PA 1Q8IA 4RW9A 3ZSYA 1RT4A 5HRNA 3D0PA 3NE6A 1KVAA 2Z1HA 4QAGA 4LY7A 3L2UA 3QEVA 3KKRA 3QEIA 4B9MA 4DQQA 1U47A 3MEGA 3KJVA 4J2BA 2D0BA 2HHSA 3T1AA 3K59A 3V9WA 1SKSA 1RT1A 1TKTA 4O5BA 1RBRA 3K58A 3P83D 1KCFA 2QK9A 1WSEA 1ASUA 3MXMA 4CEDA 4DS5A 2PZSA 1RT7A 2YHBA 4CESA 1KVBA 3DLGA 3LANA 1GOAA 1WSFA 3TAGA 1D9DA 2E4LA 4DTUA 1RT5A 4HUEA 4CF1A 2HHUA 3L8BA 1O1WA 3DLRA 5J1EA 1L3SA 4BDZA 4B9NA 3AVJA 2A1SA 3ASMA 3LAMA 4E1NA 4OJRA 3L2QA 1XHZA 3WNEA 4H4MA 4KRFA 4BWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8I A;  4FLY A;  1RCH A;  2YNH A;  3AVH A;  3LAL A;  5JS2 A;  1RTI A;  4Z4H A;  2X6N A;  3OYF A;  2Y1I A;  1NK0 A;  3NFA A;  1UAX A;  3QO9 A;  1RDA A;  1IO2 A;  1BGX T;  4B9U A;  1ASW A;  1HQE A;  3ZT3 A;  1A5W A;  3EZ5 A;  4OGE A;  4N41 A;  1G15 A;  2D5R A;  2HB5 A;  2BAN A;  1BIZ A;  1S6P A;  3THV A;  4FM1 A;  4NCG A;  3OJS A;  4C8O A;  3HK2 A;  1TKZ A;  1FKP A;  3V9Z A;  4W5N A;  1K6Y A;  2YHA A;  4KHU A;  1B92 A;  1KLN A;  3U3G A;  3S3O A;  1VSE A;  1IKX A;  4IG0 A;  1BCM A;  3HPG A;  4DS4 A;  4B8A B;  1NK9 A;  4FJK A;  4BE0 A;  4M3W A;  5FRO A;  3O3G A;  4IKF A;  3PY8 A;  4CFA A;  4Y1D A;  5J2Q A;  3NF9 A;  3SQ4 A;  2BDP A;  3LP2 A;  1U49 A;  4L8R B;  3TAM A;  3P5J A;  1XWL A;  4H8K A;  4W5R A;  4E7I A;  1RTD A;  3DLE A;  4FJN A;  4DTJ A;  1C0U A;  5SWM A;  5HRO A;  4CGD A;  2R7Y A;  3V1R A;  1NKB A;  1S9G A;  2HVI A;  3PO4 A;  3F9K A;  1XHX A;  3HL8 A;  4CJT A;  2ZE2 A;  4C8L A;  5CZ2 A;  3KK3 A;  4C8K A;  4DQP A;  3OYC A;  4M3T A;  3LPU A;  3LAK A;  4PA1 A;  4CJF A;  3O3H A;  1SKW A;  3RRH A;  4DF4 A;  4FXD A;  2HNY A;  4KI6 A;  1RDD A;  3VA0 A;  4Z4F A;  3F73 A;  4CEQ A;  1D9F A;  1TK0 A;  4O0J A;  1U4B A;  3K5N A;  3CFP A;  2G8V A;  5HRP A;  4JRQ A;  2X78 A;  5J2P A;  2PYJ A;  3IS9 A;  4CJP A;  4DQR A;  2PY5 A;  4PQU A;  4J2A A;  4FK0 A;  3OS1 A;  3B6P A;  3I0R A;  2KW4 A;  3I8D A;  2NUB A;  3AO1 A;  1VSF A;  4KTW A;  4N47 A;  4F4K A;  3QIN A;  1Z26 A;  2Z1J A;  4FK2 A;  1VSM A;  3O4Q A;  2P51 A;  3ZSR A;  3VQ4 A;  1S6Q A;  1CLQ A;  2DFE A;  4OKJ A;  4OPK A;  2OZS A;  2XY8 A;  5J2M A;  2KFN A;  1Q9Y A;  3O3F A;  1RTJ A;  4W5Q A;  4AIL C;  4KB0 A;  2ITG A;  4IFV A;  1L5U A;  4CHQ A;  3V9X A;  2HW3 A;  1BI4 A;  4DFK A;  3DOL A;  3EY1 A;  1LW2 A;  1J9A A;  2ATQ A;  3KD1 E;  2VWJ A;  1YTA A;  3PV8 A;  1FK9 A;  1EP4 A;  5CYQ A;  2IOC A;  3PUF A;  5FRN A;  4I2Q A;  1L3U A;  1T03 A;  1NK7 A;  4CIF A;  1ASV A;  4FJ7 A;  4B3O A;  3VN5 A;  3RMB A;  4Q5V A;  2RF2 A;  3TAE A;  4NCA A;  4E7H A;  4Z4E A;  2G8K A;  4OKE A;  2HMI A;  3AVN A;  3LZJ A;  4E19 A;  3AVG A;  3NHG A;  4DG1 A;  1B9F A;  5KRS A;  3OY9 A;  3KLH A;  3SUO A;  4CE9 A;  3VQB A;  4CJK A;  4FM2 A;  4DFM A;  4LD0 A;  3AO4 A;  1RTH A;  1WAF A;  4EP4 A;  1ZYQ A;  3UIQ A;  3FFI A;  2KQ2 A;  1BCO A;  4CEE A;  4BDY A;  3SUN A;  1FXX A;  2JGU A;  3OYE A;  2XY5 A;  3DM2 A;  5I42 A;  1SV5 A;  3HPH A;  1JXB A;  1MU2 A;  1NOY A;  3C94 A;  1UA0 A;  3AVB A;  1TKX A;  2EHG A;  4GW6 A;  4M3R A;  5T7B A;  2W42 A;  1XI1 A;  1QSS A;  2P5O A;  4FJH A;  1EXQ A;  1RT3 A;  4FZZ A;  4KFB A;  4M3U A;  2O4I A;  1TL3 A;  1VSL A;  3MEE A;  3NH0 A;  3K5M A;  3OYJ A;  4C8N A;  1HNV A;  3QIP A;  3SUQ A;  3DLH A;  4K8X A;  5J2N A;  4FZX C;  4EZ9 A;  1BI4 B;  4DF8 A;  3SQ2 A;  1WSI A;  4E3S A;  3OYI A;  4IDK A;  3HST B;  3ULD A;  2ETJ A;  4FYD A;  1C1C A;  4DSJ A;  4BE2 A;  2AJQ A;  4IFY A;  4N76 A;  3ZSV A;  2HND A;  2B4J A;  2ZQB A;  2VWK A;  3MEC A;  1NK8 A;  4CGJ A;  1WN7 A;  4CEC A;  4CHN A;  4ELV A;  3SNN A;  1NK4 A;  3OYK A;  3NF7 A;  3RR8 A;  3C95 A;  4FVM A;  3OJU A;  1HYS A;  4KHQ A;  3MAQ A;  2OZM A;  1JLB A;  3ZT2 A;  4KV8 A;  1EET A;  4CJL A;  1BHL A;  3S3M A;  5C42 A;  2Z1I A;  4W5T A;  1ZBL A;  4CEZ A;  1VSJ A;  1GOC A;  5SZT A;  2VG7 A;  1WSH A;  3DYA A;  1HMV A;  1NKC A;  4RW4 A;  1IH7 A;  1JLG A;  4BWJ A;  3QEW A;  4Y1C A;  3AVK A;  4DSE A;  4N5S A;  4FJG A;  2OPQ A;  2IAJ A;  1C0M A;  1TGO A;  3CYM A;  1CXQ A;  3V9U A;  3ZSO A;  4ZTF A;  1A5V A;  4XIU A;  4DU4 A;  5I3U A;  3SV4 A;  3TAB A;  5HLF A;  2HHV A;  3OYL A;  2VG6 A;  4ID1 A;  2E6L A;  1HJR A;  4MFB A;  4DFP A;  4CFD A;  1JLE A;  5HP1 A;  3TAN A;  1JXE A;  1EKE A;  4CIG A;  3DI6 A;  4UQG A;  3O4N A;  4Q0B A;  1LW0 A;  5DK5 A;  3QES A;  3DRS A;  3MXJ A;  3V4I A;  2FBV A;  1WNS A;  3KK1 A;  3CM6 A;  1LAW A;  1JLF A;  2FBT A;  3ISN C;  3K57 A;  3LP3 A;  3WNF A;  3NF6 A;  1X9M A;  1YT3 A;  5HBM A;  3KLF A;  3OYH A;  3SPZ A;  4CIE A;  1HYV A;  1QS4 A;  3HO1 A;  1KSP A;  1Z25 A;  2D0C A;  4NYF A;  4FZY A;  2FBY A;  4CJE A;  4DTN A;  3M8R A;  1WAJ A;  4C8M A;  4CJW A;  4OLA A;  4KHY A;  3RMD A;  4KB1 A;  2HHW A;  3OS0 A;  3AVL A;  2D0A A;  2X74 A;  4H4O A;  4M45 A;  3ZT4 A;  3U3Y A;  2XRI A;  3AVA A;  4J2E A;  4MQ3 A;  1HNI A;  4CHP A;  4I9L A;  3V81 A;  1JL1 A;  3AVC A;  4NYN A;  4FJM A;  3RTV A;  4F2R A;  4AHV A;  1KFS A;  1WSJ A;  4FW1 A;  4O55 A;  1NK6 A;  2G8W A;  5E41 A;  2Y1J A;  3KLI A;  1B9D A;  3ZT0 A;  2HHT A;  4JLH A;  3OYA A;  3SZ2 A;  1IG9 A;  4GMJ B;  3JSM A;  1UWB A;  3VA3 A;  4Z4G A;  4WE1 A;  4DWI A;  1VRU A;  1ZBF A;  3LZI A;  2YV0 X;  3OYM A;  3SJJ A;  3TAF A;  1BIU A;  3QIO A;  3NDK A;  3ZSX A;  4QCL A;  2RPI A;  3KTQ A;  3VQ5 A;  1C6V A;  1S1W A;  4LSL A;  5EU7 A;  3SV3 A;  2OPR A;  2B5J A;  1L3T A;  1KLM A;  3L3U A;  1RBV A;  3M8P A;  4DTS A;  4ZTJ A;  4AHS A;  2YNF A;  3PX0 A;  2DY4 A;  2HHX A;  4DSI A;  4RW7 A;  2YNI A;  3VQ8 A;  1NK5 A;  1YVU A;  3HVT A;  3DLK A;  1T7P A;  3BDP A;  3QEX A;  1W0H A;  1FKO A;  1WSG A;  4R5P A;  3HT3 A;  3S3N A;  3AA2 A;  3AA3 A;  4CF2 A;  4FJI A;  1I39 A;  4KTZ A;  1D8Y A;  4OVL A;  2YKM A;  4LH4 A;  4B9V A;  1ZBH A;  1KTQ A;  2P1J A;  1SUQ A;  2KFZ A;  4JRP A;  1NJW A;  2DTU A;  4O0I A;  2QXF A;  5K14 A;  4RG8 A;  4W5O A;  3IRX A;  1JKH A;  1JLA A;  4BAC A;  4FLU A;  1RBU A;  3VQA A;  3ALY A;  1LV5 A;  1ZBU A;  1RDC A;  2E6M A;  1QE1 A;  1VSD A;  2Z1G A;  2VG5 A;  5FDL A;  1GOB A;  1IKY A;  4CGH A;  4YFU A;  4N56 A;  3NAE A;  3SI6 A;  1IKW A;  3C6U A;  3TR8 A;  3IAY A;  4DSF A;  2I5J A;  3AA4 A;  2RN2 A;  4FLW A;  1F21 A;  4KRE A;  1VSK A;  3P1G A;  4F3O A;  3QNN A;  4JS4 A;  2WOM A;  4JS5 A;  4CJ5 A;  2A1R A;  4CCH A;  3HP6 A;  3QER A;  4FJX A;  3AVF A;  4G1Q A;  2BGG A;  3AV9 A;  4DQI A;  1A5X A;  1J53 A;  1S1X A;  3T19 A;  3HPO A;  4CK2 A;  4GVM A;  3V6D A;  4CGG A;  1KFD A;  3SPY A;  3HJF A;  1LWC A;  3VQP A;  3TAQ A;  5KI6 A;  4YNQ A;  1TKD A;  3BGR A;  3LP1 A;  4EP5 A;  5KGX A;  1HYZ A;  3WNG A;  5D3G A;  3U6F A;  2KTQ A;  3VQE A;  3KK2 A;  2O4G A;  3RMC A;  1DTT A;  2FBX A;  5CZ1 A;  4DQS A;  4CEO A;  1RT2 A;  3OYD A;  5KTQ A;  2WON A;  3NCI A;  5JS1 A;  3HVR A;  4LSN A;  3KLG A;  3ZSQ A;  1TVR A;  2OPP A;  3AA5 X;  3OYN A;  2RKI A;  2YKN A;  4FCY A;  4E7K A;  3MXI A;  4CEB A;  1TAU A;  4NCB A;  1Q9X A;  4FJ9 A;  4ICL A;  3NGZ A;  3V9S A;  4FJ5 A;  2IC3 A;  4KO0 A;  1RDB A;  4CJU A;  4CGF A;  3VQ7 A;  1TV6 A;  1JL2 A;  1T8E A;  2XY6 A;  1JLC A;  4KAZ A;  5DMR A;  4CER A;  3KD5 E;  1TK5 A;  4E1M A;  1U04 A;  2QKK A;  4E0D A;  2F8T A;  1T05 A;  4F3T A;  5HRR A;  3DRP A;  2QKB A;  1C0T A;  3KKS A;  4FLV A;  4KHN A;  3H08 A;  2FC0 A;  5HRS A;  1C1A A;  4DSK A;  2ZD1 A;  4BDP A;  1DTQ A;  5CY4 A;  4FLT A;  2GBZ A;  4Z4C A;  3AO3 A;  2EX3 A;  4CFB A;  3AVM A;  4OPJ A;  3T3F A;  4E7L A;  1QSY A;  2DFF A;  3C6T A;  3QEP A;  4QOZ B;  1TAQ A;  4HCC A;  2GV9 A;  3A2F A;  4Z4I A;  2OPS A;  4B8C A;  4AHC A;  1X1P A;  2B6A A;  1BQN A;  2G8U A;  2HNZ A;  5C24 A;  3OYB A;  1TL1 A;  1NJX A;  3CFO A;  3LPT A;  2X6S A;  1Y97 A;  3NGY A;  4CF8 A;  5C25 A;  1VSI A;  1S1V A;  3CFR A;  4CJV A;  4HHT A;  1NOZ A;  3HYF A;  4RW6 A;  3AO2 A;  4K8Z A;  1RIL A;  3B6O A;  1S5J A;  1NKE A;  3RR7 A;  4B9S A;  4KI4 A;  4PWD A;  1HRH A;  4KKO A;  4CJ3 A;  4OKK A;  4BE1 A;  4FLX A;  1KVC A;  3G10 A;  1U48 A;  1N6Q A;  1ITG A;  4HUF A;  4DTP A;  2Q3S A;  3V1Q A;  4CEF A;  3SUP A;  4CHY A;  3K5L A;  4DTX A;  2P5G A;  1SL1 A;  4I9Q A;  4KTQ A;  3M8S A;  4ID5 A;  4TSX A;  1C1B A;  4CFC A;  4FK4 A;  2IS3 A;  2LSN A;  3JYT A;  3L2V A;  2KZZ A;  1S1T A;  1BIS A;  3HXM A;  2F8S A;  3E01 A;  5KGW A;  4E89 A;  4DFJ A;  1SL2 A;  4FJ8 A;  4I2P A;  3VQQ A;  3ZSW A;  3I0S A;  3SYZ A;  1R0A A;  4FJL A;  4DMN A;  3AVI A;  4CJ4 A;  1YTU A;  1D5A A;  3WNH A;  2XHB A;  3PX6 A;  4OGC A;  4DLE A;  1X9S A;  2GUI A;  1HQU A;  3PO5 A;  3L2R A;  2BE2 A;  2DFH A;  4FJJ A;  4FW2 A;  1REV A;  3NH1 A;  4KHW A;  4DU1 A;  1WLJ A;  3CG7 A;  3ITH A;  3CQ8 A;  1TK8 A;  4F8R A;  1HPZ A;  4PUO A;  4CHO A;  3SQ0 A;  4PY5 A;  3MED A;  1DLO A;  1W9H A;  2YNG A;  3QNO A;  3QET A;  1SL0 A;  4B9L A;  4E7J A;  3VQ6 A;  1I3A A;  4HUG A;  3EYZ A;  2G8H A;  2XY7 A;  3DMJ A;  3ZCM A;  4B08 A;  3RWU A;  3ZT1 A;  5KRT A;  1QQC A;  3K5O A;  4DTR A;  4O4G A;  3NGI A;  4DTO A;  2OYQ A;  4HCB A;  4CF0 A;  1KRP A;  3PX4 A;  1S9E A;  4CF9 A;  1QTM A;  1U45 A;  1BL3 A;  3RRG A;  1CZ9 A;  3DOK A;  4DSL A;  1LWF A;  1QSL A;  1CXU A;  4ELT A;  4OLB A;  1XC9 A;  3LWM A;  1LWE A;  4IBN A;  4DU3 A;  3DRR A;  1QHT A;  3S9H A;  4CK3 A;  1RBT A;  1UA1 A;  2HVH A;  4AHU A;  3HP9 A;  5CYM A;  1VSH A;  3TAP A;  4M3Y A;  4KPY A;  1EX4 A;  2G8F A;  3LWL A;  4I7F A;  3NF8 A;  1J5O A;  3IG1 A;  1IKV A;  4M42 A;  3OYG A;  1VRT A;  4DTM A;  2PYL A;  3LP0 A;  3SCX A;  1RNH A;  3TI0 A;  4F2S A;  4Z0U A;  3HM9 A;  4ELU A;  3M8Q A;  3TAR A;  4M41 A;  3AO5 A;  3CM5 A;  1BQM A;  3RMA A;  4IG3 A;  3NBP A;  4AHT A;  1VK0 A;  3L3V A;  3QLH A;  3VQC A;  4FLZ A;  4O44 A;  1SKR A;  3KIO A;  1RT6 A;  1UOC A;  3NH2 A;  2IDO A;  1X9W A;  2HHQ A;  3D45 A;  2JLE A;  3LDS A;  2KZM A;  4CK1 A;  4LH5 A;  3VQD A;  4CJR A;  4CHZ A;  3OS2 A;  3TWH A;  4CJQ A;  3ZSZ A;  4AH9 A;  1NJZ A;  4EZ6 A;  3G0Z A;  3SQ1 A;  4J2D A;  4KHS A;  3KLE A;  2XO7 A;  3DLB A;  4M3Z A;  1RBS A;  4ZHR A;  4AHR A;  1LAV A;  4RW8 A;  4B9T A;  5FRM A;  1JLQ A;  1ZBI A;  2OA8 A;  4HVJ A;  4CJS A;  1L3V A;  1S1U A;  4M3X A;  1NJY A;  1CZB A;  1N5Y A;  2F96 A;  1J54 A;  3VQ9 A;  4FM0 A;  4HTU A;  2IGI A;  3V1O A;  4DLG A;  3OVN A;  3L2W A;  4CEA A;  4CGI A;  3K2P A;  1Q8I A;  4RW9 A;  3ZSY A;  1RT4 A;  5HRN A;  3D0P A;  3NE6 A;  1KVA A;  2Z1H A;  4QAG A;  4LY7 A;  3L2U A;  3QEV A;  3KKR A;  3QEI A;  4B9M A;  4DQQ A;  1U47 A;  3MEG A;  3KJV A;  4J2B A;  2D0B A;  2HHS A;  3T1A A;  3K59 A;  3V9W A;  1SKS A;  1RT1 A;  1TKT A;  4O5B A;  1RBR A;  3K58 A;  3P83 D;  1KCF A;  2QK9 A;  1WSE A;  1ASU A;  3MXM A;  4CED A;  4DS5 A;  2PZS A;  1RT7 A;  2YHB A;  4CES A;  1KVB A;  3DLG A;  3LAN A;  1GOA A;  1WSF A;  3TAG A;  1D9D A;  2E4L A;  4DTU A;  1RT5 A;  4HUE A;  4CF1 A;  2HHU A;  3L8B A;  1O1W A;  3DLR A;  5J1E A;  1L3S A;  4BDZ A;  4B9N A;  3AVJ A;  2A1S A;  3ASM A;  3LAM A;  4E1N A;  4OJR A;  3L2Q A;  1XHZ A;  3WNE A;  4H4M A;  4KRF A;  4BWM A; 
#chains in the Genus database with same CATH topology
 2G8I A;  1NBW A;  4FLY A;  1NK0 A;  2QKK A;  4DKW A;  1RTI A;  3OYF A;  5GAG P;  1QVG M;  1BGX T;  2NRW A;  1A5W A;  5M1K A;  3CPW M;  1G15 A;  2Q0U A;  4GNI A;  1BIZ A;  3CCV N;  4DR1 K;  3THV A;  2HHH K;  3J81 O;  1FKP A;  3V9Z A;  3J8A A;  4KHU A;  1B92 A;  3MN5 A;  1IKX A;  4IG0 A;  4DS4 A;  1OH6 A;  4FJK A;  4IKF A;  3JXU A;  4BVO A;  4CFA A;  5J2Q A;  3NF9 A;  1T44 A;  4L8R B;  4H8K A;  3FR0 A;  4FJN A;  2QA4 N;  4YOY A;  5SWM A;  5JVH L;  2E2P A;  2NRT A;  2QWN A;  2HVI A;  2ZE2 A;  4DQP A;  3OYC A;  1QQN A;  4BR9 A;  4CJF A;  1SKW A;  3K9J A;  2Q97 A;  4X66 K;  4LF5 K;  4FXD A;  2HF4 A;  3F73 A;  3IKM A;  1D9F A;  4JK9 A;  3WXI A;  5HRP A;  5J2P A;  2PYJ A;  2O8D B;  4WQ5 C;  4DQR A;  4CBW A;  2PY5 A;  3I56 N;  4PQU A;  4J2A A;  3B6P A;  4LF4 K;  4XH5 A;  1Q81 O;  4N47 A;  3CI5 A;  1Z26 A;  2Z1J A;  3ZYY X;  4FK2 A;  1VSM A;  3CJ7 A;  2W40 A;  4QS8 A;  3VQ4 A;  1S6Q A;  1CLQ A;  2OZS A;  1JCE A;  1Q9Y A;  4W5Q A;  2ITG A;  4IFV A;  3ZLJ A;  3DOL A;  3KD1 E;  2ATQ A;  1YIJ N;  3MCP A;  5FRN A;  1L3U A;  1NK7 A;  1QHA A;  4YOT A;  3TAE A;  2FSN A;  3TSU A;  1B9F A;  5KRS A;  3O1W A;  2GEM A;  3SBG A;  2ZJQ L;  3NMU A;  2QEX N;  3FFI A;  3NVM A;  1BCO A;  3THX B;  1H1V A;  1MU2 A;  2P5O A;  1TKX A;  4FJH A;  1U6Z A;  2O4I A;  3ZEU B;  1VSL A;  4JI0 K;  3MEE A;  3UB5 A;  3SUQ A;  1YF5 L;  1YXQ A;  4DF8 A;  1WSI A;  3ENO A;  4E3S A;  2WFB A;  3HST B;  1C1C A;  3MEC A;  1NK8 A;  4CBU A;  2WBN A;  1NK4 A;  4FOE A;  4ILG B;  3NF7 A;  4BRG A;  5AZJ B;  3KWI A;  3LM2 A;  3C95 A;  3LDO A;  4ISG A;  4KHQ A;  3MAQ A;  1HX1 A;  2BH1 A;  4CEZ A;  3DYA A;  3UKU A;  4X65 K;  3O4W A;  4WCE L;  1TYQ A;  5AQV A;  1TGO A;  1YIT N;  3GG4 A;  3CMA N;  4ZTF A;  3SV4 A;  2HHV A;  2IVP A;  1HJR A;  4DV2 K;  4UQG A;  3VEX A;  5DK5 A;  3DRS A;  2O8E A;  1IJJ A;  5DM6 L;  3KK1 A;  1LAW A;  1JLF A;  2FBT A;  3LP3 A;  3WNF A;  1X9M A;  1YT3 A;  5HBM A;  3SPZ A;  3OYH A;  3UE5 A;  1RDU A;  1KSP A;  1GLJ O;  4IOA L;  3KVG A;  4DTN A;  3FFK B;  4KHY A;  2V51 B;  5CE3 A;  4J8F A;  3U3Y A;  2A5X A;  4J2E A;  3H1Q A;  2ZJR L;  2ASP A;  2Q36 A;  4FW1 A;  2P9I B;  3CC4 N;  1B9D A;  1N32 K;  4JLH A;  3JSM A;  1UWB A;  3VA3 A;  4DWI A;  2GTD A;  1HNW K;  1ZBF A;  4FOI A;  5C15 A;  3TAF A;  3NDK A;  3IMX A;  2RPI A;  2EWS A;  1K9M O;  2ASO A;  4LF7 K;  3R8E A;  1L3T A;  4X62 K;  3L3U A;  1Z05 A;  3M8P A;  4AHS A;  2DY4 A;  1NGI A;  4KH6 A;  1XMQ K;  2RE2 A;  1NMN A;  4JKD A;  1YVU A;  3DLK A;  3FZM A;  3AGK A;  1W0H A;  4R5P A;  3HT3 A;  3S3N A;  4CF2 A;  4KTZ A;  3TTC A;  4OVL A;  3SK3 A;  2YKM A;  4LH4 A;  4B9V A;  1KTQ A;  4JRP A;  1NJW A;  4O0I A;  5K14 A;  2NRV A;  3IRX A;  4IOX A;  4CZK A;  4YOX A;  4FLU A;  1MA9 B;  4CZM A;  1VSD A;  2YCH A;  4CGH A;  4YFU A;  3NAE A;  3CCQ N;  2HBL A;  3SI6 A;  3TR8 A;  3IAY A;  2UXB K;  2RN2 A;  4FLW A;  2A1R A;  2I7P A;  3HP6 A;  3AVF A;  4G1Q A;  4YOV A;  4E1J A;  4CVN E;  2PAV A;  3VGL A;  3HPO A;  1LWC A;  4IXC A;  4QS9 A;  4A62 A;  2A41 A;  3BGR A;  3LP1 A;  3UKR B;  5TKW A;  3WNG A;  4FPB A;  4CZL A;  3VQE A;  2KTQ A;  3KK2 A;  3RMC A;  1K8K A;  1T6D A;  2D0O A;  3KLG A;  5JS1 A;  3AA5 X;  2RKI A;  2YKN A;  3G25 A;  4DR3 K;  5ELZ A;  1EWR A;  4H0X B;  2BUP A;  4LF9 K;  1RDB A;  3BEX A;  1TV6 A;  4FWR A;  3TU5 A;  3VGK A;  4CER A;  1TK5 A;  3O1B A;  4PKG A;  4E0D A;  3DXK A;  3ULE B;  2FSJ A;  2F8T A;  3HRG A;  4CBX A;  2QKB A;  1C0T A;  4FLV A;  1W97 L;  4AM7 A;  4Z4C A;  3OHR A;  4E7L A;  2DFF A;  2P9L B;  4QOZ B;  2GV9 A;  4WQ4 A;  4B8C A;  2B6A A;  2HNZ A;  1N8R O;  5C24 A;  1NJX A;  3SMS A;  4AM6 A;  2X6S A;  1Y97 A;  4CF8 A;  3CCL N;  1VSI A;  1XMO K;  4RW6 A;  4KI4 A;  1RIL A;  1WOQ A;  1S5J A;  3B6O A;  4B9S A;  1QVF M;  3ZET A;  1KVC A;  1N6Q A;  1U48 A;  1OH5 A;  1ITG A;  2HBM A;  4RCH A;  5AQH A;  3THW A;  4CHY A;  4DTX A;  3G71 N;  2O8F A;  2NZT A;  1NGB A;  2HBJ A;  1GLD G;  2CH6 A;  1SL2 A;  4L3Q A;  4FJ8 A;  4I2P A;  2FXU A;  3VQQ A;  1R0A A;  3I0S A;  4XH4 A;  3WNH A;  2GUI A;  3PO5 A;  1REV A;  5C12 A;  3P4I A;  3CG7 A;  1TK8 A;  5GIN A;  4PUO A;  1HPZ A;  4NB4 A;  4CHO A;  3THY B;  4NXM K;  2YNG A;  1W9H A;  3QNO A;  1SL0 A;  1I3A A;  3F5T A;  2XY7 A;  1HKG A;  2HMP A;  3CQY A;  5AQL A;  5C2D A;  3ZT1 A;  3P31 A;  3FZK A;  2UUA K;  2VQF K;  3NGI A;  1M90 O;  1KRP A;  1QTM A;  3QML A;  5AQZ A;  4CD3 A;  3RSE B;  4DU3 A;  2UU9 K;  3DRR A;  1QHT A;  3CXC M;  3CJA A;  3AAR A;  4B3T K;  4BRC A;  1IKV A;  1VRT A;  3TI0 A;  3HI0 A;  3TAR A;  3AO5 A;  1BQM A;  4JKG B;  3L3V A;  3O5B A;  3KIO A;  1RT6 A;  2YHY A;  1X9W A;  2JLE A;  1VQN N;  4LH5 A;  3VQD A;  1NJZ A;  2YI1 A;  4FWK A;  3SQ1 A;  3EZW A;  3W3D A;  1RBS A;  1LAV A;  1SQK A;  4RW8 A;  4B9T A;  1JLQ A;  3CET A;  3EO3 A;  4CJS A;  1L3V A;  1NJY A;  1N5Y A;  3IDH A;  4PL8 A;  4HTU A;  3VTH A;  2IGI A;  4WQ5 A;  1Q18 A;  4XH1 A;  3VER A;  1TUU A;  3ZSY A;  1KVA A;  3L2U A;  2HF3 A;  1U47 A;  1DKG D;  1VQK N;  2D0B A;  3T1A A;  4FO0 A;  4LC9 B;  1BUP A;  4IZ9 A;  4BQL A;  1GLC G;  1RBR A;  4JKF A;  4AF1 A;  2E2N A;  1GOA A;  1WSF A;  2P9S A;  5KPR A;  2E4L A;  4DTU A;  4HUE A;  1O1W A;  3DLR A;  5LMU K;  4BDZ A;  4B9N A;  5A2Q O;  1BO5 O;  4OJR A;  1VQ4 N;  4F9O A;  3R3L A;  3RVC A;  3AVH A;  5JS2 A;  3LAL A;  4Z4H A;  2X6N A;  2E88 A;  3VGM A;  4WFA L;  3QO9 A;  4B9U A;  1ASW A;  1HQE A;  3ZT3 A;  4DV5 K;  4OGE A;  4N41 A;  2UXD K;  3A8Y A;  2HB5 A;  2O8C B;  2BAN A;  1S6P A;  5BPM A;  3TTF A;  3OJS A;  1ZXO A;  4C8O A;  3HK2 A;  1K6Y A;  1NM1 A;  3U3G A;  1VSE A;  4X64 K;  4BE0 A;  5FRO A;  3O3G A;  3I33 A;  3PSF A;  3SQ4 A;  3LP2 A;  4WFB L;  4W5R A;  4E7I A;  4I6M B;  1O13 A;  3DLE A;  1C0U A;  1GLB G;  4MDB A;  2R7Y A;  1S9G A;  2Q31 A;  3F9K A;  1XHX A;  3HL8 A;  4B1U B;  5JMV A;  3KK3 A;  3EEQ A;  4PA1 A;  3ID8 A;  4FWQ A;  2F7T A;  1OVY A;  4Z4F A;  1YAG A;  3ATV A;  3VPZ A;  3WXJ A;  4A59 A;  1U4B A;  3K5N A;  4IFE A;  1Z6R A;  3M3Z A;  2G8V A;  3EL2 A;  2FF3 B;  2X78 A;  3J7Y P;  3L0Q A;  4FK0 A;  2KW4 A;  1VSF A;  3TPQ A;  1G99 A;  4H5R A;  3QIN A;  1P8Z A;  3ZSR A;  4JI6 K;  2DFE A;  2XY8 A;  5AFU A;  3O3F A;  4JI1 K;  4AIL C;  2VCP A;  1TUY A;  2HW3 A;  4DFK A;  1VQL N;  2VWJ A;  1EP4 A;  2QTD A;  4B1X B;  5JLF A;  4DR2 K;  1OH8 A;  1ASV A;  1ATR A;  1GLE G;  4C1N K;  2CGJ A;  1MWM A;  4DUY K;  4BG8 A;  4Q5V A;  1BA0 A;  3OBW A;  4BRL A;  4E7H A;  4Z4E A;  5B8H A;  3NHG A;  3DAW A;  3CIP A;  5F1X A;  4DFM A;  3CME N;  1Q86 O;  4IEE A;  3CCJ N;  1E4G T;  4FWM A;  2QWR A;  5ADX H;  3E9O A;  4BDY A;  1FXX A;  3SUN A;  3OYE A;  5C10 A;  1SV5 A;  3HPH A;  4AQY K;  1JXB A;  4MO4 A;  3I8B A;  3C94 A;  5EX5 A;  3AVB A;  5BR8 K;  2EHG A;  4M3R A;  2W42 A;  1NOY A;  4EFH A;  5AQJ A;  5GIO A;  1QQO A;  2CGK A;  3WXK A;  4C8N A;  1HNV A;  3QIP A;  3DLH A;  3T69 A;  4EZ9 A;  4PL7 A;  1SZ2 A;  3VMF B;  3SQ2 A;  3DJC A;  3OYI A;  3ULD A;  3IFR A;  3VEO A;  1QZ6 A;  4FYD A;  2AJQ A;  4JHD A;  2FLO A;  4BRD A;  2B4J A;  3EE8 A;  4ELV A;  1N36 K;  3M1F A;  3MK6 A;  4CJL A;  5MLC Q;  4BG9 A;  3LM9 A;  1WSH A;  3ATU A;  1IH7 A;  1JLG A;  4Y1C A;  3E9L A;  4JKC A;  3V9U A;  3VEY A;  1W2B M;  2JWK A;  5HLF A;  3OYL A;  2VG6 A;  4ID1 A;  4DFP A;  4MFB A;  4BQZ A;  4BVP A;  3TAN A;  1JXE A;  4CIG A;  1ESV A;  3DI6 A;  4LFC K;  4Q0B A;  4FSV A;  5FLX O;  1OVQ A;  2YJE A;  3MX2 A;  3ISN C;  4A5B A;  3VES A;  4JI2 K;  3NF6 A;  1BU6 O;  3KLF A;  4CIE A;  1HYV A;  3HO1 A;  1NGE A;  1Z25 A;  1KAY A;  2D0C A;  4NYF A;  4FZY A;  3M8R A;  1WAJ A;  4GVE A;  3RMD A;  3HOT A;  3OS0 A;  2X74 A;  1ILY A;  5LJV A;  5KPT A;  3EE9 A;  4IWV A;  1WSJ A;  1NK6 A;  3KLI A;  3ZT0 A;  3UKU B;  2HHT A;  5TKY A;  3OYA A;  3SZ2 A;  4GMJ B;  3Q7C A;  4EHT A;  3K9K A;  1TYQ B;  4BRO A;  2NNW A;  3T1H K;  4MDA A;  3OYM A;  3VEW A;  3SJJ A;  3VOV A;  3QIO A;  4QCL A;  3VQ5 A;  1FW6 A;  4MLE A;  2OPR A;  2B5J A;  2QM1 A;  3WQU A;  3O9Q A;  1KLM A;  2P9U A;  2O8E B;  2VGM A;  4ZTJ A;  2HHX A;  4DSI A;  3HVT A;  1KXP A;  2UYT A;  3FZF A;  1T7P A;  3BDP A;  4K25 A;  4K41 A;  1WSG A;  1VQP N;  2FSK A;  4IOC L;  3EKU A;  4YY3 K;  2IVN A;  1D4X A;  2VGN A;  2DTU A;  4IDH A;  5KQD A;  5BPL A;  3H45 C;  2QWQ A;  4A5A A;  1JKH A;  4BAC A;  1RBU A;  4CJ7 A;  4BR0 A;  1RGI A;  3Q7B A;  2ZJP L;  3P38 A;  4CW7 B;  3JAM O;  1IKW A;  3M5R A;  4DSF A;  4A2B A;  5BN8 A;  3H6E A;  4CZF A;  3QNN A;  4JS4 A;  2BTF A;  2BGG A;  3QFP A;  4O5F A;  4BR2 A;  4G9Z A;  1A5X A;  1S1X A;  3T19 A;  3ID6 A;  4CK2 A;  4GVM A;  1XNQ K;  5KI6 A;  4YNQ A;  1TKD A;  2P9K A;  4WFN L;  5KGX A;  3CCM N;  4BGA A;  5AQY A;  4DQS A;  1RT2 A;  3OYD A;  2WON A;  3HVR A;  4LSN A;  4FWO A;  2OPP A;  3ZSQ A;  3OYN A;  3MXI A;  3LDL A;  4E7K A;  4CEB A;  4BRE A;  4FJ9 A;  4ICL A;  5EVZ A;  3V9S A;  2ZGY A;  4CGF A;  3CCE N;  1JLC A;  1JJ2 M;  4CD1 A;  5DMR A;  2YHX A;  1EWQ A;  1T05 A;  5HRR A;  3KKS A;  4KHN A;  1J6Z A;  3O6W A;  2FC0 A;  1IBL K;  5AZI A;  2GEL A;  1DTQ A;  3T1Y K;  2GBZ A;  1XQS C;  3AVM A;  2FF6 A;  2QWP A;  4BR4 A;  3D2F A;  3QEP A;  2E20 A;  4YOR A;  2O8B A;  3A2F A;  2OPS A;  4AHC A;  1X1P A;  2V7Z A;  3OYB A;  4B9L A;  5BRF A;  4B3S K;  1S1V A;  1V4S A;  2QWL A;  1NOZ A;  4M7Y A;  4K8Z A;  1K8K B;  2QW9 A;  3O8M A;  1HRH A;  4OKK A;  4FLX A;  4FWL A;  3U9D A;  3G10 A;  2A6A A;  3SUP A;  3U9Z A;  1SL1 A;  4KTQ A;  1C1B A;  3N4P A;  1EO1 A;  3DXK B;  4CZE A;  3CCR N;  3E01 A;  4LF8 K;  2WUS A;  5KGW A;  5CR4 A;  2XHB A;  3PX6 A;  1X9S A;  1HQU A;  2KHO A;  1NGH A;  2DFH A;  1WLJ A;  4F8R A;  3SQ0 A;  5BRH A;  5AQR A;  4ILH A;  4H0O A;  3VQ6 A;  2CH5 A;  4HUG A;  3EYZ A;  4B08 A;  4DB3 A;  3CC2 N;  3CQX A;  3K5O A;  4O4G A;  3ZET B;  4CF0 A;  4JD2 A;  5LY3 A;  5IT9 O;  4JKH A;  5H1S Q;  3DOK A;  3THW B;  4OLB A;  1XC9 A;  3LWM A;  4IBN A;  3S9H A;  2O8F B;  3TAP A;  1VSH A;  2YHW A;  4KPY A;  1EX4 A;  4I7F A;  4YDU C;  2W41 A;  3IG1 A;  1E3M A;  3L4I A;  4DR4 K;  2PYL A;  3SCX A;  1RNH A;  4Z0U A;  3MN7 A;  1RDW X;  3CM5 A;  1NG9 A;  1VK0 A;  3VQC A;  4Z94 A;  1UOC A;  3NH2 A;  2HHQ A;  3D45 A;  3LDS A;  3TWH A;  4CHZ A;  4KHS A;  4AH9 A;  2UUC K;  3KLE A;  2XO7 A;  4HWI A;  5FRM A;  3BZC A;  4IO8 A;  5GAH P;  2OA8 A;  1CZB A;  3E1Y A;  3V1O A;  4LFA K;  3DWL A;  4CEA A;  1VQ5 N;  2P9N A;  5FPE A;  1RT4 A;  5HRN A;  3D0P A;  2Z1H A;  4LY7 A;  2QWM A;  3KJV A;  4CZH A;  3FZH A;  1SKS A;  3GBT A;  2HBK A;  3P83 D;  2QK9 A;  1ASU A;  3HSC A;  4DS5 A;  1XC3 A;  1RT7 A;  2YHB A;  4CES A;  1YVN A;  2ITM A;  4H5W A;  3QBX A;  4NO7 A;  2HHU A;  3L8B A;  4H5V A;  5J1E A;  1L3S A;  3DLL L;  2A1S A;  1XHZ A;  3WNE A;  4BRI A;  4KRF A;  3M6G A;  1NKC A;  5FPN A;  3R1X A;  1IO2 A;  3EZ5 A;  3SMP A;  4DCH A;  3MMV A;  3D2E A;  3O9R A;  3HBT A;  4JI7 K;  4FVU A;  4W5N A;  2YHA A;  2VQE K;  4DR5 K;  3S3O A;  4JN4 A;  1BCM A;  3HPG A;  1SAZ A;  2Q2R A;  4M3W A;  1RFQ A;  2D4W A;  3FZL A;  2A42 A;  5AQQ A;  3P39 A;  3A0I X;  4Y1D A;  3GDQ A;  3L6Q A;  1U49 A;  1U2V A;  3TAM A;  3P5J A;  2P9S B;  1EQY A;  1R59 O;  4JKB A;  1RTD A;  3L4Q A;  4DTJ A;  5HRO A;  1NU0 A;  5CHI A;  3V1R A;  1NKB A;  3PO4 A;  4GV3 A;  5CZ2 A;  3ZX3 A;  4C8K A;  4M3T A;  3LAK A;  3CER A;  5BPN A;  5KPZ A;  1XUP O;  4O8U A;  3G4S N;  3MCA B;  1BA1 A;  3RRH A;  1ZC6 A;  4CEQ A;  1VQM N;  4KH4 A;  3CFP A;  4FWS A;  1C0F A;  4JRQ A;  1J5E K;  1S3X A;  3C6H A;  3OTO K;  3CCS N;  3ZX0 A;  4CJP A;  3OS1 A;  3I0R A;  3I8D A;  4KTW A;  4F4K A;  4KBO A;  3ZX2 A;  2KFN A;  5J2M A;  1RTJ A;  4KB0 A;  4JNE A;  3O80 A;  4CHQ A;  1BI4 A;  3EY1 A;  1LW2 A;  4M7X A;  3PV8 A;  5JLH A;  1HLU A;  4JV5 K;  4I2Q A;  1CZA N;  2E1Z A;  4EIA A;  3AAQ A;  4FJ7 A;  3ENH A;  2RF2 A;  4NCA A;  2G8K A;  4OKE A;  3AVN A;  4E19 A;  1X3M A;  3AVG A;  3CJC A;  4DG1 A;  1C0G A;  2E1Y A;  3KLH A;  3SUO A;  4CE9 A;  3AO4 A;  1WAF A;  1FJG K;  4EP4 A;  1ZYQ A;  1VQ8 N;  2JWL A;  4CEE A;  3WXM B;  4BRK A;  1NMD A;  2JGU A;  3DM2 A;  4BGB A;  5M1Q A;  1UA0 A;  1K73 O;  3G6E N;  4FZZ A;  2PFU A;  1WBB A;  2DPN A;  4M3U A;  3BY5 A;  4B3M K;  3K5M A;  3OYJ A;  4K8X A;  5J2N A;  4FZX C;  1HNX K;  4H0V B;  4IDK A;  1IG8 A;  2ETJ A;  4DSJ A;  3A5M C;  3BUZ B;  2ZQB A;  3SNN A;  3OYK A;  3RR8 A;  1QZ5 A;  3F9M A;  2OTL N;  2OZM A;  4KV8 A;  1EET A;  2P9P A;  3S3M A;  2Z1I A;  4W5T A;  1ZBL A;  1VSJ A;  5SZT A;  4RW4 A;  4BWJ A;  3QEW A;  1I94 K;  3AVK A;  4FJG A;  3CYM A;  1CXQ A;  3ZSO A;  5AJ3 K;  4XIU A;  4DU4 A;  3E66 A;  3TAB A;  4DR7 K;  2E6L A;  1KD1 O;  1BOT O;  4CFD A;  4BRM A;  1EKE A;  4BRH A;  3V4I A;  3MXJ A;  4DV1 K;  2FBV A;  1WNS A;  4JHD B;  3K57 A;  1MWK A;  1YI2 N;  1QS4 A;  3O9U A;  4C1N I;  1VAZ A;  2FBY A;  4CJE A;  1OKJ A;  4WF9 L;  4CJW A;  1HPM A;  4KB1 A;  2HHW A;  3AVL A;  4M45 A;  3AGR A;  2XRI A;  3AVA A;  4MQ3 A;  1HNI A;  4CHP A;  3V81 A;  1JL1 A;  3AVC A;  4NYN A;  4H5N A;  4BC3 A;  4DR6 K;  4H03 B;  5E41 A;  2Y1J A;  1HJO A;  1IG9 A;  5AQX A;  1VQ7 N;  3AAP A;  3LZI A;  3EKS A;  4LSL A;  3SV3 A;  2Q1N A;  4GY2 B;  2CGL A;  5EOY A;  4R79 A;  2YNF A;  3PX0 A;  2F4V K;  3F2K A;  4RW7 A;  1HKC A;  4H0Y B;  3QEX A;  1FKO A;  3AA2 A;  3AA3 A;  1D8Y A;  3QDK A;  3WUH A;  1ZBH A;  3VEV A;  3J80 O;  1VQO N;  3CJB A;  2QXF A;  4W5O A;  5AQK A;  1N34 K;  2GX9 A;  1ATS A;  3ALY A;  1LV5 A;  1RDC A;  3C7N B;  3SBT A;  4RTF D;  1IKY A;  4N56 A;  3LL3 A;  5AQG A;  4YHH K;  4A2A A;  4KRE A;  1VSK A;  4BRA A;  4BRF A;  3QER A;  4IJN A;  2P9U B;  4JI8 K;  4DQI A;  1VQ6 N;  4EHU A;  3PLA A;  3SPY A;  5LL6 Z;  3TAQ A;  2RHK A;  2AA4 A;  4EP5 A;  1HYZ A;  1ZBS A;  2OCE A;  2QI2 A;  4JI5 K;  1DTT A;  2FBX A;  3TSQ A;  4EAH D;  4CZJ A;  3NCI A;  3T7Z A;  4DUZ K;  1WUA A;  4JEP A;  4FCY A;  4NCB A;  1Q9X A;  3NGZ A;  3ENB A;  3S41 A;  5M1F A;  4KAZ A;  2XY6 A;  4YDU A;  3WQT A;  3KD5 E;  4E1M A;  4JAX A;  4JI4 K;  4F3T A;  5LMN K;  1HNZ K;  3NVK A;  3H08 A;  1C1A A;  5M1N A;  4DSK A;  5ADX A;  5CY4 A;  4FLT A;  1NJI O;  2EX3 A;  4OPJ A;  3T3F A;  2UUB K;  1QSY A;  1TAQ A;  4HCC A;  4Z4I A;  3D6R A;  2P9K B;  2G8U A;  4KHP K;  2OAN A;  1TL1 A;  2YX6 A;  3A5L C;  3LPT A;  3NGY A;  5C25 A;  3CFR A;  2Q0R A;  4B1Y B;  3HYF A;  3AO2 A;  1NKE A;  4DV0 K;  2KKZ A;  3RR7 A;  4KKO A;  5F2R A;  4DQ8 A;  5BRD A;  3J7Z O;  4XEI A;  3PIP L;  3LDN A;  4I9Q A;  5AQT A;  3M8S A;  4ID5 A;  4TSX A;  4CFC A;  2VYP A;  4FK4 A;  2IS3 A;  4B3R K;  3HXM A;  3C7N A;  3C0B A;  4E89 A;  5JIC A;  5AZI B;  4DV7 K;  4FJL A;  1YTU A;  3EN9 A;  4IJA A;  4DLE A;  3MWT A;  3L2R A;  5BR9 A;  3D2F B;  2O8B B;  1KQS M;  4KHW A;  4DU1 A;  3MED A;  4JK8 A;  1DLO A;  1HUX A;  2YJF A;  4E7J A;  3MX5 A;  2G8H A;  2VWB A;  3WEE A;  4K0K K;  2W6K A;  3C6A A;  3W0L A;  4DTO A;  2OYQ A;  1ATN A;  3PSI A;  1U45 A;  1CZ9 A;  4DSL A;  1LWF A;  5M1O A;  4ELT A;  3K0S A;  1UA1 A;  3HP9 A;  5CYM A;  5C0Y A;  2AP1 A;  5AQU A;  1J5O A;  3TTD A;  4CZG A;  4B9Q A;  4A57 A;  4DTM A;  4M42 A;  3SAF A;  3CHW A;  3HM9 A;  4ELU A;  1XNR K;  4M41 A;  3RMA A;  3DXM A;  4IG3 A;  3NBP A;  4AHT A;  3QLH A;  4FLZ A;  1SKR A;  4BR5 A;  3JS6 A;  2IDO A;  2KZM A;  4CJR A;  4CJQ A;  5HOO A;  4HVJ A;  4M3X A;  2F96 A;  1J54 A;  4FM0 A;  4DLG A;  4JD2 B;  3AY9 A;  1Q8I A;  4RW9 A;  4BDP A;  4CZI A;  3NE6 A;  3QEV A;  1GLA G;  3KKR A;  4B9M A;  4DQQ A;  3MEG A;  4J2B A;  2HHS A;  5AQS A;  1TKT A;  4O5B A;  5GAD P;  4HTL A;  2ZM6 K;  3MN6 A;  1WSE A;  2ZGZ A;  4NXN K;  1KVB A;  1K8A O;  3TAG A;  1D9D A;  1RT5 A;  4RWT A;  4CF1 A;  4NLB A;  3AVJ A;  3BF3 A;  2QXL A;  3ASM A;  3LAM A;  4E1N A;  5AQP A;  3VET A;  1NGC A;  4H4M A;  4BWM A;  1LOT B;  1RCH A;  2YNH A;  2Y1I A;  3BF1 A;  4JYA K;  1OH7 A;  3NFA A;  1UAX A;  1RDA A;  3IUC A;  2D5R A;  2O8D A;  4FM1 A;  4NCG A;  2P9N B;  5AQI A;  1TKZ A;  4A61 A;  2D0P A;  4JKA A;  1KLN A;  1Y64 A;  1JCF A;  4B8A B;  1NK9 A;  3BP8 A;  1YJN N;  3PY8 A;  4DV4 K;  3FGU A;  2BDP A;  1XWL A;  3FE1 A;  5JVG L;  3OA9 A;  4CGD A;  2D1K A;  5AQO A;  4C8L A;  4CJT A;  3U8X A;  3LPU A;  3CPE A;  1NGG A;  4YOW A;  3O3H A;  3GE1 A;  4DF4 A;  2HNY A;  4UY8 O;  4KI6 A;  2NRR A;  2NRZ A;  1RDD A;  3VA0 A;  1YHQ N;  1TK0 A;  4O0J A;  3IS9 A;  1NLV A;  3D2E B;  2A40 A;  3U4L A;  3A5N C;  1T3V A;  3THX A;  2NUB A;  3AO1 A;  1IBK K;  1S72 N;  3SAG A;  2E5L K;  1WBD A;  3R9P A;  3O9S A;  3O4Q A;  3H1V X;  2P51 A;  4OKJ A;  4OPK A;  3ZEU A;  5GIP A;  4O8K A;  1U2V B;  5AQW A;  3TSP A;  4DV3 K;  1L5U A;  2F9W A;  3V9X A;  3C65 A;  3HZ6 A;  1J9A A;  3WXL A;  1YTA A;  1FK9 A;  5CYQ A;  1KC8 O;  2IOC A;  4OO1 J;  3PUF A;  3CF5 L;  1NWK A;  1T03 A;  4CIF A;  4B3O A;  3VN5 A;  3RMB A;  5AZJ A;  1JCG A;  2HMI A;  3LZJ A;  4FPA A;  2GWK A;  3MN9 A;  3OY9 A;  5KQ8 A;  3VQB A;  4CJK A;  2V52 B;  4FM2 A;  4LD0 A;  1RTH A;  3VTI A;  3UIQ A;  2KQ2 A;  2XY5 A;  5I42 A;  2ASM A;  3HTV A;  4GW6 A;  5T7B A;  1QSS A;  1DT9 A;  3HM8 A;  1XI1 A;  1EXQ A;  4FWP A;  1RT3 A;  4KFB A;  1TL3 A;  3NH0 A;  5AQM A;  4M63 C;  1Q82 O;  1BI4 B;  1SS6 A;  1BG3 A;  2HOE A;  1NGD A;  4BE2 A;  4IFY A;  4N76 A;  3ZSV A;  2HND A;  4BY9 C;  2VWK A;  4CGJ A;  4MO5 A;  1WN7 A;  4CEC A;  4CHN A;  5DM7 L;  4FVM A;  3OJU A;  1HYS A;  4OX9 K;  3BZK A;  1JLB A;  3ZT2 A;  1BHL A;  1BDG A;  5C42 A;  3CJ1 A;  4IO9 L;  4V19 S;  1GOC A;  2VG7 A;  2P9I A;  2GWJ A;  1HMV A;  4ISF A;  4B1Z A;  4DSE A;  4N5S A;  5HL7 L;  2OPQ A;  2IAJ A;  1C0M A;  2HST A;  3OW2 M;  1A5V A;  5I3U A;  2W6L A;  2GUP A;  1JLE A;  5HP1 A;  2NLX A;  3J7A P;  4BRN A;  3O4N A;  1LW0 A;  3QES A;  5BN9 A;  3O08 A;  3CM6 A;  5E26 A;  3WT0 A;  3I55 N;  1W7A A;  1NNE A;  4C8M A;  4OLA A;  3LDQ A;  4H4O A;  2D0A A;  4BC4 A;  3H3O B;  2A3Z A;  3ZT4 A;  4I9L A;  2P9P B;  4FJM A;  3RTV A;  4F2R A;  4AHV A;  4NLC A;  1KFS A;  4K42 A;  4O55 A;  4Y0W A;  3VEN A;  2G8W A;  4BC2 A;  4GKJ K;  4Z4G A;  4WE1 A;  1VRU A;  2YV0 X;  4OPA A;  1BIU A;  3H3N O;  3ZSX A;  3KTQ A;  1C6V A;  1S1W A;  5EU7 A;  5AR0 A;  4PKH A;  1RBV A;  4DTS A;  3QBW A;  3LDP A;  2YNI A;  3VQ8 A;  1NK5 A;  3UKR A;  5AQF A;  4WYB A;  4FJI A;  1I39 A;  2E2Q A;  4ILJ A;  2P1J A;  4FWN A;  1SUQ A;  2KFZ A;  5E84 A;  4FL9 A;  3CC7 N;  4RG8 A;  5I9E B;  1JLA A;  3VQA A;  1DGK N;  3PIO L;  1ZBU A;  2E6M A;  1QE1 A;  4GV6 A;  2Z1G A;  2VG5 A;  5FDL A;  1GOB A;  5EY4 A;  3C6U A;  3ULE A;  1NGA A;  4PHT X;  1IV0 A;  2I5J A;  3AA4 A;  1F21 A;  3P1G A;  4F3O A;  3GL1 A;  2WOM A;  4JS5 A;  4CJ5 A;  4CCH A;  4FJX A;  3AV9 A;  1X9J A;  1J53 A;  3V6D A;  4CGG A;  1KFD A;  1T6C A;  2P9L A;  3HJF A;  1VHX A;  3VQP A;  1QQM A;  3SLC A;  5D3G A;  3U6F A;  1M1K O;  4H0P A;  5FPD A;  2O4G A;  1NGF A;  5CZ1 A;  4CEO A;  3OBY A;  1IBM K;  1YJ9 N;  5KTQ A;  3CJ9 A;  4C23 A;  3QB0 A;  1TVR A;  3R6M A;  4BR7 A;  1TAU A;  5F0X A;  4FJ5 A;  2IC3 A;  4KO0 A;  3SAH A;  4CJU A;  4H0T B;  3VQ7 A;  1JL2 A;  3GOI A;  1T8E A;  1X3N A;  1HR0 K;  1U04 A;  2NRH A;  3DRP A;  5HRS A;  3HOS A;  2OTJ N;  4QS7 A;  2ZD1 A;  3B8A X;  3SJH A;  3AO3 A;  4H5T A;  4CFB A;  3CCU N;  2UXC K;  4PKI A;  3C6T A;  2QWO A;  1LCU A;  4JK7 A;  4U7B A;  1BQN A;  3THY A;  3MDQ A;  3CFO A;  5LJW A;  4HHT A;  2ZWH A;  4LFB K;  4CJV A;  1Q7Y O;  4PWD A;  1DEJ A;  2J4R A;  1P90 A;  5GAE P;  4CJ3 A;  4BE1 A;  3VF4 A;  4B1V A;  4CI6 A;  4LF6 K;  4YOU A;  4HUF A;  4DTP A;  3QFU A;  1KAZ A;  2Q3S A;  5AFU H;  3V1Q A;  4CEF A;  3K5L A;  3VF6 A;  3RSE A;  2P5G A;  4JI3 K;  1KAX A;  2LSN A;  5FPM A;  3L2V A;  3JYT A;  1S1T A;  1BIS A;  2F8S A;  2KZZ A;  2E8A A;  2H3G X;  4DFJ A;  4BC5 A;  3KZB A;  3ZSW A;  3SYZ A;  4DMN A;  3AVI A;  4CJ4 A;  1N33 K;  1D5A A;  4OPH A;  4OGC A;  2F9T A;  1BWF O;  4JKG A;  2BE2 A;  4FJJ A;  4FW2 A;  3NH1 A;  5IWA K;  3ITH A;  3CQ8 A;  4PY5 A;  3QET A;  1V4T A;  2V7Y A;  3DMJ A;  3ZCM A;  3RWU A;  4U67 L;  5KRT A;  1QQC A;  2I7N A;  1NGJ A;  3KWG A;  4DTR A;  4HCB A;  2PBD A;  3PX4 A;  1S9E A;  4CF9 A;  3RRG A;  1BL3 A;  4DV6 K;  1QSL A;  1CXU A;  1LWE A;  4BRQ A;  1E4F T;  5AQN A;  4CK3 A;  1RBT A;  3D7E O;  5BRE A;  2HVH A;  4AHU A;  2WTU A;  4M3Y A;  2G8F A;  3LWL A;  1MDU B;  3NF8 A;  3O9T A;  2IVO A;  3KK7 A;  4IEI A;  3OYG A;  3LP0 A;  4F2S A;  3M8Q A;  3FLC O;  2KLA A;  5EXW A;  3VEZ A;  2WC9 A;  4O44 A;  2ZF5 O;  4CK1 A;  3OS2 A;  4WQ4 C;  3ZSZ A;  4MLH A;  4EZ6 A;  3G0Z A;  4K43 A;  4J2D A;  4M3Z A;  3DLB A;  4ZHR A;  4AHR A;  3WEE B;  2IIR A;  3KHY A;  3E9P A;  1ZBI A;  1S1U A;  1S22 A;  3QIC A;  3VQ9 A;  3H46 O;  1WB9 A;  4DHY A;  3OVN A;  4GKK K;  3L2W A;  4CGI A;  2O8C A;  5C2F A;  3K2P A;  4JKE A;  3VF2 A;  1YJW N;  3CD6 N;  1HKB A;  4QAG A;  4B1W B;  3QEI A;  3K59 A;  3V9W A;  1RT1 A;  3K58 A;  5M1P A;  1KCF A;  3MXM A;  4CED A;  2PZS A;  1GLF O;  3DLG A;  4GV9 A;  3LAN A;  1GLL O;  3MWP A;  4I6M A;  4KH5 A;  3DXM B;  2E2O A;  4ISE A;  3L2Q A;  1YUW A;  4BRP A;  3A5O C;  3N4Q A;  2NRX A;  1VQ9 N; 
#chains in the Genus database with same CATH homology
 2G8I A;  4FLY A;  1RCH A;  2YNH A;  3AVH A;  3LAL A;  5JS2 A;  1RTI A;  4Z4H A;  2X6N A;  3OYF A;  2Y1I A;  1NK0 A;  3NFA A;  1UAX A;  3QO9 A;  1RDA A;  1IO2 A;  1BGX T;  4B9U A;  1ASW A;  1HQE A;  3ZT3 A;  1A5W A;  3EZ5 A;  4OGE A;  4N41 A;  1G15 A;  2D5R A;  2HB5 A;  2BAN A;  1BIZ A;  1S6P A;  3THV A;  4FM1 A;  4NCG A;  3OJS A;  4C8O A;  3HK2 A;  1TKZ A;  1FKP A;  3V9Z A;  4W5N A;  1K6Y A;  2YHA A;  4KHU A;  1B92 A;  1KLN A;  3U3G A;  3S3O A;  1VSE A;  1IKX A;  4IG0 A;  1BCM A;  3HPG A;  4DS4 A;  4B8A B;  1NK9 A;  4FJK A;  4BE0 A;  4M3W A;  5FRO A;  3O3G A;  4IKF A;  3PY8 A;  4CFA A;  4Y1D A;  5J2Q A;  3NF9 A;  3SQ4 A;  2BDP A;  3LP2 A;  1U49 A;  4L8R B;  3TAM A;  3P5J A;  1XWL A;  4H8K A;  4W5R A;  4E7I A;  1RTD A;  3DLE A;  4FJN A;  4DTJ A;  1C0U A;  5SWM A;  5HRO A;  4CGD A;  2R7Y A;  3V1R A;  1NKB A;  1S9G A;  2HVI A;  3PO4 A;  3F9K A;  1XHX A;  3HL8 A;  4CJT A;  2ZE2 A;  4C8L A;  5CZ2 A;  3KK3 A;  4C8K A;  4DQP A;  3OYC A;  4M3T A;  3LPU A;  3LAK A;  4PA1 A;  4CJF A;  3O3H A;  1SKW A;  3RRH A;  4DF4 A;  4FXD A;  2HNY A;  4KI6 A;  1RDD A;  3VA0 A;  4Z4F A;  3F73 A;  4CEQ A;  1D9F A;  1TK0 A;  4O0J A;  1U4B A;  3K5N A;  3CFP A;  2G8V A;  5HRP A;  4JRQ A;  2X78 A;  5J2P A;  2PYJ A;  3IS9 A;  4CJP A;  4DQR A;  2PY5 A;  4PQU A;  4J2A A;  4FK0 A;  3OS1 A;  3B6P A;  3I0R A;  2KW4 A;  3I8D A;  2NUB A;  3AO1 A;  1VSF A;  4KTW A;  4N47 A;  4F4K A;  3QIN A;  1Z26 A;  2Z1J A;  4FK2 A;  1VSM A;  3O4Q A;  2P51 A;  3ZSR A;  3VQ4 A;  1S6Q A;  1CLQ A;  2DFE A;  4OKJ A;  4OPK A;  2OZS A;  2XY8 A;  5J2M A;  2KFN A;  1Q9Y A;  3O3F A;  1RTJ A;  4W5Q A;  4AIL C;  4KB0 A;  2ITG A;  4IFV A;  1L5U A;  4CHQ A;  3V9X A;  2HW3 A;  1BI4 A;  4DFK A;  3DOL A;  3EY1 A;  1LW2 A;  1J9A A;  2ATQ A;  3KD1 E;  2VWJ A;  1YTA A;  3PV8 A;  1FK9 A;  1EP4 A;  5CYQ A;  2IOC A;  3PUF A;  5FRN A;  4I2Q A;  1L3U A;  1T03 A;  1NK7 A;  4CIF A;  1ASV A;  4FJ7 A;  4B3O A;  3VN5 A;  3RMB A;  4Q5V A;  2RF2 A;  3TAE A;  4NCA A;  4E7H A;  4Z4E A;  2G8K A;  4OKE A;  2HMI A;  3AVN A;  3LZJ A;  4E19 A;  3AVG A;  3NHG A;  4DG1 A;  1B9F A;  5KRS A;  3OY9 A;  3KLH A;  3SUO A;  4CE9 A;  3VQB A;  4CJK A;  4FM2 A;  4DFM A;  4LD0 A;  3AO4 A;  1RTH A;  1WAF A;  4EP4 A;  1ZYQ A;  3UIQ A;  3FFI A;  2KQ2 A;  1BCO A;  4CEE A;  4BDY A;  3SUN A;  1FXX A;  2JGU A;  3OYE A;  2XY5 A;  3DM2 A;  5I42 A;  1SV5 A;  3HPH A;  1JXB A;  1MU2 A;  1NOY A;  3C94 A;  1UA0 A;  3AVB A;  1TKX A;  2EHG A;  4GW6 A;  4M3R A;  5T7B A;  2W42 A;  1XI1 A;  1QSS A;  2P5O A;  4FJH A;  1EXQ A;  1RT3 A;  4FZZ A;  4KFB A;  4M3U A;  2O4I A;  1TL3 A;  1VSL A;  3MEE A;  3NH0 A;  3K5M A;  3OYJ A;  4C8N A;  1HNV A;  3QIP A;  3SUQ A;  3DLH A;  4K8X A;  5J2N A;  4FZX C;  4EZ9 A;  1BI4 B;  4DF8 A;  3SQ2 A;  1WSI A;  4E3S A;  3OYI A;  4IDK A;  3HST B;  3ULD A;  2ETJ A;  4FYD A;  1C1C A;  4DSJ A;  4BE2 A;  2AJQ A;  4IFY A;  4N76 A;  3ZSV A;  2HND A;  2B4J A;  2ZQB A;  2VWK A;  3MEC A;  1NK8 A;  4CGJ A;  1WN7 A;  4CEC A;  4CHN A;  4ELV A;  3SNN A;  1NK4 A;  3OYK A;  3NF7 A;  3RR8 A;  3C95 A;  4FVM A;  3OJU A;  1HYS A;  4KHQ A;  3MAQ A;  2OZM A;  1JLB A;  3ZT2 A;  4KV8 A;  1EET A;  4CJL A;  1BHL A;  3S3M A;  5C42 A;  2Z1I A;  4W5T A;  1ZBL A;  4CEZ A;  1VSJ A;  1GOC A;  5SZT A;  2VG7 A;  1WSH A;  3DYA A;  1HMV A;  1NKC A;  4RW4 A;  1IH7 A;  1JLG A;  4BWJ A;  3QEW A;  4Y1C A;  3AVK A;  4DSE A;  4N5S A;  4FJG A;  2OPQ A;  2IAJ A;  1C0M A;  1TGO A;  3CYM A;  1CXQ A;  3V9U A;  3ZSO A;  4ZTF A;  1A5V A;  4XIU A;  4DU4 A;  5I3U A;  3SV4 A;  3TAB A;  5HLF A;  2HHV A;  3OYL A;  2VG6 A;  4ID1 A;  2E6L A;  1HJR A;  4MFB A;  4DFP A;  4CFD A;  1JLE A;  5HP1 A;  3TAN A;  1JXE A;  1EKE A;  4CIG A;  3DI6 A;  4UQG A;  3O4N A;  4Q0B A;  1LW0 A;  5DK5 A;  3QES A;  3DRS A;  3MXJ A;  3V4I A;  2FBV A;  1WNS A;  3KK1 A;  3CM6 A;  1LAW A;  1JLF A;  2FBT A;  3ISN C;  3K57 A;  3LP3 A;  3WNF A;  3NF6 A;  1X9M A;  1YT3 A;  5HBM A;  3KLF A;  3OYH A;  3SPZ A;  4CIE A;  1HYV A;  1QS4 A;  3HO1 A;  1KSP A;  1Z25 A;  2D0C A;  4NYF A;  4FZY A;  2FBY A;  4CJE A;  4DTN A;  3M8R A;  1WAJ A;  4C8M A;  4CJW A;  4OLA A;  4KHY A;  3RMD A;  4KB1 A;  2HHW A;  3OS0 A;  3AVL A;  2D0A A;  2X74 A;  4H4O A;  4M45 A;  3ZT4 A;  3U3Y A;  2XRI A;  3AVA A;  4J2E A;  4MQ3 A;  1HNI A;  4CHP A;  4I9L A;  3V81 A;  1JL1 A;  3AVC A;  4NYN A;  4FJM A;  3RTV A;  4F2R A;  4AHV A;  1KFS A;  1WSJ A;  4FW1 A;  4O55 A;  1NK6 A;  2G8W A;  5E41 A;  2Y1J A;  3KLI A;  1B9D A;  3ZT0 A;  2HHT A;  4JLH A;  3OYA A;  3SZ2 A;  1IG9 A;  4GMJ B;  3JSM A;  1UWB A;  3VA3 A;  4Z4G A;  4WE1 A;  4DWI A;  1VRU A;  1ZBF A;  3LZI A;  2YV0 X;  3OYM A;  3SJJ A;  3TAF A;  1BIU A;  3QIO A;  3NDK A;  3ZSX A;  4QCL A;  2RPI A;  3KTQ A;  3VQ5 A;  1C6V A;  1S1W A;  4LSL A;  5EU7 A;  3SV3 A;  2OPR A;  2B5J A;  1L3T A;  1KLM A;  3L3U A;  1RBV A;  3M8P A;  4DTS A;  4ZTJ A;  4AHS A;  2YNF A;  3PX0 A;  2DY4 A;  2HHX A;  4DSI A;  4RW7 A;  2YNI A;  3VQ8 A;  1NK5 A;  1YVU A;  3HVT A;  3DLK A;  1T7P A;  3BDP A;  3QEX A;  1W0H A;  1FKO A;  1WSG A;  4R5P A;  3HT3 A;  3S3N A;  3AA2 A;  3AA3 A;  4CF2 A;  4FJI A;  1I39 A;  4KTZ A;  1D8Y A;  4OVL A;  2YKM A;  4LH4 A;  4B9V A;  1ZBH A;  1KTQ A;  2P1J A;  1SUQ A;  2KFZ A;  4JRP A;  1NJW A;  2DTU A;  4O0I A;  2QXF A;  5K14 A;  4RG8 A;  4W5O A;  3IRX A;  1JKH A;  1JLA A;  4BAC A;  4FLU A;  1RBU A;  3VQA A;  3ALY A;  1LV5 A;  1ZBU A;  1RDC A;  2E6M A;  1QE1 A;  1VSD A;  2Z1G A;  2VG5 A;  5FDL A;  1GOB A;  1IKY A;  4CGH A;  4YFU A;  4N56 A;  3NAE A;  3SI6 A;  1IKW A;  3C6U A;  3TR8 A;  3IAY A;  4DSF A;  2I5J A;  3AA4 A;  2RN2 A;  4FLW A;  1F21 A;  4KRE A;  1VSK A;  3P1G A;  4F3O A;  3QNN A;  4JS4 A;  2WOM A;  4JS5 A;  4CJ5 A;  2A1R A;  4CCH A;  3HP6 A;  3QER A;  4FJX A;  3AVF A;  4G1Q A;  2BGG A;  3AV9 A;  4DQI A;  1A5X A;  1J53 A;  1S1X A;  3T19 A;  3HPO A;  4CK2 A;  4GVM A;  3V6D A;  4CGG A;  1KFD A;  3SPY A;  3HJF A;  1LWC A;  3VQP A;  3TAQ A;  5KI6 A;  4YNQ A;  1TKD A;  3BGR A;  3LP1 A;  4EP5 A;  5KGX A;  1HYZ A;  3WNG A;  5D3G A;  3U6F A;  2KTQ A;  3VQE A;  3KK2 A;  2O4G A;  3RMC A;  1DTT A;  2FBX A;  5CZ1 A;  4DQS A;  4CEO A;  1RT2 A;  3OYD A;  5KTQ A;  2WON A;  3NCI A;  5JS1 A;  3HVR A;  4LSN A;  3KLG A;  3ZSQ A;  1TVR A;  2OPP A;  3AA5 X;  3OYN A;  2RKI A;  2YKN A;  4FCY A;  4E7K A;  3MXI A;  4CEB A;  1TAU A;  4NCB A;  1Q9X A;  4FJ9 A;  4ICL A;  3NGZ A;  3V9S A;  4FJ5 A;  2IC3 A;  4KO0 A;  1RDB A;  4CJU A;  4CGF A;  3VQ7 A;  1TV6 A;  1JL2 A;  1T8E A;  2XY6 A;  1JLC A;  4KAZ A;  5DMR A;  4CER A;  3KD5 E;  1TK5 A;  4E1M A;  1U04 A;  2QKK A;  4E0D A;  2F8T A;  1T05 A;  4F3T A;  5HRR A;  3DRP A;  2QKB A;  1C0T A;  3KKS A;  4FLV A;  4KHN A;  3H08 A;  2FC0 A;  5HRS A;  1C1A A;  4DSK A;  2ZD1 A;  4BDP A;  1DTQ A;  5CY4 A;  4FLT A;  2GBZ A;  4Z4C A;  3AO3 A;  2EX3 A;  4CFB A;  3AVM A;  4OPJ A;  3T3F A;  4E7L A;  1QSY A;  2DFF A;  3C6T A;  3QEP A;  4QOZ B;  1TAQ A;  4HCC A;  2GV9 A;  3A2F A;  4Z4I A;  2OPS A;  4B8C A;  4AHC A;  1X1P A;  2B6A A;  1BQN A;  2G8U A;  2HNZ A;  5C24 A;  3OYB A;  1TL1 A;  1NJX A;  3CFO A;  3LPT A;  2X6S A;  1Y97 A;  3NGY A;  4CF8 A;  5C25 A;  1VSI A;  1S1V A;  3CFR A;  4CJV A;  4HHT A;  1NOZ A;  3HYF A;  4RW6 A;  3AO2 A;  4K8Z A;  1RIL A;  3B6O A;  1S5J A;  1NKE A;  3RR7 A;  4B9S A;  4KI4 A;  4PWD A;  1HRH A;  4KKO A;  4CJ3 A;  4OKK A;  4BE1 A;  4FLX A;  1KVC A;  3G10 A;  1U48 A;  1N6Q A;  1ITG A;  4HUF A;  4DTP A;  2Q3S A;  3V1Q A;  4CEF A;  3SUP A;  4CHY A;  3K5L A;  4DTX A;  2P5G A;  1SL1 A;  4I9Q A;  4KTQ A;  3M8S A;  4ID5 A;  4TSX A;  1C1B A;  4CFC A;  4FK4 A;  2IS3 A;  2LSN A;  3JYT A;  3L2V A;  2KZZ A;  1S1T A;  1BIS A;  3HXM A;  2F8S A;  3E01 A;  5KGW A;  4E89 A;  4DFJ A;  1SL2 A;  4FJ8 A;  4I2P A;  3VQQ A;  3ZSW A;  3I0S A;  3SYZ A;  1R0A A;  4FJL A;  4DMN A;  3AVI A;  4CJ4 A;  1YTU A;  1D5A A;  3WNH A;  2XHB A;  3PX6 A;  4OGC A;  4DLE A;  1X9S A;  2GUI A;  1HQU A;  3PO5 A;  3L2R A;  2BE2 A;  2DFH A;  4FJJ A;  4FW2 A;  1REV A;  3NH1 A;  4KHW A;  4DU1 A;  1WLJ A;  3CG7 A;  3ITH A;  3CQ8 A;  1TK8 A;  4F8R A;  1HPZ A;  4PUO A;  4CHO A;  3SQ0 A;  4PY5 A;  3MED A;  1DLO A;  1W9H A;  2YNG A;  3QNO A;  3QET A;  1SL0 A;  4B9L A;  4E7J A;  3VQ6 A;  1I3A A;  4HUG A;  3EYZ A;  2G8H A;  2XY7 A;  3DMJ A;  3ZCM A;  4B08 A;  3RWU A;  3ZT1 A;  5KRT A;  1QQC A;  3K5O A;  4DTR A;  4O4G A;  3NGI A;  4DTO A;  2OYQ A;  4HCB A;  4CF0 A;  1KRP A;  3PX4 A;  1S9E A;  4CF9 A;  1QTM A;  1U45 A;  1BL3 A;  3RRG A;  1CZ9 A;  3DOK A;  4DSL A;  1LWF A;  1QSL A;  1CXU A;  4ELT A;  4OLB A;  1XC9 A;  3LWM A;  1LWE A;  4IBN A;  4DU3 A;  3DRR A;  1QHT A;  3S9H A;  4CK3 A;  1RBT A;  1UA1 A;  2HVH A;  4AHU A;  3HP9 A;  5CYM A;  1VSH A;  3TAP A;  4M3Y A;  4KPY A;  1EX4 A;  2G8F A;  3LWL A;  4I7F A;  3NF8 A;  1J5O A;  3IG1 A;  1IKV A;  4M42 A;  3OYG A;  1VRT A;  4DTM A;  2PYL A;  3LP0 A;  3SCX A;  1RNH A;  3TI0 A;  4F2S A;  4Z0U A;  3HM9 A;  4ELU A;  3M8Q A;  3TAR A;  4M41 A;  3AO5 A;  3CM5 A;  1BQM A;  3RMA A;  4IG3 A;  3NBP A;  4AHT A;  1VK0 A;  3L3V A;  3QLH A;  3VQC A;  4FLZ A;  4O44 A;  1SKR A;  3KIO A;  1RT6 A;  1UOC A;  3NH2 A;  2IDO A;  1X9W A;  2HHQ A;  3D45 A;  2JLE A;  3LDS A;  2KZM A;  4CK1 A;  4LH5 A;  3VQD A;  4CJR A;  4CHZ A;  3OS2 A;  3TWH A;  4CJQ A;  3ZSZ A;  4AH9 A;  1NJZ A;  4EZ6 A;  3G0Z A;  3SQ1 A;  4J2D A;  4KHS A;  3KLE A;  2XO7 A;  3DLB A;  4M3Z A;  1RBS A;  4ZHR A;  4AHR A;  1LAV A;  4RW8 A;  4B9T A;  5FRM A;  1JLQ A;  1ZBI A;  2OA8 A;  4HVJ A;  4CJS A;  1L3V A;  1S1U A;  4M3X A;  1NJY A;  1CZB A;  1N5Y A;  2F96 A;  1J54 A;  3VQ9 A;  4FM0 A;  4HTU A;  2IGI A;  3V1O A;  4DLG A;  3OVN A;  3L2W A;  4CEA A;  4CGI A;  3K2P A;  1Q8I A;  4RW9 A;  3ZSY A;  1RT4 A;  5HRN A;  3D0P A;  3NE6 A;  1KVA A;  2Z1H A;  4QAG A;  4LY7 A;  3L2U A;  3QEV A;  3KKR A;  3QEI A;  4B9M A;  4DQQ A;  1U47 A;  3MEG A;  3KJV A;  4J2B A;  2D0B A;  2HHS A;  3T1A A;  3K59 A;  3V9W A;  1SKS A;  1RT1 A;  1TKT A;  4O5B A;  1RBR A;  3K58 A;  3P83 D;  1KCF A;  2QK9 A;  1WSE A;  1ASU A;  3MXM A;  4CED A;  4DS5 A;  2PZS A;  1RT7 A;  2YHB A;  4CES A;  1KVB A;  3DLG A;  3LAN A;  1GOA A;  1WSF A;  3TAG A;  1D9D A;  2E4L A;  4DTU A;  1RT5 A;  4HUE A;  4CF1 A;  2HHU A;  3L8B A;  1O1W A;  3DLR A;  5J1E A;  1L3S A;  4BDZ A;  4B9N A;  3AVJ A;  2A1S A;  3ASM A;  3LAM A;  4E1N A;  4OJR A;  3L2Q A;  1XHZ A;  3WNE A;  4H4M A;  4KRF A;  4BWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...