3G10A

Structure of s. pombe pop2p - mg2+ and mn2+ bound form
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
SPIRDVWSTNLQQEMNLIMSLIERYPVVSMDTEFPGVVARPLGVFKSSDDYHYQTLRANVDSLKIIQIGLALSDEEGNAPVEACTWQFNFTFNLQDDMYAPESIELLTKSGIDFKKHQEVGIEPADFAELLIGSGLVLQEEVTWITFHSGYDFAYLLKAMTQIPLPAEYEEFYKILCIYFPKNYDIKYIMKSVLNNSKGLQDIADDLQIHRIGPQHQAGSDALLTARIFFEIRSRYFDGSIDSRMLNQLYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The activity and selectivity of fission yeast Pop2p are affected by a high affinity for Zn2+ and Mn2+ in the active site
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase, gene regulation
molecule keywords CCR4-Not complex subunit Caf1
total genus 85
structure length 252
sequence length 252
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3g10A00
2DFFA 3L3UA 2QKBA 2B4JA 3O4NA 1WSIA 3V9WA 1WSFA 3OYNA 1EETA 1RDCA 2I5JA 4O0JA 5C24A 1VK0A 4E1NA 4OGCA 3K57A 4B8AB 4ICLA 3SI6A 4CEFA 4FJJA 1RDBA 1A5VA 3KLGA 1KCFA 4CF8A 2B6AA 3AA5X 3JSMA 4AHTA 3LZJA 1W9HA 4E0DA 5KGXA 5E41A 3SPZA 1BHLA 4FJ9A 4JRPA 3T1AA 4HUEA 4AILC 1TKDA 1QQCA 4CEOA 2HHUA 1WSJA 3IG1A 4CCHA 2IAJA 4CGGA 4BE0A 3SQ1A 4RG8A 1IO2A 2OPRA 4FLWA 1X9SA 1B92A 3SUNA 1RILA 4TSXA 3MEGA 3G0ZA 1RT5A 1FKPA 3AO3A 4FM2A 5SZTA 2DFHA 3SUOA 4FXDA 5HROA 3V9ZA 2BANA 4CEBA 4CJRA 3I8DA 1L3TA 4FCYA 3THVA 3SV4A 2ITGA 4RW9A 1RCHA 1S9EA 3AVIA 3OYJA 4E3SA 4KREA 1KFDA 3F9KA 4DTRA 1CLQA 4M3ZA 1X1PA 2D0CA 4JLHA 2GUIA 3KLHA 3QERA 4CK2A 4FJIA 4I9LA 4DTNA 4CF1A 1HQEA 4F2SA 3SUPA 1SL1A 1VSJA 3CM5A 4BDZA 3QIOA 4W5RA 3U6FA 2HHVA 4M3RA 3AV9A 4B9LA 1Z25A 1VSDA 1DTTA 2W42A 4F3TA 1CZ9A 3LAMA 3OYCA 1J54A 3ZT1A 3HJFA 4OLAA 3OYDA 2XY6A 1Q9XA 2HHQA 3KK1A 3SV3A 1VSHA 3HVRA 2JLEA 4AHRA 4EZ6A 1MU2A 4O4GA 3L2UA 3MAQA 3HPHA 3M8PA 4FLXA 3K5MA 3LDSA 3OJSA 3B6PA 1VSEA 3DLKA 1RBSA 2P1JA 2G8UA 3SJJA 4N47A 4DTMA 4FW1A 3VQQA 4FJXA 1S1XA 2Q3SA 3QLHA 4FLVA 1S9GA 3AVLA 2X6NA 3AA4A 3MEEA 4O44A 4E7IA 2ZD1A 3AVKA 3OYLA 2OZMA 1S1VA 4B3OA 1IKWA 3SUQA 4KHQA 1UAXA 1WSHA 1BIUA 4CHOA 1SL2A 3QEWA 2OA8A 4CFAA 4FJGA 3VQBA 4AH9A 5SWMA 1BISA 1Z26A 3OYHA 3ISNC 3SNNA 1TK8A 4YFUA 2IS3A 3EY1A 3VQ9A 3M8SA 2DTUA 4IDKA 3L2VA 4HUGA 1T05A 4OPKA 1NJWA 1T7PA 3BDPA 1HYZA 4FJ7A 3B6OA 3TR8A 4R5PA 4JRQA 3I0SA 4CEDA 4KHYA 3OJUA 4DQSA 3HM9A 2HVIA 1J53A 2VG6A 4CHZA 4C8OA 4ID1A 2BE2A 4CHPA 3T3FA 1NK7A 1RDAA 2YKMA 5HRRA 4DG1A 4LD0A 3CQ8A 3NH0A 3VQ5A 1QSYA 1C0MA 1QHTA 1HPZA 3DRPA 2P51A 1TAQA 4PQUA 4HVJA 4E7HA 1Y97A 4RW7A 3OVNA 2XRIA 4BDYA 2YHAA 2AJQA 1VRUA 1KVAA 4AHCA 4W5TA 1D5AA 4B9VA 4I9QA 1ZBFA 4O0IA 2KTQA 4CK3A 4CJEA 3OYEA 3LWLA 1HJRA 3AA2A 4DTSA 4FK0A 1IKXA 1YT3A 4OGEA 3LP0A 4OKEA 3OS0A 2Y1JA 1NKEA 2VWKA 3K5NA 4DSKA 4FJLA 5CY4A 4ZTJA 3KTQA 3HVTA 4Z4GA 4PWDA 1T03A 1NJZA 2OPSA 3MXJA 1X9MA 3VA0A 4CJWA 4CFBA 1N5YA 5KI6A 3MXMA 2PYLA 1KLNA 3DM2A 4CGDA 4DU4A 1C0TA 1XC9A 3OYIA 1C1AA 3K5OA 1O1WA 4I2QA 4O55A 3WNFA 4AHVA 4FJ8A 1SV5A 3AVFA 2G8HA 4E7LA 4DFMA 3DRSA 4CERA 3M8QA 3AVHA 4IG3A 1NK0A 4OVLA 3JYTA 4W5OA 4N56A 3VA3A 3DOLA 2RN2A 3C6TA 4OKJA 3WNHA 3NGIA 4DTUA 3PO5A 2OZSA 4KKOA 4GVMA 1SUQA 5K14A 1TGOA 4HCBA 3ALYA 3VQPA 3P83D 3PUFA 1HYSA 4CJKA 4K8ZA 1JXEA 3MECA 2EX3A 2D5RA 3SZ2A 3V9UA 1BQMA 3TI0A 4Z4EA 1B9DA 4DQRA 4M3XA 1KLMA 3HL8A 4LSNA 1WAFA 1XHXA 3DLHA 4C8LA 4I2PA 3HP9A 3PX6A 2KZZA 4RW6A 3NF7A 5CYMA 4M3UA 3LP1A 1GOBA 2YNHA 1QSSA 4AHSA 3KLIA 4B9TA 4GW6A 1SKWA 4DSFA 1ASVA 5T7BA 3AVCA 5DK5A 3ZSXA 2PY5A 1JLBA 3LZIA 1YVUA 4W5QA 1WSEA 2YV0X 3HSTB 3TAMA 5HRPA 1DTQA 4NCAA 4CJ3A 2X78A 1EX4A 4KO0A 5J2MA 2JGUA 2HNZA 4IFVA 4NYFA 4IKFA 1U47A 1UOCA 4FLUA 4FZZA 3WNEA 4FZXC 4KI6A 3RMDA 3D45A 3I0RA 4CJ4A 4UQGA 2XY7A 3ZT2A 4CGJA 3AO2A 1QE1A 5EU7A 3HP6A 3L8BA 1ZYQA 3L2WA 1TKZA 3RTVA 1XHZA 1SL0A 1A5WA 3A2FA 1CXUA 3O3HA 3RWUA 4KHSA 3TABA 1S1UA 3QEXA 1RT4A 4JS5A 1SKSA 4FK2A 4BACA 1T8EA 3QIPA 3U3GA 4DF8A 5J2PA 2ZE2A 2RF2A 3OS2A 4J2EA 2RKIA 3S3OA 3AVMA 4OLBA 4CFDA 1KTQA 1JXBA 5CYQA 2YHBA 2HW3A 1JLCA 3IRXA 4EP4A 3V9SA 4HHTA 1RBUA 3IAYA 4KHWA 4DSIA 2Z1HA 4FJHA 1KRPA 1TL1A 1RTDA 4DU3A 3AVJA 5J2NA 3V1OA 1I3AA 3HK2A 2HHXA 2O4IA 2PZSA 2O4GA 3ITHA 3F73A 3NAEA 3SCXA 2QK9A 4Q0BA 1U49A 3EZ5A 5FROA 1KFSA 4CJPA 3DMJA 3TANA 1FXXA 2HNYA 3KK2A 1HNIA 4KHNA 4CESA 2FBXA 3NE6A 3DI6A 3U3YA 4EZ9A 3L2RA 3E01A 1U45A 1FKOA 4CJUA 2XO7A 4ID5A 3CYMA 3K59A 4K8XA 3CFPA 4FK4A 2FC0A 4M41A 4C8MA 2BGGA 1W0HA 4CJLA 1LW2A 3NH1A 3S3NA 2P5OA 4FM0A 1LAWA 4F4KA 4C8NA 1HYVA 3C94A 3DYAA 3O4QA 3ZT4A 3O3FA 3NDKA 2LSNA 5C42A 2D0AA 5D3GA 1S5JA 1EXQA 5I42A 1IG9A 3KKSA 3HPOA 3NF6A 4CJTA 3VQ6A 3SPYA 1X9WA 1J5OA 3ULDA 1D9FA 2HMIA 4KFBA 3VQDA 1GOCA 2G8IA 4XIUA 2IC3A 3DLRA 3V6DA 3PO4A 3SQ0A 5JS2A 4RW4A 4RW8A 4DSLA 3PX4A 3ZT0A 4CJ5A 3QEIA 2ATQA 1NK9A 1L3SA 4O5BA 4CK1A 3HPGA 4QCLA 1NOZA 1A5XA 2HHTA 3QNNA 1I39A 4B8CA 4Z4CA 3L3VA 4CGFA 4E89A 4DLGA 2FBYA 3TAPA 4F2RA 4DU1A 2HVHA 1IH7A 1IKVA 3OY9A 1QSLA 2IGIA 1JL2A 2VWJA 3NBPA 4DF4A 1WAJA 1NK5A 1D9DA 2E4LA 2E6MA 3K5LA 1ZBHA 5FRMA 2KFZA 3DLBA 1KVBA 3D0PA 3LWMA 4FVMA 2Z1JA 4DMNA 4JS4A 4FJNA 1WSGA 1XWLA 3K58A 4CIEA 3TAEA 1BIZA 1BI4B 4N41A 2HHSA 3VQCA 4IFYA 2YNGA 4H4OA 1R0AA 5KGWA 4NCGA 5HRSA 3NH2A 1J9AA 3QEPA 1QS4A 1VSKA 2RPIA 4Z0UA 4YNQA 2G8VA 4LY7A 4FLZA 4CGIA 3CM6A 3QO9A 3T19A 4Z4HA 5C25A 4DQQA 3QETA 1S1WA 4ELUA 4DSJA 4DSEA 1S6PA 5J1EA 1S1TA 1CZBA 4KI4A 4E1MA 3IS9A 1JLQA 1VSIA 3P5JA 4KTWA 1D8YA 1WNSA 4CEEA 4DQIA 5HLFA 4KB0A 4CIFA 3LALA 4KAZA 4FZYA 1NKCA 4BWJA 2DY4A 4CJSA 1KVCA 3ZSRA 2KZMA 1LWFA 1BL3A 1C1CA 2E6LA 2DFEA 3RR8A 2FBTA 4CF2A 3V1QA 3VQEA 4Q5VA 3V9XA 3AO5A 5I3UA 1F21A 1U04A 3RRHA 1ZBIA 3V1RA 3KIOA 4MFBA 4BE2A 1Q9YA 3MEDA 4KTZA 3CFOA 1LAVA 4EP5A 2X6SA 4LH4A 3HO1A 4PA1A 4DFJA 1NJXA 4CJFA 1VSFA 2Z1IA 3LP2A 3NF9A 3QEVA 3KD5E 4ELVA 5HBMA 4Z4IA 1RT1A 4B08A 3OS1A 2GV9A 5CZ2A 5DMRA 2YNFA 1BCOA 3P1GA 5KRSA 2Z1GA 1BI4A 4BE1A 4G1QA 4CGHA 2QKKA 1YTAA 5KRTA 2KQ2A 4BWMA 4H4MA 3M8RA 3NGYA 3CFRA 5KTQA 3FFIA 3DLEA 2A1SA 1N6QA 2G8FA 4ZHRA 3UIQA 4FJMA 2KFNA 2YKNA 4CECA 2XHBA 3DOKA 3ZSZA 4KHUA 1NJYA 3QNOA 3TAQA 1UA1A 1SKRA 4OPJA 3PV8A 1K6YA 3BGRA 1REVA 3TAGA 1RBRA 4B9UA 3QINA 3KKRA 3AVBA 3VQ4A 3KJVA 4KTQA 1RBTA 2OPQA 4B9MA 3AO1A 1QTMA 1RTHA 1EKEA 4DLEA 2VG7A 1UA0A 5FRNA 4AHUA 1FK9A 1NK6A 1HMVA 3O3GA 1S6QA 1KSPA 3AO4A 1RTIA 3OYKA 2XY8A 3RRGA 1C1BA 2D0BA 3ZCMA 1LWEA 1RDDA 5HRNA 2WOMA 4E7JA 3CG7A 3VQ8A 1LW0A 1NOYA 1JLGA 3OYMA 4B9SA 3S9HA 5J2QA 4DTJA 4J2DA 3G10A 1TKXA 1VRTA 4LH5A 1JL1A 2QXFA 1TK5A 4KPYA 4CJQA 3V81A 1U48A 1UWBA 3C6UA 1C0UA 1TV6A 3AA3A 3RMAA 1HRHA 1NKBA 3PX0A 4M3WA 4E7KA 4LSLA 1RT2A 1LWCA 1ZBUA 4CEQA 3TWHA 3ZT3A 1RT6A 3QESA 3ZSOA 4J2AA 2F8SA 3KK3A 3DLGA 3LPTA 1VSMA 4CHQA 4FYDA 3K2PA 4HCCA 2F8TA 3OYAA 1DLOA 4CE9A 4FJKA 1TAUA 2IOCA 2R7YA 1WLJA 1JKHA 2EHGA 4KRFA 1TKTA 3NGZA 4DS5A 1BGXT 4DWIA 4CHNA 2BDPA 2A1RA 3KD1E 4WE1A 5FDLA 1L3UA 1GOAA 3OYBA 3LANA 1JLFA 3LP3A 4L8RB 1EP4A 2OPPA 4CHYA 3ZSWA 3SQ2A 3TARA 1JLAA 3H08A 3LAKA 4GMJB 4DTXA 4DFPA 4Z4FA 1CXQA 4OJRA 4J2BA 4OKKA 4CEZA 4FLTA 4ZTFA 5CZ1A 3ZSYA 2Y1IA 3RMCA 1RT7A 3NFAA 4MQ3A 4Y1DA 3NCIA 4KB1A 4N76A 1HQUA 2ETJA 4CF0A 2VG5A 4QOZB 1ITGA 3HYFA 4M42A 4PY5A 1RTJA 3L2QA 4FM1A 3OYGA 1C6VA 3HT3A 4DFKA 4H8KA 1RT3A 3VQAA 4CF9A 3LPUA 3TAFA 4W5NA 4E19A 4M45A 1L5UA 1TL3A 4HUFA 1U4BA 4C8KA 3HXMA 4I7FA 4CIGA 3OYFA 2OYQA 2F96A 4FW2A 1B9FA 4NCBA 4M3YA 4DTOA 3KLFA 1YTUA 4IBNA 3ZSVA 1LV5A 3VN5A 3VQ7A 4F3OA 2WONA 4DS4A 1JLEA 3ZSQA 2HHWA 3NF8A 3MXIA 4DQPA 3ASMA 4M3TA 3SQ4A 3AVNA 4KV8A 1VSLA 1WN7A 4FLYA 4BDPA 3AVGA 4IG0A 4CFCA 2KW4A 1BQNA 4B9NA 3S3MA 2G8WA 2NUBA 3RMBA 4ELTA 4FJ5A 3PY8A 1HNVA 4DTPA 3SYZA 4F8RA 2IDOA 5HP1A 3C95A 3WNGA 3KLEA 1RNHA 4CJVA 1BCMA 2G8KA 3RR7A 1Q8IA 1NK8A 1ASWA 1ZBLA 1IKYA 4HTUA 4N5SA 4QAGA 2XY5A 1RBVA 1XI1A 1TK0A 3AVAA 1ASUA 1G15A 2ZQBA 2HB5A 4PUOA 2GBZA 4CEAA 5JS1A 2PYJA 2HNDA 2YNIA 3NHGA 3V4IA 1NK4A 4Y1CA 2X74A 3DRRA 2B5JA 2FBVA 1L3VA 1TVRA 4NYNA 3EYZA 2P5GA
chains in the Genus database with same CATH superfamily
1WSIA 3V9WA 1WSFA 3OYNA 1MWMA 1VK0A 4B8AB 4FJJA 1RDBA 3KLGA 3ZETA 2P9UA 4BC3A 1K8KB 3AA5X 3JSMA 4AHTA 1W9HA 5KGXA 2O8CB 4JHDA 1OH7A 1NU0A 5BR8K 4WF9L 4Z94A 4AILC 4EAHD 5JMVA 4DKWA 1X9SA 4TSXA 2P9NB 4JKCA 3C6HA 3AO3A 3H3OB 2DFHA 4BR9A 3THWB 3I8DA 4CEBA 4CJRA 1L3TA 4FCYA 2P9NA 3SV4A 2ITGA 4RW9A 4KREA 1S9EA 3AVIA 3OYJA 4E3SA 4A59A 3F9KA 1CLQA 4DUZK 3GOIA 4FJIA 4CZGA 4CF1A 1HQEA 1T6DA 3AV9A 1DTTA 2W42A 3THYB 4F3TA 1W97L 2HHQA 2XY6A 3SV3A 1VSHA 2JLEA 3D2FA 4AHRA 3CIPA 4ISEA 3OJSA 3B6PA 2HHHK 1HLUA 5AQFA 2P1JA 5AQUA 4DTMA 3UKRB 4FW1A 1S1XA 3AVLA 3AVKA 4B3OA 4A5BA 3SUQA 4KHQA 4C23A 3K9KA 3QEWA 2OA8A 4JKAA 3RSEA 4CFAA 3VQBA 1BISA 1XQSC 2DTUA 4IDKA 5AR0A 1NJWA 1VQ4N 3BDPA 1HYZA 3BP8A 2Q31A 4R5PA 3I0SA 4JK7A 4CEDA 1ZXOA 4YOTA 3DXMA 3QBWA 5AZJA 4RWTA 2BE2A 5AQZA 3T3FA 3IKMA 3THXB 2YKMA 1OH8A 5HRRA 1ESVA 1YVNA 3VQ5A 1QHTA 3HBTA 3SBGA 2HBMA 3OVNA 1K9MO 1VRUA 3QBXA 4I9QA 4CJEA 1GLCG 3AA2A 1IBLK 2NNWA 3D7EO 3K5NA 4FJLA 4PWDA 5CY4A 4BG8A 3KTQA 3TSQA 4CFBA 5KI6A 1KLNA 2FSJA 3DM2A 4CGDA 1XC9A 3OYIA 1C1AA 1O1WA 4I2QA 4AHVA 1MWKA 1V4SA 4MLEA 3LDOA 4IG3A 3VA3A 3DOLA 2RN2A 3NGIA 1E3MA 2UU9K 1SUQA 3AGKA 1XMOK 1Q81O 4CJKA 4K8ZA 1BG3A 5AQXA 3V9UA 1B9DA 3O1BA 3HL8A 4C8LA 3OBWA 3PX6A 2KZZA 4RW6A 3NF7A 3E9LA 4B1YB 3QMLA 4GW6A 5T7BA 3E1YA 5DK5A 3ZSXA 2PY5A 1NJIO 4FPBA 4AM7A 1KQSM 1DTQA 1KAXA 4CJ3A 1EX4A 4KO0A 1NGDA 2NRRA 4IFVA 2W6LA 2ZM6K 4IKFA 1U47A 4KI6A 4AM6A 4JK9A 4CJ4A 4UQGA 3MWPA 4CGJA 3AO2A 1QE1A 5EU7A 3L8BA 1ZYQA 1SL0A 1ATSA 3TABA 1S1UA 1N34K 1RT4A 4FK2A 4BACA 1WBDA 4DQ8A 2Q36A 1GLFO 2RF2A 4CFDA 4B3TK 2YHBA 1JLCA 4EP4A 1RBUA 5I9EB 3LM9A 3U8XA 4DU3A 3V1OA 2HHXA 2O4IA 1NGIA 2O4GA 3ITHA 3T69A 3F73A 1W2BM 2QK9A 2O8DA 5BN9A 3VMFB 5AFUH 3MN9A 2AA4A 2KKZA 2ITMA 4KHNA 4BRMA 3NE6A 1FW6A 5AQPA 3DI6A 3E01A 3JS6A 4CJUA 4K8XA 4ID5A 3CFPA 3FFKB 4M41A 5HL7L 3U9ZA 3KHYA 1LW2A 3D6RA 5AQGA 4CJLA 2E2NA 3O4QA 3C94A 3O3FA 3Q7BA 5D3GA 4GV3A 5I42A 4IOAL 1IG9A 4DV5K 4CJTA 2HMIA 4KFBA 4LFBK 4YOVA 4CBUA 3DLRA 4RW8A 4BRCA 4DSLA 3ZT0A 5TKYA 4CJ5A 3CETA 1TUUA 4QCLA 2HHTA 4DLGA 2HVHA 4F2RA 2QI2A 3ATVA 2Q2RA 1JL2A 3AAQA 1WAJA 3CJ9A 4B9QA 1ZBHA 5FRMA 2KFZA 3LWMA 2Z1JA 4FJNA 1XWLA 4CIEA 1BIZA 5B8HA 2HHSA 3NH2A 1DT9A 1GLLO 1QS4A 2QTDA 2RPIA 3BF1A 4Z0UA 4BY9C 3T19A 4DQQA 4LF5K 3WXKA 1SZ2A 3PIOL 3VEXA 5LMUK 1VSIA 3P5JA 1D8YA 4IWVA 1HR0K 1X3NA 5HLFA 1YITN 4CIFA 4KB0A 1SS6A 4FZYA 2O8FA 2ZJQL 4CJSA 3ZSRA 1LWFA 1BL3A 1C1CA 2FBTA 3DXKA 5LJWA 3VQEA 3V9XA 3G71N 4BC2A 1RDUA 3RRHA 1D4XA 4BE2A 1Q9YA 3DXKB 1OH6A 4KTZA 3O9UA 4CJFA 4DB3A 3NF9A 4Z4IA 1DKGD 1RT1A 3OS1A 2GV9A 3SMPA 1Q7YO 5CZ2A 5KRSA 3P1GA 3CMEN 3CCMN 5KQ8A 3MDQA 3J7YP 3FE1A 4CGHA 4BE1A 4H5TA 2KQ2A 2P9LA 3NGYA 3CFRA 3FFIA 5M1KA 2E1YA 2G8FA 4ZHRA 2KFNA 4CECA 3OBYA 4KHUA 1SKRA 2RHKA 1LCUA 1RBRA 3KKRA 3VQ4A 3KK7A 3KJVA 3AO1A 4HTLA 1QTMA 1RTHA 2OTJN 3CXCM 5BPMA 1NK6A 3ENBA 1HMVA 4DR6K 1S6QA 1KSPA 2XY8A 3RRGA 5HRNA 4WFBL 3VQ8A 1JLGA 5EOYA 4LH5A 1JL1A 2QXFA 3JAMO 5H1SQ 4XH5A 4H0OA 3D2FB 1TV6A 1NKBA 2V7YA 2A3ZA 1VQ5N 1RT2A 1ZBUA 1RT6A 3ZSOA 3KK3A 3ZEUA 4CHQA 3K2PA 3OYAA 2UYTA 4IO8A 2R7YA 1BDGA 1JKHA 2EHGA 4BREA 2IVPA 1S3XA 3VOVA 4DS5A 3F9MA 1K73O 2BDPA 3HM8A 3I56N 5FDLA 3GBTA 3LANA 3OYBA 3LP3A 1WBBA 4L8RB 4DR4K 1IBMK 4DTXA 4Z4FA 1CXQA 4OJRA 4J2BA 5EY4A 4ZTFA 1WOQA 3RMCA 4KB1A 3NFAA 3NCIA 2ETJA 4CF0A 1QQMA 2VG5A 3S41A 3H6EA 2WBNA 4PY5A 3L2QA 3CPEA 3H46O 1EO1A 3OYGA 3HT3A 1YXQA 4H0XB 3VF2A 3TAFA 4W5NA 3CI5A 4WQ4A 1L5UA 3OYFA 3A8YA 4NCBA 4DTOA 3KLFA 4LC9B 3ZSVA 3VN5A 3VQ7A 2HHWA 3SBTA 3NF8A 4DQPA 3ASMA 3DWLA 4KV8A 2O8DB 1WN7A 2P9LB 3J81O 4B1WB 3S3MA 2IIRA 3PY8A 3MCPA 1YF5L 3KLEA 3R8EA 1N8RO 1NK8A 1ASWA 3BZKA 3AVAA 1G15A 2HB5A 5JS1A 2PYJA 2HNDA 4GV6A 4ISFA 2X74A 1EQYA 3DRRA 2FBVA 1MA9B 3O9TA 4PKGA 3EYZA 2P5GA 1NGFA 2CGKA 1GLBG 2QKBA 4H0YB 1EETA 1RDCA 5C24A 4OGCA 3DLLL 4V19S 5C2FA 4CF8A 2B6AA 1XMQK 1TUYA 2J4RA 4B3RK 4LF9K 4JRPA 2HHUA 1WSJA 1HX1A 1IO2A 3GE1A 1B92A 3SUNA 4ISGA 3SUOA 4FXDA 5HROA 5LY3A 1RCHA 4CVNE 3R1XA 4JI0K 1KFDA 1VQLN 3AGRA 4M3ZA 2D0CA 2GUIA 4IXCA 4H0PA 3EEQA 3MN6A 3TU5A 4F2SA 1VSJA 4JI6K 4GNIA 3E9OA 3EE8A 4M3RA 4L3QA 3CCEN 4AF1A 4FO0A 1H1VA 4QS7A 1J54A 3W0LA 3OYDA 3E66A 3HVRA 4FWRA 4O4GA 3MAQA 3P31A 3HPHA 3LDSA 3A5LC 1VSEA 3DLKA 1RBSA 3QLHA 3MEEA 2ZD1A 3W3DA 3OYLA 2OZMA 1IKWA 3C6AA 4LF4K 3CF5L 4CHOA 1SL2A 1KC8O 4DV2K 2HBJA 2NLXA 5TKWA 4FJGA 5AQJA 1TK8A 1Z26A 3VQ9A 4HUGA 3EE9A 4OPKA 4BC4A 4FJ7A 3O9SA 3HM9A 3K9JA 2VG6A 4C8OA 1LOTB 3GDQA 2ZGZA 1NBWA 4OPHA 1C0MA 1QSYA 4PQUA 2E2QA 3OTOK 2EWSA 2XRIA 5F2RA 4AHCA 2KHOA 3LWLA 4BQZA 4DTSA 3CC2N 4FK0A 3CMAN 3LP0A 3OS0A 3F5TA 3TTDA 3HZ6A 1T03A 2HMPA 3VA0A 3QICA 3VEVA 1HNZK 2OCEA 1NGBA 5AQKA 1K8KA 1C0TA 3L4IA 4O55A 4MDAA 1SV5A 3CD6N 1NGHA 4E7LA 1C0GA 3DRSA 5AZIA 3M8QA 4M7XA 3L0QA 1NK0A 2OZSA 4DTUA 3WNHA 3PO5A 4KKOA 4GVMA 4WFAL 5K14A 1TGOA 4XH1A 3ALYA 3EKSA 2VQFK 5C10A 3L6QA 1HNXK 1HYSA 2D5RA 5M1OA 3VERA 3TI0A 4Z4EA 3CC4N 4LSNA 1WAFA 1XHXA 4E1JA 3HP9A 1ATRA 3NMUA 3CPWM 2A41A 2ZF5O 4BRGA 1DEJA 5C12A 4PL7A 3H3NO 1ASVA 3AVCA 3LDPA 2QWRA 3J80O 1YVUA 3TAMA 3AAPA 2JGUA 3BY5A 2GEMA 4IDHA 2HNZA 4BRIA 1YI2N 2P9KB 3OA9A 4FZXC 3BZCA 3LM2A 3RMDA 2YX6A 3A5OC 3LDLA 3HP6A 3MMVA 3L2WA 1TKZA 1XHZA 1A5WA 3O3HA 1T3VA 4DF8A 3VF4A 5DM6L 1EWRA 4JI8K 2VCPA 3N4QA 4J8FA 1E4FT 1NGGA 2PFUA 3A5NC 4Y0WA 4HHTA 4DSIA 1KRPA 3AVJA 4BR5A 1I3AA 5AZIB 3WUHA 4BRKA 4A62A 3SCXA 5AZJB 1JCGA 1OVYA 3EZ5A 4CJPA 5EVZA 1FXXA 2HNYA 2HF4A 3A0IX 3ZX3A 1NGEA 1BO5O 3U3YA 3L2RA 3ID8A 2WTUA 1U45A 1FKOA 3K59A 3WXIA 2NRXA 3O9RA 2BGGA 2E5LK 3NH1A 1LAWA 4C8NA 3DYAA 4YOWA 2LSNA 5C42A 2D0AA 4NXNK 1ZBSA 1EXQA 4NLCA 1M1KO 3FR0A 1D9FA 2HSTA 2P9KA 4XIUA 3SQ0A 5JS2A 4RW4A 3PX4A 4CK1A 4A5AA 1NOZA 3L4QA 4CGFA 3OY9A 1QSLA 2VWJA 1NK5A 3ENOA 5BREA 2FF3B 1OH5A 1MDUB 4O8KA 4WQ5A 4DV7K 3D0PA 4JS4A 4DMNA 5ADXH 1WSGA 1Z6RA 1U2VA 1HPMA 3VQCA 4IO9L 2I7PA 4H5RA 4NCGA 1VSKA 2G8VA 4FOEA 4LY7A 4Z4HA 3QETA 4CD3A 2P9SB 4JHDB 4DSJA 4DSEA 1S6PA 3FGUA 5AQLA 5M1FA 1JLQA 4H0VB 1WNSA 1NGAA 2D4WA 4KAZA 4M7YA 5GAEP 2DY4A 2OANA 3VGMA 3RR8A 2E6LA 3LDNA 3PLAA 2Q0RA 2QWNA 4FWLA 1DGKN 1ZBIA 2QW9A 4MFBA 3QDKA 4BG9A 3CCUN 3LL3A 3TSPA 1BUPA 3HO1A 3OW2M 4ELVA 1SQKA 3C65A 3EO3A 4B08A 2VQEK 1GLJO 4JKEA 4JI2K 2Z1GA 2O8BA 2ZGYA 2QKKA 3OHRA 5KPRA 4BWMA 4H4MA 2A1SA 3VETA 1N6QA 3UIQA 1HNWK 2YKNA 3T1YK 5JLFA 3TAQA 1UA1A 4OPJA 1T6CA 2GELA 4MO4A 1REVA 1YAGA 2O8CA 4B9UA 1IJJA 1EKEA 4DLEA 2VG7A 1UA0A 4AHUA 1NGCA 5HOOA 3O3GA 3Q7CA 1VAZA 3P4IA 1C1BA 2D0BA 1NLVA 4BGBA 3OYMA 4B9SA 3O08A 4J2DA 1TK5A 4CJQA 3V81A 1U48A 1YIJN 1UWBA 3ULEA 3RMAA 3PX0A 3QESA 3WEEA 4HCCA 4CW7B 3PSIA 3ZLJA 1TAUA 2IOCA 3CERA 1WLJA 5BPNA 2HOEA 3NGZA 2Q0UA 2YHYA 2CH6A 3C7NB 4CD1A 1Z05A 3PSFA 2ZJRL 4O5FA 5AQYA 4OKKA 2YHXA 4FLTA 5CZ1A 3ZSYA 2NRTA 4Y1DA 1RTJA 2BH1A 2VYPA 2GWJA 4DFKA 3LPUA 3ULEB 4E19A 3IMXA 3UB5A 2IVOA 1VQ7N 4HUFA 1QQNA 4BR0A 3QFPA 4CIGA 2OYQA 1GLDG 2F96A 4FW2A 1B9FA 5IT9O 4OO1J 4F3OA 2WONA 4DS4A 1NNEA 4M3TA 3SQ4A 3FZMA 5LJVA 3AVNA 3AVGA 4CFCA 2G8WA 4FJ5A 3HSCA 5HP1A 3WNGA 4CJVA 1BCMA 1Q82O 1ZBLA 4N5SA 3WQTA 4A61A 2PBDA 1ASUA 3SLCA 3EZWA 4BRHA 4CZEA 3V4IA 4IJAA 4Y1CA 3WQUA 2B5JA 3CJCA 4BQLA 1TVRA 3L3UA 3O4NA 4JI3K 2I5JA 3VEWA 2FLOA 4BRPA 4DR5K 4K0KK 4CEFA 1VQON 1A5VA 3R9PA 2FXUA 3MX5A 3SPZA 4LF7K 1NM1A 4B1UB 4A57A 2P9UB 4FPAA 4ILJA 3T1AA 3VESA 4GKJK 4CGGA 3SQ1A 4FLWA 2ZWHA 4JKBA 1RILA 3MEGA 3G0ZA 1RT5A 4BR7A 1FKPA 2YHWA 4JI1K 4PKHA 3WXLA 3V9ZA 2BANA 3THVA 5FPMA 1BOTO 3CCVN 4DTRA 4YOUA 3ZX0A 5AQSA 3VPZA 3QERA 3CCJN 4I9LA 1ZC6A 3SUPA 1SL1A 3CM5A 4BDZA 3QIOA 3U6FA 3VTIA 4B9LA 1Z25A 3NVMA 3LAMA 1S22A 3ZT1A 1T44A 3HJFA 3KK1A 2AP1A 4FLXA 3M8PA 3K5MA 3HTVA 4JN4A 2KLAA 3VQQA 4FJXA 4FLVA 1S9GA 2X6NA 5LL6Z 4O44A 4DR2K 3WT0A 4E7IA 1HJOA 1OVQA 3TTFA 2E20A 1W7AA 1WSHA 1BIUA 2F9WA 4AH9A 5SWMA 3OYHA 5EXWA 4U7BA 3EY1A 2Q97A 4IJNA 3M8SA 2A5XA 3L2VA 3RVCA 5AQRA 4GKKK 3B6OA 2FF6A 3FLCO 4JRQA 2HVIA 3OJUA 4DQSA 5ADXA 1J53A 4MLHA 3O6WA 4CHPA 1RDAA 4DG1A 4LD0A 3CQ8A 3NH0A 4WQ4C 1HPZA 4HVJA 1Y97A 2H3GX 3I8BA 5IWAK 4BDYA 2AJQA 1KVAA 4W5TA 4JYAK 4CK3A 4JI4K 2QXLA 4OGEA 2WC9A 4FWSA 1NKEA 5CR4A 2VWKA 4DSKA 4ZTJA 3BF3A 3HVTA 4DCHA 1NJZA 5AQQA 5KQDA 4IEIA 1N5YA 4DU4A 4DV0K 4CZLA 2QWLA 1KD1O 4K43A 1N32K 4DFMA 4EHUA 2UUAK 4OVLA 4W5OA 5C0YA 4B1VA 3P83D 3R3LA 1JXEA 4FWMA 3MECA 2EX3A 1VQKN 4DQRA 3MWTA 1KLMA 3DLHA 4FVUA 3NVKA 3LP1A 1KAZA 3KLIA 4B9TA 4DSFA 4IEEA 4ILGB 4NO7A 1YJ9N 4YDUA 3D2EA 4W5QA 4YDUC 4NCAA 2X78A 1VQMN 1FJGK 4IFEA 3WXMB 1G99A 3RSEB 1J5EK 3O4WA 1XUPO 3D45A 2QWQA 3ZT2A 5E26A 3RTVA 4KHSA 3A2FA 3RWUA 1CXUA 2P9PA 4JS5A 3MN5A 1SKSA 4G9ZA 3U4LA 1GLEG 4WQ5C 4DUYK 2ZE2A 5M1PA 3OS2A 4OLBA 2RKIA 3S3OA 5AQHA 4UY8O 1KTQA 4BRQA 3IRXA 3V9SA 3IAYA 4FJHA 2Z1HA 3FZHA 4GY2B 1TL1A 3CCLN 2BUPA 4XH4A 4K42A 3HK2A 2A6AA 2PZSA 4Q0BA 1U49A 5AQVA 5FROA 4X65K 4NXMK 1QVGM 3DMJA 3KK2A 3M3ZA 4CESA 2FBXA 4ILHA 4EZ9A 3LDQA 2ASOA 3ZX2A 1W0HA 4JKHA 1WB9A 2P5OA 3U9DA 4FM0A 5F0XA 4GV9A 2O8EA 4F4KA 4BR2A 4U67L 3NDKA 5FPDA 2NRHA 1S5JA 2WUSA 3EKUA 3KKSA 3HPOA 1X9WA 1VQ8N 3SPYA 1J5OA 4X66K 3ULDA 4WCEL 2IC3A 5BN8A 3V6DA 3PO4A 4WFNL 1M90O 1U2VB 3QNNA 1I39A 4B8CA 4E89A 2FBYA 3TAPA 3N4PA 1IKVA 3HOSA 2IGIA 4DF4A 3NBPA 1D9DA 2P9IA 2E6MA 4FWPA 3T1HK 3CQYA 1KVBA 2E1ZA 4FVMA 4B3SK 1BI4B 4DV4K 1NMDA 4IFYA 2YNGA 1J9AA 3QEPA 4YNQA 4X64K 2CGLA 4FLZA 4M3XA 3CM6A 3QO9A 1O13A 1U6ZA 5C25A 4ELUA 3UE5A 4JD2B 5J1EA 2OTLN 1S1TA 4KI4A 1KAYA 5EX5A 4DQIA 1NKCA 2KZMA 3FZLA 2DFEA 1SAZA 5E84A 5I3UA 1QQOA 1F21A 4CBXA 4JKGB 5FPNA 1VQNN 3HRGA 3CFOA 1LAVA 4EP5A 4PKIA 3KWIA 4LH4A 4PA1A 1NJXA 3QEVA 2VGMA 3KD5E 4KH4A 5DMRA 4IOCL 2YNFA 1Q18A 1BI4A 4G1QA 4I6MB 3M8RA 3DLEA 5AQTA 4CZJA 3J7ZO 4FJMA 2VGNA 2XHBA 3DOKA 5JLHA 3PV8A 3BGRA 1Q86O 3TAGA 3QINA 3AVBA 3VEOA 4KTQA 1RBTA 2OPQA 4B3MK 4B9MA 3CCRN 5FRNA 1RGIA 2QWPA 1RTIA 3ZCMA 1LWEA 1RDDA 1NOYA 4QS8A 3THYA 2F9TA 3G10A 4FSVA 4CZMA 2RE2A 3C6UA 1C0UA 3AA3A 3P39A 1HRHA 3B8AX 1NG9A 4M3WA 5JICA 2V51B 4E7KA 1LWCA 2F8SA 3T7ZA 3TSUA 3DLGA 3LPTA 1VSMA 2F8TA 4CE9A 4FJKA 3J7AP 2E2OA 4O8UA 5BR9A 4AQYK 2E2PA 4JI5K 5AQMA 3H45C 2A1RA 4R79A 3THWA 1GOAA 1X9JA 1JLFA 3I33A 3ZSWA 5GIPA 3TARA 1JLAA 3H08A 2DPNA 3SMSA 5GAGP 4C1NK 2Y1IA 1RT7A 1EWQA 1HQUA 4QOZB 1N33K 4M42A 3ZETB 4JKFA 4FM1A 3CJ1A 3IDHA 1C6VA 5AQIA 1TYQA 1YUWA 2P9PB 2W41A 1RT3A 4CF9A 4M45A 5C2DA 2JWLA 4C8KA 3HXMA 2HBKA 4NLBA 3P38A 3UKUB 2FSKA 4IBNA 4BRLA 1RDWX 1JLEA 3MXIA 3CJ7A 3BEXA 4YY3K 4IG0A 2VWBA 4JKDA 2KW4A 2CH5A 1BQNA 4B9NA 3ENHA 3RMBA 4ELTA 3WXJA 4DTPA 3SYZA 4F8RA 1VHXA 3C95A 4EFHA 3F2KA 3ZEUB 4LF8K 1RNHA 2W6KA 2G8KA 4JNEA 4A2AA 4HTUA 4QAGA 1XI1A 1RBVA 5MLCQ 3CCQN 4PUOA 4DV3K 4BC5A 3SAFA 2YNIA 1NK4A 4JI7K 4LFAK 3DAWA 1I94K 1L3VA 4NYNA 2UXCK 1IG8A 2DFFA 4PHTX 2B4JA 2F7TA 3E9PA 4O0JA 1BA1A 1QZ5A 4BROA 4E1NA 4DV6K 3K57A 4ICLA 3SI6A 1KCFA 4FWKA 3VEZA 3LZJA 5GAHP 4E0DA 5E41A 2A42A 1BHLA 3VGLA 3SAGA 2CGJA 4FJ9A 4HUEA 1TKDA 1QQCA 4M63C 4CEOA 4CCHA 3IG1A 2IAJA 4BE0A 4RG8A 2OPRA 3J8AA 1WUAA 2YCHA 4FM2A 5M1QA 5SZTA 1HKGA 2O8EB 4KH5A 1X1PA 4JLHA 3KLHA 4CK2A 4DTNA 4BRFA 4RTFD 4B1XB 4W5RA 1QHAA 2GX9A 1VSDA 1CZ9A 3OYCA 4OLAA 1Q9XA 3SJHA 4YORA 4EZ6A 1MU2A 3L2UA 3O8MA 4H0TB 5BRHA 2G8UA 3SJJA 4N47A 4DR3K 2Q3SA 4WYBA 2KTQA 3AA4A 2HHVA 1S1VA 5F1XA 1UAXA 3GL1A 3SNNA 3ISNC 1JCEA 2IS3A 5ELZA 4YFUA 1T05A 1T7PA 2V52B 3TR8A 4KHYA 3H1VX 4CHZA 4ID1A 5JVGL 3VENA 1NK7A 4H03B 3ZYYX 1IBKK 3M5RA 2P51A 3DRPA 5AFUA 1TAQA 3VF6A 4E7HA 4RW7A 5CHIA 2YHAA 4RCHA 1R59O 1D5AA 4B9VA 1ZBFA 4O0IA 4FOIA 3OYEA 1HJRA 1YHQN 1IKXA 1YT3A 4OKEA 2Y1JA 4Z4GA 2Q1NA 1P8ZA 1X9MA 2OPSA 3MXJA 5BRFA 3BUZB 2W40A 4CJWA 3QB0A 4LF6K 3MXMA 2PYLA 3CJBA 3H1QA 3K5OA 3WNFA 4FJ8A 4BRAA 3AVFA 5JVHL 2G8HA 1BU6O 3CJAA 5AQNA 4CERA 5FPEA 3AVHA 4CI6A 3JYTA 4N56A 4OKJA 3C6TA 4HCBA 3VQPA 3PUFA 1NMNA 3CHWA 4BR4A 3SZ2A 1BQMA 1HKBA 3SAHA 4I2PA 4JEPA 5CYMA 4MO5A 4M3UA 1GOBA 2YNHA 1QSSA 3MCAB 4AHSA 1SKWA 1NWKA 2QWMA 3ATUA 4X62K 4EHTA 1XNQK 1VQPN 2JWKA 1JLBA 3LZIA 1WSEA 2YV0X 3HSTB 2BTFA 5HRPA 5J2MA 3MK6A 4BVPA 3G25A 4NYFA 3CQXA 1UOCA 4FLUA 4FZZA 3WNEA 4I6MA 3I0RA 2XY7A 3QEXA 3D2EB 1T8EA 3GG4A 3QIPA 3U3GA 5J2PA 1NGJA 3MN7A 4CZFA 3AVMA 4J2EA 1JXBA 5CYQA 2HW3A 2NZTA 4KHWA 1P90A 3HOTA 4HWIA 1RTDA 5J2NA 3KVGA 4GVEA 3CCSN 3MX2A 2UXDK 3SK3A 5C15A 3NAEA 4K41A 3EL2A 4DR1K 2A40A 1KFSA 5M1NA 3TANA 1HNIA 4DHYA 1BA0A 1QVFM 4JD2A 2XO7A 2GTDA 3CYMA 4FK4A 1VQ9N 2FC0A 4JV5K 4C8MA 4DV1K 2NRVA 3S3NA 2O8FB 1HYVA 4BGAA 3ZT4A 2I7NA 4NB4A 3VTHA 2YJEA 3NF6A 3VQ6A 2E8AA 5BPLA 3QFUA 3M6GA 2D0PA 4K25A 3VQDA 1GOCA 4OX9K 2G8IA 4JAXA 5FLXO 4IZ9A 3QEIA 2ATQA 1NK9A 1L3SA 4O5BA 5AQOA 3HPGA 1S72N 4DR7K 1A5XA 1HKCA 4Z4CA 3I55N 3L3VA 2QEXN 3C7NA 4YHHK 4DU1A 1IH7A 3M1FA 1TYQB 2E4LA 3FZFA 2E88A 3TPQA 3K5LA 3AY9A 2NRWA 4IOXA 3DLBA 3HI0A 3TTCA 2QWOA 3TAEA 3K58A 3WEEB 2O8BB 4N41A 4OPAA 4C1NI 2HBLA 4H4OA 5KGWA 1R0AA 5HRSA 4YOYA 2YJFA 2ASMA 4CGIA 4CJ7A 3IFRA 1S1WA 1CZBA 4E1MA 3A5MC 3FZKA 3IS9A 4KTWA 2NRZA 3EN9A 4JK8A 2P9SA 4CEEA 4BVOA 3LALA 4BWJA 4H5VA 1KVCA 4PL8A 3O9QA 4CF2A 3CC7N 3V1QA 4Q5VA 1VQ6N 3AO5A 1U04A 1BWFO 3V1RA 3KIOA 3O80A 3MEDA 2X6SA 1ATNA 4DFJA 1VSFA 2Z1IA 3LP2A 4CZKA 1IV0A 5HBMA 3VGKA 5A2QO 1BCOA 1GLAG 4H5WA 1YTAA 5KRTA 1JJ2M 4JKGA 3ID6A 5KTQA 4CZHA 4BRDA 1E4GT 3DJCA 3ZSZA 1NJYA 3QNOA 1K6YA 4CZIA 4KHPK 2HF3A 5BRDA 1XNRK 1FK9A 1CZAN 3AO4A 3C0BA 3PIPL 3OYKA 2UXBK 1ILYA 2D0OA 5GIOA 2WOMA 2V7ZA 3CG7A 4E7JA 1LW0A 3S9HA 5J2QA 4DTJA 5GINA 1TKXA 1VRTA 4KPYA 2UUCK 3IUCA 5AJ3K 1C0FA 5KPTA 3R6MA 3O1WA 2QM1A 4LSLA 4BRNA 3TWHA 2YI1A 4XEIA 4CEQA 2FSNA 3ZT3A 4J2AA 5AQWA 3UKRA 4FYDA 3JXUA 1DLOA 4FL9A 4H5NA 4F9OA 4KRFA 1YJNN 1TKTA 2WFBA 1BGXT 4FWQA 4CHNA 3KD1E 4WE1A 4CBWA 4LFCK 1L3UA 5GADP 1RFQA 5KPZA 1YJWN 1EP4A 2OPPA 4CHYA 3SQ2A 4GMJB 3LAKA 4DFPA 2D1KA 3G4SN 3THXA 4CEZA 1JCFA 4FWNA 3O5BA 4YOXA 4MQ3A 4N76A 1J6ZA 2PAVA 3KWGA 1ITGA 2F4VK 3HYFA 1V4TA 2P9IB 4H8KA 3VQAA 4KBOA 2IVNA 1TL3A 1U4BA 4A2BA 4I7FA 2ASPA 4M3YA 1OKJA 1YTUA 5LMNK 1K8AO 1LV5A 4QS9A 3ZSQA 1Y64A 3AARA 2GWKA 1VSLA 3G6EN 4FLYA 4BDPA 3DXMB 1XC3A 2UUBK 2NUBA 4FWOA 4EIAA 1HNVA 2ZJPL 2QA4N 1N36K 5DM7L 2IDOA 5CE3A 1KXPA 2GUPA 3RR7A 1QZ6A 1Q8IA 3KZBA 1HUXA 3UKUA 1TK0A 1IKYA 4KH6A 4DWIA 2XY5A 2ZQBA 4MDBA 2GBZA 4CEAA 3VEYA 3NHGA 4B1ZA 3K0SA 1X3MA
chains in the Genus database with same CATH topology
2DFFA 3L3UA 2QKBA 2B4JA 3O4NA 1WSIA 3V9WA 1WSFA 3OYNA 1EETA 1RDCA 2I5JA 4O0JA 5C24A 1VK0A 4E1NA 4OGCA 3K57A 4B8AB 4ICLA 3SI6A 4CEFA 4FJJA 1RDBA 1A5VA 3KLGA 1KCFA 4CF8A 2B6AA 3AA5X 3JSMA 4AHTA 3LZJA 1W9HA 4E0DA 5KGXA 5E41A 3SPZA 1BHLA 4FJ9A 4JRPA 3T1AA 4HUEA 4AILC 1TKDA 1QQCA 4CEOA 2HHUA 1WSJA 3IG1A 4CCHA 2IAJA 4CGGA 4BE0A 3SQ1A 4RG8A 1IO2A 2OPRA 4FLWA 1X9SA 1B92A 3SUNA 1RILA 4TSXA 3MEGA 3G0ZA 1RT5A 1FKPA 3AO3A 4FM2A 5SZTA 2DFHA 3SUOA 4FXDA 5HROA 3V9ZA 2BANA 4CEBA 4CJRA 3I8DA 1L3TA 4FCYA 3THVA 3SV4A 2ITGA 4RW9A 1RCHA 1S9EA 3AVIA 3OYJA 4E3SA 4KREA 1KFDA 3F9KA 4DTRA 1CLQA 4M3ZA 1X1PA 2D0CA 4JLHA 2GUIA 3KLHA 3QERA 4CK2A 4FJIA 4I9LA 4DTNA 4CF1A 1HQEA 4F2SA 3SUPA 1SL1A 1VSJA 3CM5A 4BDZA 3QIOA 4W5RA 3U6FA 2HHVA 4M3RA 3AV9A 4B9LA 1Z25A 1VSDA 1DTTA 2W42A 4F3TA 1CZ9A 3LAMA 3OYCA 1J54A 3ZT1A 3HJFA 4OLAA 3OYDA 2XY6A 1Q9XA 2HHQA 3KK1A 3SV3A 1VSHA 3HVRA 2JLEA 4AHRA 4EZ6A 1MU2A 4O4GA 3L2UA 3MAQA 3HPHA 3M8PA 4FLXA 3K5MA 3LDSA 3OJSA 3B6PA 1VSEA 3DLKA 1RBSA 2P1JA 2G8UA 3SJJA 4N47A 4DTMA 4FW1A 3VQQA 4FJXA 1S1XA 2Q3SA 3QLHA 4FLVA 1S9GA 3AVLA 2X6NA 3AA4A 3MEEA 4O44A 4E7IA 2ZD1A 3AVKA 3OYLA 2OZMA 1S1VA 4B3OA 1IKWA 3SUQA 4KHQA 1UAXA 1WSHA 1BIUA 4CHOA 1SL2A 3QEWA 2OA8A 4CFAA 4FJGA 3VQBA 4AH9A 5SWMA 1BISA 1Z26A 3OYHA 3ISNC 3SNNA 1TK8A 4YFUA 2IS3A 3EY1A 3VQ9A 3M8SA 2DTUA 4IDKA 3L2VA 4HUGA 1T05A 4OPKA 1NJWA 1T7PA 3BDPA 1HYZA 4FJ7A 3B6OA 3TR8A 4R5PA 4JRQA 3I0SA 4CEDA 4KHYA 3OJUA 4DQSA 3HM9A 2HVIA 1J53A 2VG6A 4CHZA 4C8OA 4ID1A 2BE2A 4CHPA 3T3FA 1NK7A 1RDAA 2YKMA 5HRRA 4DG1A 4LD0A 3CQ8A 3NH0A 3VQ5A 1QSYA 1C0MA 1QHTA 1HPZA 3DRPA 2P51A 1TAQA 4PQUA 4HVJA 4E7HA 1Y97A 4RW7A 3OVNA 2XRIA 4BDYA 2YHAA 2AJQA 1VRUA 1KVAA 4AHCA 4W5TA 1D5AA 4B9VA 4I9QA 1ZBFA 4O0IA 2KTQA 4CK3A 4CJEA 3OYEA 3LWLA 1HJRA 3AA2A 4DTSA 4FK0A 1IKXA 1YT3A 4OGEA 3LP0A 4OKEA 3OS0A 2Y1JA 1NKEA 2VWKA 3K5NA 4DSKA 4FJLA 5CY4A 4ZTJA 3KTQA 3HVTA 4Z4GA 4PWDA 1T03A 1NJZA 2OPSA 3MXJA 1X9MA 3VA0A 4CJWA 4CFBA 1N5YA 5KI6A 3MXMA 2PYLA 1KLNA 3DM2A 4CGDA 4DU4A 1C0TA 1XC9A 3OYIA 1C1AA 3K5OA 1O1WA 4I2QA 4O55A 3WNFA 4AHVA 4FJ8A 1SV5A 3AVFA 2G8HA 4E7LA 4DFMA 3DRSA 4CERA 3M8QA 3AVHA 4IG3A 1NK0A 4OVLA 3JYTA 4W5OA 4N56A 3VA3A 3DOLA 2RN2A 3C6TA 4OKJA 3WNHA 3NGIA 4DTUA 3PO5A 2OZSA 4KKOA 4GVMA 1SUQA 5K14A 1TGOA 4HCBA 3ALYA 3VQPA 3P83D 3PUFA 1HYSA 4CJKA 4K8ZA 1JXEA 3MECA 2EX3A 2D5RA 3SZ2A 3V9UA 1BQMA 3TI0A 4Z4EA 1B9DA 4DQRA 4M3XA 1KLMA 3HL8A 4LSNA 1WAFA 1XHXA 3DLHA 4C8LA 4I2PA 3HP9A 3PX6A 2KZZA 4RW6A 3NF7A 5CYMA 4M3UA 3LP1A 1GOBA 2YNHA 1QSSA 4AHSA 3KLIA 4B9TA 4GW6A 1SKWA 4DSFA 1ASVA 5T7BA 3AVCA 5DK5A 3ZSXA 2PY5A 1JLBA 3LZIA 1YVUA 4W5QA 1WSEA 2YV0X 3HSTB 3TAMA 5HRPA 1DTQA 4NCAA 4CJ3A 2X78A 1EX4A 4KO0A 5J2MA 2JGUA 2HNZA 4IFVA 4NYFA 4IKFA 1U47A 1UOCA 4FLUA 4FZZA 3WNEA 4FZXC 4KI6A 3RMDA 3D45A 3I0RA 4CJ4A 4UQGA 2XY7A 3ZT2A 4CGJA 3AO2A 1QE1A 5EU7A 3HP6A 3L8BA 1ZYQA 3L2WA 1TKZA 3RTVA 1XHZA 1SL0A 1A5WA 3A2FA 1CXUA 3O3HA 3RWUA 4KHSA 3TABA 1S1UA 3QEXA 1RT4A 4JS5A 1SKSA 4FK2A 4BACA 1T8EA 3QIPA 3U3GA 4DF8A 5J2PA 2ZE2A 2RF2A 3OS2A 4J2EA 2RKIA 3S3OA 3AVMA 4OLBA 4CFDA 1KTQA 1JXBA 5CYQA 2YHBA 2HW3A 1JLCA 3IRXA 4EP4A 3V9SA 4HHTA 1RBUA 3IAYA 4KHWA 4DSIA 2Z1HA 4FJHA 1KRPA 1TL1A 1RTDA 4DU3A 3AVJA 5J2NA 3V1OA 1I3AA 3HK2A 2HHXA 2O4IA 2PZSA 2O4GA 3ITHA 3F73A 3NAEA 3SCXA 2QK9A 4Q0BA 1U49A 3EZ5A 5FROA 1KFSA 4CJPA 3DMJA 3TANA 1FXXA 2HNYA 3KK2A 1HNIA 4KHNA 4CESA 2FBXA 3NE6A 3DI6A 3U3YA 4EZ9A 3L2RA 3E01A 1U45A 1FKOA 4CJUA 2XO7A 4ID5A 3CYMA 3K59A 4K8XA 3CFPA 4FK4A 2FC0A 4M41A 4C8MA 2BGGA 1W0HA 4CJLA 1LW2A 3NH1A 3S3NA 2P5OA 4FM0A 1LAWA 4F4KA 4C8NA 1HYVA 3C94A 3DYAA 3O4QA 3ZT4A 3O3FA 3NDKA 2LSNA 5C42A 2D0AA 5D3GA 1S5JA 1EXQA 5I42A 1IG9A 3KKSA 3HPOA 3NF6A 4CJTA 3VQ6A 3SPYA 1X9WA 1J5OA 3ULDA 1D9FA 2HMIA 4KFBA 3VQDA 1GOCA 2G8IA 4XIUA 2IC3A 3DLRA 3V6DA 3PO4A 3SQ0A 5JS2A 4RW4A 4RW8A 4DSLA 3PX4A 3ZT0A 4CJ5A 3QEIA 2ATQA 1NK9A 1L3SA 4O5BA 4CK1A 3HPGA 4QCLA 1NOZA 1A5XA 2HHTA 3QNNA 1I39A 4B8CA 4Z4CA 3L3VA 4CGFA 4E89A 4DLGA 2FBYA 3TAPA 4F2RA 4DU1A 2HVHA 1IH7A 1IKVA 3OY9A 1QSLA 2IGIA 1JL2A 2VWJA 3NBPA 4DF4A 1WAJA 1NK5A 1D9DA 2E4LA 2E6MA 3K5LA 1ZBHA 5FRMA 2KFZA 3DLBA 1KVBA 3D0PA 3LWMA 4FVMA 2Z1JA 4DMNA 4JS4A 4FJNA 1WSGA 1XWLA 3K58A 4CIEA 3TAEA 1BIZA 1BI4B 4N41A 2HHSA 3VQCA 4IFYA 2YNGA 4H4OA 1R0AA 5KGWA 4NCGA 5HRSA 3NH2A 1J9AA 3QEPA 1QS4A 1VSKA 2RPIA 4Z0UA 4YNQA 2G8VA 4LY7A 4FLZA 4CGIA 3CM6A 3QO9A 3T19A 4Z4HA 5C25A 4DQQA 3QETA 1S1WA 4ELUA 4DSJA 4DSEA 1S6PA 5J1EA 1S1TA 1CZBA 4KI4A 4E1MA 3IS9A 1JLQA 1VSIA 3P5JA 4KTWA 1D8YA 1WNSA 4CEEA 4DQIA 5HLFA 4KB0A 4CIFA 3LALA 4KAZA 4FZYA 1NKCA 4BWJA 2DY4A 4CJSA 1KVCA 3ZSRA 2KZMA 1LWFA 1BL3A 1C1CA 2E6LA 2DFEA 3RR8A 2FBTA 4CF2A 3V1QA 3VQEA 4Q5VA 3V9XA 3AO5A 5I3UA 1F21A 1U04A 3RRHA 1ZBIA 3V1RA 3KIOA 4MFBA 4BE2A 1Q9YA 3MEDA 4KTZA 3CFOA 1LAVA 4EP5A 2X6SA 4LH4A 3HO1A 4PA1A 4DFJA 1NJXA 4CJFA 1VSFA 2Z1IA 3LP2A 3NF9A 3QEVA 3KD5E 4ELVA 5HBMA 4Z4IA 1RT1A 4B08A 3OS1A 2GV9A 5CZ2A 5DMRA 2YNFA 1BCOA 3P1GA 5KRSA 2Z1GA 1BI4A 4BE1A 4G1QA 4CGHA 2QKKA 1YTAA 5KRTA 2KQ2A 4BWMA 4H4MA 3M8RA 3NGYA 3CFRA 5KTQA 3FFIA 3DLEA 2A1SA 1N6QA 2G8FA 4ZHRA 3UIQA 4FJMA 2KFNA 2YKNA 4CECA 2XHBA 3DOKA 3ZSZA 4KHUA 1NJYA 3QNOA 3TAQA 1UA1A 1SKRA 4OPJA 3PV8A 1K6YA 3BGRA 1REVA 3TAGA 1RBRA 4B9UA 3QINA 3KKRA 3AVBA 3VQ4A 3KJVA 4KTQA 1RBTA 2OPQA 4B9MA 3AO1A 1QTMA 1RTHA 1EKEA 4DLEA 2VG7A 1UA0A 5FRNA 4AHUA 1FK9A 1NK6A 1HMVA 3O3GA 1S6QA 1KSPA 3AO4A 1RTIA 3OYKA 2XY8A 3RRGA 1C1BA 2D0BA 3ZCMA 1LWEA 1RDDA 5HRNA 2WOMA 4E7JA 3CG7A 3VQ8A 1LW0A 1NOYA 1JLGA 3OYMA 4B9SA 3S9HA 5J2QA 4DTJA 4J2DA 3G10A 1TKXA 1VRTA 4LH5A 1JL1A 2QXFA 1TK5A 4KPYA 4CJQA 3V81A 1U48A 1UWBA 3C6UA 1C0UA 1TV6A 3AA3A 3RMAA 1HRHA 1NKBA 3PX0A 4M3WA 4E7KA 4LSLA 1RT2A 1LWCA 1ZBUA 4CEQA 3TWHA 3ZT3A 1RT6A 3QESA 3ZSOA 4J2AA 2F8SA 3KK3A 3DLGA 3LPTA 1VSMA 4CHQA 4FYDA 3K2PA 4HCCA 2F8TA 3OYAA 1DLOA 4CE9A 4FJKA 1TAUA 2IOCA 2R7YA 1WLJA 1JKHA 2EHGA 4KRFA 1TKTA 3NGZA 4DS5A 1BGXT 4DWIA 4CHNA 2BDPA 2A1RA 3KD1E 4WE1A 5FDLA 1L3UA 1GOAA 3OYBA 3LANA 1JLFA 3LP3A 4L8RB 1EP4A 2OPPA 4CHYA 3ZSWA 3SQ2A 3TARA 1JLAA 3H08A 3LAKA 4GMJB 4DTXA 4DFPA 4Z4FA 1CXQA 4OJRA 4J2BA 4OKKA 4CEZA 4FLTA 4ZTFA 5CZ1A 3ZSYA 2Y1IA 3RMCA 1RT7A 3NFAA 4MQ3A 4Y1DA 3NCIA 4KB1A 4N76A 1HQUA 2ETJA 4CF0A 2VG5A 4QOZB 1ITGA 3HYFA 4M42A 4PY5A 1RTJA 3L2QA 4FM1A 3OYGA 1C6VA 3HT3A 4DFKA 4H8KA 1RT3A 3VQAA 4CF9A 3LPUA 3TAFA 4W5NA 4E19A 4M45A 1L5UA 1TL3A 4HUFA 1U4BA 4C8KA 3HXMA 4I7FA 4CIGA 3OYFA 2OYQA 2F96A 4FW2A 1B9FA 4NCBA 4M3YA 4DTOA 3KLFA 1YTUA 4IBNA 3ZSVA 1LV5A 3VN5A 3VQ7A 4F3OA 2WONA 4DS4A 1JLEA 3ZSQA 2HHWA 3NF8A 3MXIA 4DQPA 3ASMA 4M3TA 3SQ4A 3AVNA 4KV8A 1VSLA 1WN7A 4FLYA 4BDPA 3AVGA 4IG0A 4CFCA 2KW4A 1BQNA 4B9NA 3S3MA 2G8WA 2NUBA 3RMBA 4ELTA 4FJ5A 3PY8A 1HNVA 4DTPA 3SYZA 4F8RA 2IDOA 5HP1A 3C95A 3WNGA 3KLEA 1RNHA 4CJVA 1BCMA 2G8KA 3RR7A 1Q8IA 1NK8A 1ASWA 1ZBLA 1IKYA 4HTUA 4N5SA 4QAGA 2XY5A 1RBVA 1XI1A 1TK0A 3AVAA 1ASUA 1G15A 2ZQBA 2HB5A 4PUOA 2GBZA 4CEAA 5JS1A 2PYJA 2HNDA 2YNIA 3NHGA 3V4IA 1NK4A 4Y1CA 2X74A 3DRRA 2B5JA 2FBVA 1L3VA 1TVRA 4NYNA 3EYZA 2P5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFF A;  3L3U A;  2QKB A;  2B4J A;  3O4N A;  1WSI A;  3V9W A;  1WSF A;  3OYN A;  1EET A;  1RDC A;  2I5J A;  4O0J A;  5C24 A;  1VK0 A;  4E1N A;  4OGC A;  3K57 A;  4B8A B;  4ICL A;  3SI6 A;  4CEF A;  4FJJ A;  1RDB A;  1A5V A;  3KLG A;  1KCF A;  4CF8 A;  2B6A A;  3AA5 X;  3JSM A;  4AHT A;  3LZJ A;  1W9H A;  4E0D A;  5KGX A;  5E41 A;  3SPZ A;  1BHL A;  4FJ9 A;  4JRP A;  3T1A A;  4HUE A;  4AIL C;  1TKD A;  1QQC A;  4CEO A;  2HHU A;  1WSJ A;  3IG1 A;  4CCH A;  2IAJ A;  4CGG A;  4BE0 A;  3SQ1 A;  4RG8 A;  1IO2 A;  2OPR A;  4FLW A;  1X9S A;  1B92 A;  3SUN A;  1RIL A;  4TSX A;  3MEG A;  3G0Z A;  1RT5 A;  1FKP A;  3AO3 A;  4FM2 A;  5SZT A;  2DFH A;  3SUO A;  4FXD A;  5HRO A;  3V9Z A;  2BAN A;  4CEB A;  4CJR A;  3I8D A;  1L3T A;  4FCY A;  3THV A;  3SV4 A;  2ITG A;  4RW9 A;  1RCH A;  1S9E A;  3AVI A;  3OYJ A;  4E3S A;  4KRE A;  1KFD A;  3F9K A;  4DTR A;  1CLQ A;  4M3Z A;  1X1P A;  2D0C A;  4JLH A;  2GUI A;  3KLH A;  3QER A;  4CK2 A;  4FJI A;  4I9L A;  4DTN A;  4CF1 A;  1HQE A;  4F2S A;  3SUP A;  1SL1 A;  1VSJ A;  3CM5 A;  4BDZ A;  3QIO A;  4W5R A;  3U6F A;  2HHV A;  4M3R A;  3AV9 A;  4B9L A;  1Z25 A;  1VSD A;  1DTT A;  2W42 A;  4F3T A;  1CZ9 A;  3LAM A;  3OYC A;  1J54 A;  3ZT1 A;  3HJF A;  4OLA A;  3OYD A;  2XY6 A;  1Q9X A;  2HHQ A;  3KK1 A;  3SV3 A;  1VSH A;  3HVR A;  2JLE A;  4AHR A;  4EZ6 A;  1MU2 A;  4O4G A;  3L2U A;  3MAQ A;  3HPH A;  3M8P A;  4FLX A;  3K5M A;  3LDS A;  3OJS A;  3B6P A;  1VSE A;  3DLK A;  1RBS A;  2P1J A;  2G8U A;  3SJJ A;  4N47 A;  4DTM A;  4FW1 A;  3VQQ A;  4FJX A;  1S1X A;  2Q3S A;  3QLH A;  4FLV A;  1S9G A;  3AVL A;  2X6N A;  3AA4 A;  3MEE A;  4O44 A;  4E7I A;  2ZD1 A;  3AVK A;  3OYL A;  2OZM A;  1S1V A;  4B3O A;  1IKW A;  3SUQ A;  4KHQ A;  1UAX A;  1WSH A;  1BIU A;  4CHO A;  1SL2 A;  3QEW A;  2OA8 A;  4CFA A;  4FJG A;  3VQB A;  4AH9 A;  5SWM A;  1BIS A;  1Z26 A;  3OYH A;  3ISN C;  3SNN A;  1TK8 A;  4YFU A;  2IS3 A;  3EY1 A;  3VQ9 A;  3M8S A;  2DTU A;  4IDK A;  3L2V A;  4HUG A;  1T05 A;  4OPK A;  1NJW A;  1T7P A;  3BDP A;  1HYZ A;  4FJ7 A;  3B6O A;  3TR8 A;  4R5P A;  4JRQ A;  3I0S A;  4CED A;  4KHY A;  3OJU A;  4DQS A;  3HM9 A;  2HVI A;  1J53 A;  2VG6 A;  4CHZ A;  4C8O A;  4ID1 A;  2BE2 A;  4CHP A;  3T3F A;  1NK7 A;  1RDA A;  2YKM A;  5HRR A;  4DG1 A;  4LD0 A;  3CQ8 A;  3NH0 A;  3VQ5 A;  1QSY A;  1C0M A;  1QHT A;  1HPZ A;  3DRP A;  2P51 A;  1TAQ A;  4PQU A;  4HVJ A;  4E7H A;  1Y97 A;  4RW7 A;  3OVN A;  2XRI A;  4BDY A;  2YHA A;  2AJQ A;  1VRU A;  1KVA A;  4AHC A;  4W5T A;  1D5A A;  4B9V A;  4I9Q A;  1ZBF A;  4O0I A;  2KTQ A;  4CK3 A;  4CJE A;  3OYE A;  3LWL A;  1HJR A;  3AA2 A;  4DTS A;  4FK0 A;  1IKX A;  1YT3 A;  4OGE A;  3LP0 A;  4OKE A;  3OS0 A;  2Y1J A;  1NKE A;  2VWK A;  3K5N A;  4DSK A;  4FJL A;  5CY4 A;  4ZTJ A;  3KTQ A;  3HVT A;  4Z4G A;  4PWD A;  1T03 A;  1NJZ A;  2OPS A;  3MXJ A;  1X9M A;  3VA0 A;  4CJW A;  4CFB A;  1N5Y A;  5KI6 A;  3MXM A;  2PYL A;  1KLN A;  3DM2 A;  4CGD A;  4DU4 A;  1C0T A;  1XC9 A;  3OYI A;  1C1A A;  3K5O A;  1O1W A;  4I2Q A;  4O55 A;  3WNF A;  4AHV A;  4FJ8 A;  1SV5 A;  3AVF A;  2G8H A;  4E7L A;  4DFM A;  3DRS A;  4CER A;  3M8Q A;  3AVH A;  4IG3 A;  1NK0 A;  4OVL A;  3JYT A;  4W5O A;  4N56 A;  3VA3 A;  3DOL A;  2RN2 A;  3C6T A;  4OKJ A;  3WNH A;  3NGI A;  4DTU A;  3PO5 A;  2OZS A;  4KKO A;  4GVM A;  1SUQ A;  5K14 A;  1TGO A;  4HCB A;  3ALY A;  3VQP A;  3P83 D;  3PUF A;  1HYS A;  4CJK A;  4K8Z A;  1JXE A;  3MEC A;  2EX3 A;  2D5R A;  3SZ2 A;  3V9U A;  1BQM A;  3TI0 A;  4Z4E A;  1B9D A;  4DQR A;  4M3X A;  1KLM A;  3HL8 A;  4LSN A;  1WAF A;  1XHX A;  3DLH A;  4C8L A;  4I2P A;  3HP9 A;  3PX6 A;  2KZZ A;  4RW6 A;  3NF7 A;  5CYM A;  4M3U A;  3LP1 A;  1GOB A;  2YNH A;  1QSS A;  4AHS A;  3KLI A;  4B9T A;  4GW6 A;  1SKW A;  4DSF A;  1ASV A;  5T7B A;  3AVC A;  5DK5 A;  3ZSX A;  2PY5 A;  1JLB A;  3LZI A;  1YVU A;  4W5Q A;  1WSE A;  2YV0 X;  3HST B;  3TAM A;  5HRP A;  1DTQ A;  4NCA A;  4CJ3 A;  2X78 A;  1EX4 A;  4KO0 A;  5J2M A;  2JGU A;  2HNZ A;  4IFV A;  4NYF A;  4IKF A;  1U47 A;  1UOC A;  4FLU A;  4FZZ A;  3WNE A;  4FZX C;  4KI6 A;  3RMD A;  3D45 A;  3I0R A;  4CJ4 A;  4UQG A;  2XY7 A;  3ZT2 A;  4CGJ A;  3AO2 A;  1QE1 A;  5EU7 A;  3HP6 A;  3L8B A;  1ZYQ A;  3L2W A;  1TKZ A;  3RTV A;  1XHZ A;  1SL0 A;  1A5W A;  3A2F A;  1CXU A;  3O3H A;  3RWU A;  4KHS A;  3TAB A;  1S1U A;  3QEX A;  1RT4 A;  4JS5 A;  1SKS A;  4FK2 A;  4BAC A;  1T8E A;  3QIP A;  3U3G A;  4DF8 A;  5J2P A;  2ZE2 A;  2RF2 A;  3OS2 A;  4J2E A;  2RKI A;  3S3O A;  3AVM A;  4OLB A;  4CFD A;  1KTQ A;  1JXB A;  5CYQ A;  2YHB A;  2HW3 A;  1JLC A;  3IRX A;  4EP4 A;  3V9S A;  4HHT A;  1RBU A;  3IAY A;  4KHW A;  4DSI A;  2Z1H A;  4FJH A;  1KRP A;  1TL1 A;  1RTD A;  4DU3 A;  3AVJ A;  5J2N A;  3V1O A;  1I3A A;  3HK2 A;  2HHX A;  2O4I A;  2PZS A;  2O4G A;  3ITH A;  3F73 A;  3NAE A;  3SCX A;  2QK9 A;  4Q0B A;  1U49 A;  3EZ5 A;  5FRO A;  1KFS A;  4CJP A;  3DMJ A;  3TAN A;  1FXX A;  2HNY A;  3KK2 A;  1HNI A;  4KHN A;  4CES A;  2FBX A;  3NE6 A;  3DI6 A;  3U3Y A;  4EZ9 A;  3L2R A;  3E01 A;  1U45 A;  1FKO A;  4CJU A;  2XO7 A;  4ID5 A;  3CYM A;  3K59 A;  4K8X A;  3CFP A;  4FK4 A;  2FC0 A;  4M41 A;  4C8M A;  2BGG A;  1W0H A;  4CJL A;  1LW2 A;  3NH1 A;  3S3N A;  2P5O A;  4FM0 A;  1LAW A;  4F4K A;  4C8N A;  1HYV A;  3C94 A;  3DYA A;  3O4Q A;  3ZT4 A;  3O3F A;  3NDK A;  2LSN A;  5C42 A;  2D0A A;  5D3G A;  1S5J A;  1EXQ A;  5I42 A;  1IG9 A;  3KKS A;  3HPO A;  3NF6 A;  4CJT A;  3VQ6 A;  3SPY A;  1X9W A;  1J5O A;  3ULD A;  1D9F A;  2HMI A;  4KFB A;  3VQD A;  1GOC A;  2G8I A;  4XIU A;  2IC3 A;  3DLR A;  3V6D A;  3PO4 A;  3SQ0 A;  5JS2 A;  4RW4 A;  4RW8 A;  4DSL A;  3PX4 A;  3ZT0 A;  4CJ5 A;  3QEI A;  2ATQ A;  1NK9 A;  1L3S A;  4O5B A;  4CK1 A;  3HPG A;  4QCL A;  1NOZ A;  1A5X A;  2HHT A;  3QNN A;  1I39 A;  4B8C A;  4Z4C A;  3L3V A;  4CGF A;  4E89 A;  4DLG A;  2FBY A;  3TAP A;  4F2R A;  4DU1 A;  2HVH A;  1IH7 A;  1IKV A;  3OY9 A;  1QSL A;  2IGI A;  1JL2 A;  2VWJ A;  3NBP A;  4DF4 A;  1WAJ A;  1NK5 A;  1D9D A;  2E4L A;  2E6M A;  3K5L A;  1ZBH A;  5FRM A;  2KFZ A;  3DLB A;  1KVB A;  3D0P A;  3LWM A;  4FVM A;  2Z1J A;  4DMN A;  4JS4 A;  4FJN A;  1WSG A;  1XWL A;  3K58 A;  4CIE A;  3TAE A;  1BIZ A;  1BI4 B;  4N41 A;  2HHS A;  3VQC A;  4IFY A;  2YNG A;  4H4O A;  1R0A A;  5KGW A;  4NCG A;  5HRS A;  3NH2 A;  1J9A A;  3QEP A;  1QS4 A;  1VSK A;  2RPI A;  4Z0U A;  4YNQ A;  2G8V A;  4LY7 A;  4FLZ A;  4CGI A;  3CM6 A;  3QO9 A;  3T19 A;  4Z4H A;  5C25 A;  4DQQ A;  3QET A;  1S1W A;  4ELU A;  4DSJ A;  4DSE A;  1S6P A;  5J1E A;  1S1T A;  1CZB A;  4KI4 A;  4E1M A;  3IS9 A;  1JLQ A;  1VSI A;  3P5J A;  4KTW A;  1D8Y A;  1WNS A;  4CEE A;  4DQI A;  5HLF A;  4KB0 A;  4CIF A;  3LAL A;  4KAZ A;  4FZY A;  1NKC A;  4BWJ A;  2DY4 A;  4CJS A;  1KVC A;  3ZSR A;  2KZM A;  1LWF A;  1BL3 A;  1C1C A;  2E6L A;  2DFE A;  3RR8 A;  2FBT A;  4CF2 A;  3V1Q A;  3VQE A;  4Q5V A;  3V9X A;  3AO5 A;  5I3U A;  1F21 A;  1U04 A;  3RRH A;  1ZBI A;  3V1R A;  3KIO A;  4MFB A;  4BE2 A;  1Q9Y A;  3MED A;  4KTZ A;  3CFO A;  1LAV A;  4EP5 A;  2X6S A;  4LH4 A;  3HO1 A;  4PA1 A;  4DFJ A;  1NJX A;  4CJF A;  1VSF A;  2Z1I A;  3LP2 A;  3NF9 A;  3QEV A;  3KD5 E;  4ELV A;  5HBM A;  4Z4I A;  1RT1 A;  4B08 A;  3OS1 A;  2GV9 A;  5CZ2 A;  5DMR A;  2YNF A;  1BCO A;  3P1G A;  5KRS A;  2Z1G A;  1BI4 A;  4BE1 A;  4G1Q A;  4CGH A;  2QKK A;  1YTA A;  5KRT A;  2KQ2 A;  4BWM A;  4H4M A;  3M8R A;  3NGY A;  3CFR A;  5KTQ A;  3FFI A;  3DLE A;  2A1S A;  1N6Q A;  2G8F A;  4ZHR A;  3UIQ A;  4FJM A;  2KFN A;  2YKN A;  4CEC A;  2XHB A;  3DOK A;  3ZSZ A;  4KHU A;  1NJY A;  3QNO A;  3TAQ A;  1UA1 A;  1SKR A;  4OPJ A;  3PV8 A;  1K6Y A;  3BGR A;  1REV A;  3TAG A;  1RBR A;  4B9U A;  3QIN A;  3KKR A;  3AVB A;  3VQ4 A;  3KJV A;  4KTQ A;  1RBT A;  2OPQ A;  4B9M A;  3AO1 A;  1QTM A;  1RTH A;  1EKE A;  4DLE A;  2VG7 A;  1UA0 A;  5FRN A;  4AHU A;  1FK9 A;  1NK6 A;  1HMV A;  3O3G A;  1S6Q A;  1KSP A;  3AO4 A;  1RTI A;  3OYK A;  2XY8 A;  3RRG A;  1C1B A;  2D0B A;  3ZCM A;  1LWE A;  1RDD A;  5HRN A;  2WOM A;  4E7J A;  3CG7 A;  3VQ8 A;  1LW0 A;  1NOY A;  1JLG A;  3OYM A;  4B9S A;  3S9H A;  5J2Q A;  4DTJ A;  4J2D A;  3G10 A;  1TKX A;  1VRT A;  4LH5 A;  1JL1 A;  2QXF A;  1TK5 A;  4KPY A;  4CJQ A;  3V81 A;  1U48 A;  1UWB A;  3C6U A;  1C0U A;  1TV6 A;  3AA3 A;  3RMA A;  1HRH A;  1NKB A;  3PX0 A;  4M3W A;  4E7K A;  4LSL A;  1RT2 A;  1LWC A;  1ZBU A;  4CEQ A;  3TWH A;  3ZT3 A;  1RT6 A;  3QES A;  3ZSO A;  4J2A A;  2F8S A;  3KK3 A;  3DLG A;  3LPT A;  1VSM A;  4CHQ A;  4FYD A;  3K2P A;  4HCC A;  2F8T A;  3OYA A;  1DLO A;  4CE9 A;  4FJK A;  1TAU A;  2IOC A;  2R7Y A;  1WLJ A;  1JKH A;  2EHG A;  4KRF A;  1TKT A;  3NGZ A;  4DS5 A;  1BGX T;  4DWI A;  4CHN A;  2BDP A;  2A1R A;  3KD1 E;  4WE1 A;  5FDL A;  1L3U A;  1GOA A;  3OYB A;  3LAN A;  1JLF A;  3LP3 A;  4L8R B;  1EP4 A;  2OPP A;  4CHY A;  3ZSW A;  3SQ2 A;  3TAR A;  1JLA A;  3H08 A;  3LAK A;  4GMJ B;  4DTX A;  4DFP A;  4Z4F A;  1CXQ A;  4OJR A;  4J2B A;  4OKK A;  4CEZ A;  4FLT A;  4ZTF A;  5CZ1 A;  3ZSY A;  2Y1I A;  3RMC A;  1RT7 A;  3NFA A;  4MQ3 A;  4Y1D A;  3NCI A;  4KB1 A;  4N76 A;  1HQU A;  2ETJ A;  4CF0 A;  2VG5 A;  4QOZ B;  1ITG A;  3HYF A;  4M42 A;  4PY5 A;  1RTJ A;  3L2Q A;  4FM1 A;  3OYG A;  1C6V A;  3HT3 A;  4DFK A;  4H8K A;  1RT3 A;  3VQA A;  4CF9 A;  3LPU A;  3TAF A;  4W5N A;  4E19 A;  4M45 A;  1L5U A;  1TL3 A;  4HUF A;  1U4B A;  4C8K A;  3HXM A;  4I7F A;  4CIG A;  3OYF A;  2OYQ A;  2F96 A;  4FW2 A;  1B9F A;  4NCB A;  4M3Y A;  4DTO A;  3KLF A;  1YTU A;  4IBN A;  3ZSV A;  1LV5 A;  3VN5 A;  3VQ7 A;  4F3O A;  2WON A;  4DS4 A;  1JLE A;  3ZSQ A;  2HHW A;  3NF8 A;  3MXI A;  4DQP A;  3ASM A;  4M3T A;  3SQ4 A;  3AVN A;  4KV8 A;  1VSL A;  1WN7 A;  4FLY A;  4BDP A;  3AVG A;  4IG0 A;  4CFC A;  2KW4 A;  1BQN A;  4B9N A;  3S3M A;  2G8W A;  2NUB A;  3RMB A;  4ELT A;  4FJ5 A;  3PY8 A;  1HNV A;  4DTP A;  3SYZ A;  4F8R A;  2IDO A;  5HP1 A;  3C95 A;  3WNG A;  3KLE A;  1RNH A;  4CJV A;  1BCM A;  2G8K A;  3RR7 A;  1Q8I A;  1NK8 A;  1ASW A;  1ZBL A;  1IKY A;  4HTU A;  4N5S A;  4QAG A;  2XY5 A;  1RBV A;  1XI1 A;  1TK0 A;  3AVA A;  1ASU A;  1G15 A;  2ZQB A;  2HB5 A;  4PUO A;  2GBZ A;  4CEA A;  5JS1 A;  2PYJ A;  2HND A;  2YNI A;  3NHG A;  3V4I A;  1NK4 A;  4Y1C A;  2X74 A;  3DRR A;  2B5J A;  2FBV A;  1L3V A;  1TVR A;  4NYN A;  3EYZ A;  2P5G A; 
#chains in the Genus database with same CATH topology
 1WSI A;  3V9W A;  1WSF A;  3OYN A;  1MWM A;  1VK0 A;  4B8A B;  4FJJ A;  1RDB A;  3KLG A;  3ZET A;  2P9U A;  4BC3 A;  1K8K B;  3AA5 X;  3JSM A;  4AHT A;  1W9H A;  5KGX A;  2O8C B;  4JHD A;  1OH7 A;  1NU0 A;  5BR8 K;  4WF9 L;  4Z94 A;  4AIL C;  4EAH D;  5JMV A;  4DKW A;  1X9S A;  4TSX A;  2P9N B;  4JKC A;  3C6H A;  3AO3 A;  3H3O B;  2DFH A;  4BR9 A;  3THW B;  3I8D A;  4CEB A;  4CJR A;  1L3T A;  4FCY A;  2P9N A;  3SV4 A;  2ITG A;  4RW9 A;  4KRE A;  1S9E A;  3AVI A;  3OYJ A;  4E3S A;  4A59 A;  3F9K A;  1CLQ A;  4DUZ K;  3GOI A;  4FJI A;  4CZG A;  4CF1 A;  1HQE A;  1T6D A;  3AV9 A;  1DTT A;  2W42 A;  3THY B;  4F3T A;  1W97 L;  2HHQ A;  2XY6 A;  3SV3 A;  1VSH A;  2JLE A;  3D2F A;  4AHR A;  3CIP A;  4ISE A;  3OJS A;  3B6P A;  2HHH K;  1HLU A;  5AQF A;  2P1J A;  5AQU A;  4DTM A;  3UKR B;  4FW1 A;  1S1X A;  3AVL A;  3AVK A;  4B3O A;  4A5B A;  3SUQ A;  4KHQ A;  4C23 A;  3K9K A;  3QEW A;  2OA8 A;  4JKA A;  3RSE A;  4CFA A;  3VQB A;  1BIS A;  1XQS C;  2DTU A;  4IDK A;  5AR0 A;  1NJW A;  1VQ4 N;  3BDP A;  1HYZ A;  3BP8 A;  2Q31 A;  4R5P A;  3I0S A;  4JK7 A;  4CED A;  1ZXO A;  4YOT A;  3DXM A;  3QBW A;  5AZJ A;  4RWT A;  2BE2 A;  5AQZ A;  3T3F A;  3IKM A;  3THX B;  2YKM A;  1OH8 A;  5HRR A;  1ESV A;  1YVN A;  3VQ5 A;  1QHT A;  3HBT A;  3SBG A;  2HBM A;  3OVN A;  1K9M O;  1VRU A;  3QBX A;  4I9Q A;  4CJE A;  1GLC G;  3AA2 A;  1IBL K;  2NNW A;  3D7E O;  3K5N A;  4FJL A;  4PWD A;  5CY4 A;  4BG8 A;  3KTQ A;  3TSQ A;  4CFB A;  5KI6 A;  1KLN A;  2FSJ A;  3DM2 A;  4CGD A;  1XC9 A;  3OYI A;  1C1A A;  1O1W A;  4I2Q A;  4AHV A;  1MWK A;  1V4S A;  4MLE A;  3LDO A;  4IG3 A;  3VA3 A;  3DOL A;  2RN2 A;  3NGI A;  1E3M A;  2UU9 K;  1SUQ A;  3AGK A;  1XMO K;  1Q81 O;  4CJK A;  4K8Z A;  1BG3 A;  5AQX A;  3V9U A;  1B9D A;  3O1B A;  3HL8 A;  4C8L A;  3OBW A;  3PX6 A;  2KZZ A;  4RW6 A;  3NF7 A;  3E9L A;  4B1Y B;  3QML A;  4GW6 A;  5T7B A;  3E1Y A;  5DK5 A;  3ZSX A;  2PY5 A;  1NJI O;  4FPB A;  4AM7 A;  1KQS M;  1DTQ A;  1KAX A;  4CJ3 A;  1EX4 A;  4KO0 A;  1NGD A;  2NRR A;  4IFV A;  2W6L A;  2ZM6 K;  4IKF A;  1U47 A;  4KI6 A;  4AM6 A;  4JK9 A;  4CJ4 A;  4UQG A;  3MWP A;  4CGJ A;  3AO2 A;  1QE1 A;  5EU7 A;  3L8B A;  1ZYQ A;  1SL0 A;  1ATS A;  3TAB A;  1S1U A;  1N34 K;  1RT4 A;  4FK2 A;  4BAC A;  1WBD A;  4DQ8 A;  2Q36 A;  1GLF O;  2RF2 A;  4CFD A;  4B3T K;  2YHB A;  1JLC A;  4EP4 A;  1RBU A;  5I9E B;  3LM9 A;  3U8X A;  4DU3 A;  3V1O A;  2HHX A;  2O4I A;  1NGI A;  2O4G A;  3ITH A;  3T69 A;  3F73 A;  1W2B M;  2QK9 A;  2O8D A;  5BN9 A;  3VMF B;  5AFU H;  3MN9 A;  2AA4 A;  2KKZ A;  2ITM A;  4KHN A;  4BRM A;  3NE6 A;  1FW6 A;  5AQP A;  3DI6 A;  3E01 A;  3JS6 A;  4CJU A;  4K8X A;  4ID5 A;  3CFP A;  3FFK B;  4M41 A;  5HL7 L;  3U9Z A;  3KHY A;  1LW2 A;  3D6R A;  5AQG A;  4CJL A;  2E2N A;  3O4Q A;  3C94 A;  3O3F A;  3Q7B A;  5D3G A;  4GV3 A;  5I42 A;  4IOA L;  1IG9 A;  4DV5 K;  4CJT A;  2HMI A;  4KFB A;  4LFB K;  4YOV A;  4CBU A;  3DLR A;  4RW8 A;  4BRC A;  4DSL A;  3ZT0 A;  5TKY A;  4CJ5 A;  3CET A;  1TUU A;  4QCL A;  2HHT A;  4DLG A;  2HVH A;  4F2R A;  2QI2 A;  3ATV A;  2Q2R A;  1JL2 A;  3AAQ A;  1WAJ A;  3CJ9 A;  4B9Q A;  1ZBH A;  5FRM A;  2KFZ A;  3LWM A;  2Z1J A;  4FJN A;  1XWL A;  4CIE A;  1BIZ A;  5B8H A;  2HHS A;  3NH2 A;  1DT9 A;  1GLL O;  1QS4 A;  2QTD A;  2RPI A;  3BF1 A;  4Z0U A;  4BY9 C;  3T19 A;  4DQQ A;  4LF5 K;  3WXK A;  1SZ2 A;  3PIO L;  3VEX A;  5LMU K;  1VSI A;  3P5J A;  1D8Y A;  4IWV A;  1HR0 K;  1X3N A;  5HLF A;  1YIT N;  4CIF A;  4KB0 A;  1SS6 A;  4FZY A;  2O8F A;  2ZJQ L;  4CJS A;  3ZSR A;  1LWF A;  1BL3 A;  1C1C A;  2FBT A;  3DXK A;  5LJW A;  3VQE A;  3V9X A;  3G71 N;  4BC2 A;  1RDU A;  3RRH A;  1D4X A;  4BE2 A;  1Q9Y A;  3DXK B;  1OH6 A;  4KTZ A;  3O9U A;  4CJF A;  4DB3 A;  3NF9 A;  4Z4I A;  1DKG D;  1RT1 A;  3OS1 A;  2GV9 A;  3SMP A;  1Q7Y O;  5CZ2 A;  5KRS A;  3P1G A;  3CME N;  3CCM N;  5KQ8 A;  3MDQ A;  3J7Y P;  3FE1 A;  4CGH A;  4BE1 A;  4H5T A;  2KQ2 A;  2P9L A;  3NGY A;  3CFR A;  3FFI A;  5M1K A;  2E1Y A;  2G8F A;  4ZHR A;  2KFN A;  4CEC A;  3OBY A;  4KHU A;  1SKR A;  2RHK A;  1LCU A;  1RBR A;  3KKR A;  3VQ4 A;  3KK7 A;  3KJV A;  3AO1 A;  4HTL A;  1QTM A;  1RTH A;  2OTJ N;  3CXC M;  5BPM A;  1NK6 A;  3ENB A;  1HMV A;  4DR6 K;  1S6Q A;  1KSP A;  2XY8 A;  3RRG A;  5HRN A;  4WFB L;  3VQ8 A;  1JLG A;  5EOY A;  4LH5 A;  1JL1 A;  2QXF A;  3JAM O;  5H1S Q;  4XH5 A;  4H0O A;  3D2F B;  1TV6 A;  1NKB A;  2V7Y A;  2A3Z A;  1VQ5 N;  1RT2 A;  1ZBU A;  1RT6 A;  3ZSO A;  3KK3 A;  3ZEU A;  4CHQ A;  3K2P A;  3OYA A;  2UYT A;  4IO8 A;  2R7Y A;  1BDG A;  1JKH A;  2EHG A;  4BRE A;  2IVP A;  1S3X A;  3VOV A;  4DS5 A;  3F9M A;  1K73 O;  2BDP A;  3HM8 A;  3I56 N;  5FDL A;  3GBT A;  3LAN A;  3OYB A;  3LP3 A;  1WBB A;  4L8R B;  4DR4 K;  1IBM K;  4DTX A;  4Z4F A;  1CXQ A;  4OJR A;  4J2B A;  5EY4 A;  4ZTF A;  1WOQ A;  3RMC A;  4KB1 A;  3NFA A;  3NCI A;  2ETJ A;  4CF0 A;  1QQM A;  2VG5 A;  3S41 A;  3H6E A;  2WBN A;  4PY5 A;  3L2Q A;  3CPE A;  3H46 O;  1EO1 A;  3OYG A;  3HT3 A;  1YXQ A;  4H0X B;  3VF2 A;  3TAF A;  4W5N A;  3CI5 A;  4WQ4 A;  1L5U A;  3OYF A;  3A8Y A;  4NCB A;  4DTO A;  3KLF A;  4LC9 B;  3ZSV A;  3VN5 A;  3VQ7 A;  2HHW A;  3SBT A;  3NF8 A;  4DQP A;  3ASM A;  3DWL A;  4KV8 A;  2O8D B;  1WN7 A;  2P9L B;  3J81 O;  4B1W B;  3S3M A;  2IIR A;  3PY8 A;  3MCP A;  1YF5 L;  3KLE A;  3R8E A;  1N8R O;  1NK8 A;  1ASW A;  3BZK A;  3AVA A;  1G15 A;  2HB5 A;  5JS1 A;  2PYJ A;  2HND A;  4GV6 A;  4ISF A;  2X74 A;  1EQY A;  3DRR A;  2FBV A;  1MA9 B;  3O9T A;  4PKG A;  3EYZ A;  2P5G A;  1NGF A;  2CGK A;  1GLB G;  2QKB A;  4H0Y B;  1EET A;  1RDC A;  5C24 A;  4OGC A;  3DLL L;  4V19 S;  5C2F A;  4CF8 A;  2B6A A;  1XMQ K;  1TUY A;  2J4R A;  4B3R K;  4LF9 K;  4JRP A;  2HHU A;  1WSJ A;  1HX1 A;  1IO2 A;  3GE1 A;  1B92 A;  3SUN A;  4ISG A;  3SUO A;  4FXD A;  5HRO A;  5LY3 A;  1RCH A;  4CVN E;  3R1X A;  4JI0 K;  1KFD A;  1VQL N;  3AGR A;  4M3Z A;  2D0C A;  2GUI A;  4IXC A;  4H0P A;  3EEQ A;  3MN6 A;  3TU5 A;  4F2S A;  1VSJ A;  4JI6 K;  4GNI A;  3E9O A;  3EE8 A;  4M3R A;  4L3Q A;  3CCE N;  4AF1 A;  4FO0 A;  1H1V A;  4QS7 A;  1J54 A;  3W0L A;  3OYD A;  3E66 A;  3HVR A;  4FWR A;  4O4G A;  3MAQ A;  3P31 A;  3HPH A;  3LDS A;  3A5L C;  1VSE A;  3DLK A;  1RBS A;  3QLH A;  3MEE A;  2ZD1 A;  3W3D A;  3OYL A;  2OZM A;  1IKW A;  3C6A A;  4LF4 K;  3CF5 L;  4CHO A;  1SL2 A;  1KC8 O;  4DV2 K;  2HBJ A;  2NLX A;  5TKW A;  4FJG A;  5AQJ A;  1TK8 A;  1Z26 A;  3VQ9 A;  4HUG A;  3EE9 A;  4OPK A;  4BC4 A;  4FJ7 A;  3O9S A;  3HM9 A;  3K9J A;  2VG6 A;  4C8O A;  1LOT B;  3GDQ A;  2ZGZ A;  1NBW A;  4OPH A;  1C0M A;  1QSY A;  4PQU A;  2E2Q A;  3OTO K;  2EWS A;  2XRI A;  5F2R A;  4AHC A;  2KHO A;  3LWL A;  4BQZ A;  4DTS A;  3CC2 N;  4FK0 A;  3CMA N;  3LP0 A;  3OS0 A;  3F5T A;  3TTD A;  3HZ6 A;  1T03 A;  2HMP A;  3VA0 A;  3QIC A;  3VEV A;  1HNZ K;  2OCE A;  1NGB A;  5AQK A;  1K8K A;  1C0T A;  3L4I A;  4O55 A;  4MDA A;  1SV5 A;  3CD6 N;  1NGH A;  4E7L A;  1C0G A;  3DRS A;  5AZI A;  3M8Q A;  4M7X A;  3L0Q A;  1NK0 A;  2OZS A;  4DTU A;  3WNH A;  3PO5 A;  4KKO A;  4GVM A;  4WFA L;  5K14 A;  1TGO A;  4XH1 A;  3ALY A;  3EKS A;  2VQF K;  5C10 A;  3L6Q A;  1HNX K;  1HYS A;  2D5R A;  5M1O A;  3VER A;  3TI0 A;  4Z4E A;  3CC4 N;  4LSN A;  1WAF A;  1XHX A;  4E1J A;  3HP9 A;  1ATR A;  3NMU A;  3CPW M;  2A41 A;  2ZF5 O;  4BRG A;  1DEJ A;  5C12 A;  4PL7 A;  3H3N O;  1ASV A;  3AVC A;  3LDP A;  2QWR A;  3J80 O;  1YVU A;  3TAM A;  3AAP A;  2JGU A;  3BY5 A;  2GEM A;  4IDH A;  2HNZ A;  4BRI A;  1YI2 N;  2P9K B;  3OA9 A;  4FZX C;  3BZC A;  3LM2 A;  3RMD A;  2YX6 A;  3A5O C;  3LDL A;  3HP6 A;  3MMV A;  3L2W A;  1TKZ A;  1XHZ A;  1A5W A;  3O3H A;  1T3V A;  4DF8 A;  3VF4 A;  5DM6 L;  1EWR A;  4JI8 K;  2VCP A;  3N4Q A;  4J8F A;  1E4F T;  1NGG A;  2PFU A;  3A5N C;  4Y0W A;  4HHT A;  4DSI A;  1KRP A;  3AVJ A;  4BR5 A;  1I3A A;  5AZI B;  3WUH A;  4BRK A;  4A62 A;  3SCX A;  5AZJ B;  1JCG A;  1OVY A;  3EZ5 A;  4CJP A;  5EVZ A;  1FXX A;  2HNY A;  2HF4 A;  3A0I X;  3ZX3 A;  1NGE A;  1BO5 O;  3U3Y A;  3L2R A;  3ID8 A;  2WTU A;  1U45 A;  1FKO A;  3K59 A;  3WXI A;  2NRX A;  3O9R A;  2BGG A;  2E5L K;  3NH1 A;  1LAW A;  4C8N A;  3DYA A;  4YOW A;  2LSN A;  5C42 A;  2D0A A;  4NXN K;  1ZBS A;  1EXQ A;  4NLC A;  1M1K O;  3FR0 A;  1D9F A;  2HST A;  2P9K A;  4XIU A;  3SQ0 A;  5JS2 A;  4RW4 A;  3PX4 A;  4CK1 A;  4A5A A;  1NOZ A;  3L4Q A;  4CGF A;  3OY9 A;  1QSL A;  2VWJ A;  1NK5 A;  3ENO A;  5BRE A;  2FF3 B;  1OH5 A;  1MDU B;  4O8K A;  4WQ5 A;  4DV7 K;  3D0P A;  4JS4 A;  4DMN A;  5ADX H;  1WSG A;  1Z6R A;  1U2V A;  1HPM A;  3VQC A;  4IO9 L;  2I7P A;  4H5R A;  4NCG A;  1VSK A;  2G8V A;  4FOE A;  4LY7 A;  4Z4H A;  3QET A;  4CD3 A;  2P9S B;  4JHD B;  4DSJ A;  4DSE A;  1S6P A;  3FGU A;  5AQL A;  5M1F A;  1JLQ A;  4H0V B;  1WNS A;  1NGA A;  2D4W A;  4KAZ A;  4M7Y A;  5GAE P;  2DY4 A;  2OAN A;  3VGM A;  3RR8 A;  2E6L A;  3LDN A;  3PLA A;  2Q0R A;  2QWN A;  4FWL A;  1DGK N;  1ZBI A;  2QW9 A;  4MFB A;  3QDK A;  4BG9 A;  3CCU N;  3LL3 A;  3TSP A;  1BUP A;  3HO1 A;  3OW2 M;  4ELV A;  1SQK A;  3C65 A;  3EO3 A;  4B08 A;  2VQE K;  1GLJ O;  4JKE A;  4JI2 K;  2Z1G A;  2O8B A;  2ZGY A;  2QKK A;  3OHR A;  5KPR A;  4BWM A;  4H4M A;  2A1S A;  3VET A;  1N6Q A;  3UIQ A;  1HNW K;  2YKN A;  3T1Y K;  5JLF A;  3TAQ A;  1UA1 A;  4OPJ A;  1T6C A;  2GEL A;  4MO4 A;  1REV A;  1YAG A;  2O8C A;  4B9U A;  1IJJ A;  1EKE A;  4DLE A;  2VG7 A;  1UA0 A;  4AHU A;  1NGC A;  5HOO A;  3O3G A;  3Q7C A;  1VAZ A;  3P4I A;  1C1B A;  2D0B A;  1NLV A;  4BGB A;  3OYM A;  4B9S A;  3O08 A;  4J2D A;  1TK5 A;  4CJQ A;  3V81 A;  1U48 A;  1YIJ N;  1UWB A;  3ULE A;  3RMA A;  3PX0 A;  3QES A;  3WEE A;  4HCC A;  4CW7 B;  3PSI A;  3ZLJ A;  1TAU A;  2IOC A;  3CER A;  1WLJ A;  5BPN A;  2HOE A;  3NGZ A;  2Q0U A;  2YHY A;  2CH6 A;  3C7N B;  4CD1 A;  1Z05 A;  3PSF A;  2ZJR L;  4O5F A;  5AQY A;  4OKK A;  2YHX A;  4FLT A;  5CZ1 A;  3ZSY A;  2NRT A;  4Y1D A;  1RTJ A;  2BH1 A;  2VYP A;  2GWJ A;  4DFK A;  3LPU A;  3ULE B;  4E19 A;  3IMX A;  3UB5 A;  2IVO A;  1VQ7 N;  4HUF A;  1QQN A;  4BR0 A;  3QFP A;  4CIG A;  2OYQ A;  1GLD G;  2F96 A;  4FW2 A;  1B9F A;  5IT9 O;  4OO1 J;  4F3O A;  2WON A;  4DS4 A;  1NNE A;  4M3T A;  3SQ4 A;  3FZM A;  5LJV A;  3AVN A;  3AVG A;  4CFC A;  2G8W A;  4FJ5 A;  3HSC A;  5HP1 A;  3WNG A;  4CJV A;  1BCM A;  1Q82 O;  1ZBL A;  4N5S A;  3WQT A;  4A61 A;  2PBD A;  1ASU A;  3SLC A;  3EZW A;  4BRH A;  4CZE A;  3V4I A;  4IJA A;  4Y1C A;  3WQU A;  2B5J A;  3CJC A;  4BQL A;  1TVR A;  3L3U A;  3O4N A;  4JI3 K;  2I5J A;  3VEW A;  2FLO A;  4BRP A;  4DR5 K;  4K0K K;  4CEF A;  1VQO N;  1A5V A;  3R9P A;  2FXU A;  3MX5 A;  3SPZ A;  4LF7 K;  1NM1 A;  4B1U B;  4A57 A;  2P9U B;  4FPA A;  4ILJ A;  3T1A A;  3VES A;  4GKJ K;  4CGG A;  3SQ1 A;  4FLW A;  2ZWH A;  4JKB A;  1RIL A;  3MEG A;  3G0Z A;  1RT5 A;  4BR7 A;  1FKP A;  2YHW A;  4JI1 K;  4PKH A;  3WXL A;  3V9Z A;  2BAN A;  3THV A;  5FPM A;  1BOT O;  3CCV N;  4DTR A;  4YOU A;  3ZX0 A;  5AQS A;  3VPZ A;  3QER A;  3CCJ N;  4I9L A;  1ZC6 A;  3SUP A;  1SL1 A;  3CM5 A;  4BDZ A;  3QIO A;  3U6F A;  3VTI A;  4B9L A;  1Z25 A;  3NVM A;  3LAM A;  1S22 A;  3ZT1 A;  1T44 A;  3HJF A;  3KK1 A;  2AP1 A;  4FLX A;  3M8P A;  3K5M A;  3HTV A;  4JN4 A;  2KLA A;  3VQQ A;  4FJX A;  4FLV A;  1S9G A;  2X6N A;  5LL6 Z;  4O44 A;  4DR2 K;  3WT0 A;  4E7I A;  1HJO A;  1OVQ A;  3TTF A;  2E20 A;  1W7A A;  1WSH A;  1BIU A;  2F9W A;  4AH9 A;  5SWM A;  3OYH A;  5EXW A;  4U7B A;  3EY1 A;  2Q97 A;  4IJN A;  3M8S A;  2A5X A;  3L2V A;  3RVC A;  5AQR A;  4GKK K;  3B6O A;  2FF6 A;  3FLC O;  4JRQ A;  2HVI A;  3OJU A;  4DQS A;  5ADX A;  1J53 A;  4MLH A;  3O6W A;  4CHP A;  1RDA A;  4DG1 A;  4LD0 A;  3CQ8 A;  3NH0 A;  4WQ4 C;  1HPZ A;  4HVJ A;  1Y97 A;  2H3G X;  3I8B A;  5IWA K;  4BDY A;  2AJQ A;  1KVA A;  4W5T A;  4JYA K;  4CK3 A;  4JI4 K;  2QXL A;  4OGE A;  2WC9 A;  4FWS A;  1NKE A;  5CR4 A;  2VWK A;  4DSK A;  4ZTJ A;  3BF3 A;  3HVT A;  4DCH A;  1NJZ A;  5AQQ A;  5KQD A;  4IEI A;  1N5Y A;  4DU4 A;  4DV0 K;  4CZL A;  2QWL A;  1KD1 O;  4K43 A;  1N32 K;  4DFM A;  4EHU A;  2UUA K;  4OVL A;  4W5O A;  5C0Y A;  4B1V A;  3P83 D;  3R3L A;  1JXE A;  4FWM A;  3MEC A;  2EX3 A;  1VQK N;  4DQR A;  3MWT A;  1KLM A;  3DLH A;  4FVU A;  3NVK A;  3LP1 A;  1KAZ A;  3KLI A;  4B9T A;  4DSF A;  4IEE A;  4ILG B;  4NO7 A;  1YJ9 N;  4YDU A;  3D2E A;  4W5Q A;  4YDU C;  4NCA A;  2X78 A;  1VQM N;  1FJG K;  4IFE A;  3WXM B;  1G99 A;  3RSE B;  1J5E K;  3O4W A;  1XUP O;  3D45 A;  2QWQ A;  3ZT2 A;  5E26 A;  3RTV A;  4KHS A;  3A2F A;  3RWU A;  1CXU A;  2P9P A;  4JS5 A;  3MN5 A;  1SKS A;  4G9Z A;  3U4L A;  1GLE G;  4WQ5 C;  4DUY K;  2ZE2 A;  5M1P A;  3OS2 A;  4OLB A;  2RKI A;  3S3O A;  5AQH A;  4UY8 O;  1KTQ A;  4BRQ A;  3IRX A;  3V9S A;  3IAY A;  4FJH A;  2Z1H A;  3FZH A;  4GY2 B;  1TL1 A;  3CCL N;  2BUP A;  4XH4 A;  4K42 A;  3HK2 A;  2A6A A;  2PZS A;  4Q0B A;  1U49 A;  5AQV A;  5FRO A;  4X65 K;  4NXM K;  1QVG M;  3DMJ A;  3KK2 A;  3M3Z A;  4CES A;  2FBX A;  4ILH A;  4EZ9 A;  3LDQ A;  2ASO A;  3ZX2 A;  1W0H A;  4JKH A;  1WB9 A;  2P5O A;  3U9D A;  4FM0 A;  5F0X A;  4GV9 A;  2O8E A;  4F4K A;  4BR2 A;  4U67 L;  3NDK A;  5FPD A;  2NRH A;  1S5J A;  2WUS A;  3EKU A;  3KKS A;  3HPO A;  1X9W A;  1VQ8 N;  3SPY A;  1J5O A;  4X66 K;  3ULD A;  4WCE L;  2IC3 A;  5BN8 A;  3V6D A;  3PO4 A;  4WFN L;  1M90 O;  1U2V B;  3QNN A;  1I39 A;  4B8C A;  4E89 A;  2FBY A;  3TAP A;  3N4P A;  1IKV A;  3HOS A;  2IGI A;  4DF4 A;  3NBP A;  1D9D A;  2P9I A;  2E6M A;  4FWP A;  3T1H K;  3CQY A;  1KVB A;  2E1Z A;  4FVM A;  4B3S K;  1BI4 B;  4DV4 K;  1NMD A;  4IFY A;  2YNG A;  1J9A A;  3QEP A;  4YNQ A;  4X64 K;  2CGL A;  4FLZ A;  4M3X A;  3CM6 A;  3QO9 A;  1O13 A;  1U6Z A;  5C25 A;  4ELU A;  3UE5 A;  4JD2 B;  5J1E A;  2OTL N;  1S1T A;  4KI4 A;  1KAY A;  5EX5 A;  4DQI A;  1NKC A;  2KZM A;  3FZL A;  2DFE A;  1SAZ A;  5E84 A;  5I3U A;  1QQO A;  1F21 A;  4CBX A;  4JKG B;  5FPN A;  1VQN N;  3HRG A;  3CFO A;  1LAV A;  4EP5 A;  4PKI A;  3KWI A;  4LH4 A;  4PA1 A;  1NJX A;  3QEV A;  2VGM A;  3KD5 E;  4KH4 A;  5DMR A;  4IOC L;  2YNF A;  1Q18 A;  1BI4 A;  4G1Q A;  4I6M B;  3M8R A;  3DLE A;  5AQT A;  4CZJ A;  3J7Z O;  4FJM A;  2VGN A;  2XHB A;  3DOK A;  5JLH A;  3PV8 A;  3BGR A;  1Q86 O;  3TAG A;  3QIN A;  3AVB A;  3VEO A;  4KTQ A;  1RBT A;  2OPQ A;  4B3M K;  4B9M A;  3CCR N;  5FRN A;  1RGI A;  2QWP A;  1RTI A;  3ZCM A;  1LWE A;  1RDD A;  1NOY A;  4QS8 A;  3THY A;  2F9T A;  3G10 A;  4FSV A;  4CZM A;  2RE2 A;  3C6U A;  1C0U A;  3AA3 A;  3P39 A;  1HRH A;  3B8A X;  1NG9 A;  4M3W A;  5JIC A;  2V51 B;  4E7K A;  1LWC A;  2F8S A;  3T7Z A;  3TSU A;  3DLG A;  3LPT A;  1VSM A;  2F8T A;  4CE9 A;  4FJK A;  3J7A P;  2E2O A;  4O8U A;  5BR9 A;  4AQY K;  2E2P A;  4JI5 K;  5AQM A;  3H45 C;  2A1R A;  4R79 A;  3THW A;  1GOA A;  1X9J A;  1JLF A;  3I33 A;  3ZSW A;  5GIP A;  3TAR A;  1JLA A;  3H08 A;  2DPN A;  3SMS A;  5GAG P;  4C1N K;  2Y1I A;  1RT7 A;  1EWQ A;  1HQU A;  4QOZ B;  1N33 K;  4M42 A;  3ZET B;  4JKF A;  4FM1 A;  3CJ1 A;  3IDH A;  1C6V A;  5AQI A;  1TYQ A;  1YUW A;  2P9P B;  2W41 A;  1RT3 A;  4CF9 A;  4M45 A;  5C2D A;  2JWL A;  4C8K A;  3HXM A;  2HBK A;  4NLB A;  3P38 A;  3UKU B;  2FSK A;  4IBN A;  4BRL A;  1RDW X;  1JLE A;  3MXI A;  3CJ7 A;  3BEX A;  4YY3 K;  4IG0 A;  2VWB A;  4JKD A;  2KW4 A;  2CH5 A;  1BQN A;  4B9N A;  3ENH A;  3RMB A;  4ELT A;  3WXJ A;  4DTP A;  3SYZ A;  4F8R A;  1VHX A;  3C95 A;  4EFH A;  3F2K A;  3ZEU B;  4LF8 K;  1RNH A;  2W6K A;  2G8K A;  4JNE A;  4A2A A;  4HTU A;  4QAG A;  1XI1 A;  1RBV A;  5MLC Q;  3CCQ N;  4PUO A;  4DV3 K;  4BC5 A;  3SAF A;  2YNI A;  1NK4 A;  4JI7 K;  4LFA K;  3DAW A;  1I94 K;  1L3V A;  4NYN A;  2UXC K;  1IG8 A;  2DFF A;  4PHT X;  2B4J A;  2F7T A;  3E9P A;  4O0J A;  1BA1 A;  1QZ5 A;  4BRO A;  4E1N A;  4DV6 K;  3K57 A;  4ICL A;  3SI6 A;  1KCF A;  4FWK A;  3VEZ A;  3LZJ A;  5GAH P;  4E0D A;  5E41 A;  2A42 A;  1BHL A;  3VGL A;  3SAG A;  2CGJ A;  4FJ9 A;  4HUE A;  1TKD A;  1QQC A;  4M63 C;  4CEO A;  4CCH A;  3IG1 A;  2IAJ A;  4BE0 A;  4RG8 A;  2OPR A;  3J8A A;  1WUA A;  2YCH A;  4FM2 A;  5M1Q A;  5SZT A;  1HKG A;  2O8E B;  4KH5 A;  1X1P A;  4JLH A;  3KLH A;  4CK2 A;  4DTN A;  4BRF A;  4RTF D;  4B1X B;  4W5R A;  1QHA A;  2GX9 A;  1VSD A;  1CZ9 A;  3OYC A;  4OLA A;  1Q9X A;  3SJH A;  4YOR A;  4EZ6 A;  1MU2 A;  3L2U A;  3O8M A;  4H0T B;  5BRH A;  2G8U A;  3SJJ A;  4N47 A;  4DR3 K;  2Q3S A;  4WYB A;  2KTQ A;  3AA4 A;  2HHV A;  1S1V A;  5F1X A;  1UAX A;  3GL1 A;  3SNN A;  3ISN C;  1JCE A;  2IS3 A;  5ELZ A;  4YFU A;  1T05 A;  1T7P A;  2V52 B;  3TR8 A;  4KHY A;  3H1V X;  4CHZ A;  4ID1 A;  5JVG L;  3VEN A;  1NK7 A;  4H03 B;  3ZYY X;  1IBK K;  3M5R A;  2P51 A;  3DRP A;  5AFU A;  1TAQ A;  3VF6 A;  4E7H A;  4RW7 A;  5CHI A;  2YHA A;  4RCH A;  1R59 O;  1D5A A;  4B9V A;  1ZBF A;  4O0I A;  4FOI A;  3OYE A;  1HJR A;  1YHQ N;  1IKX A;  1YT3 A;  4OKE A;  2Y1J A;  4Z4G A;  2Q1N A;  1P8Z A;  1X9M A;  2OPS A;  3MXJ A;  5BRF A;  3BUZ B;  2W40 A;  4CJW A;  3QB0 A;  4LF6 K;  3MXM A;  2PYL A;  3CJB A;  3H1Q A;  3K5O A;  3WNF A;  4FJ8 A;  4BRA A;  3AVF A;  5JVH L;  2G8H A;  1BU6 O;  3CJA A;  5AQN A;  4CER A;  5FPE A;  3AVH A;  4CI6 A;  3JYT A;  4N56 A;  4OKJ A;  3C6T A;  4HCB A;  3VQP A;  3PUF A;  1NMN A;  3CHW A;  4BR4 A;  3SZ2 A;  1BQM A;  1HKB A;  3SAH A;  4I2P A;  4JEP A;  5CYM A;  4MO5 A;  4M3U A;  1GOB A;  2YNH A;  1QSS A;  3MCA B;  4AHS A;  1SKW A;  1NWK A;  2QWM A;  3ATU A;  4X62 K;  4EHT A;  1XNQ K;  1VQP N;  2JWK A;  1JLB A;  3LZI A;  1WSE A;  2YV0 X;  3HST B;  2BTF A;  5HRP A;  5J2M A;  3MK6 A;  4BVP A;  3G25 A;  4NYF A;  3CQX A;  1UOC A;  4FLU A;  4FZZ A;  3WNE A;  4I6M A;  3I0R A;  2XY7 A;  3QEX A;  3D2E B;  1T8E A;  3GG4 A;  3QIP A;  3U3G A;  5J2P A;  1NGJ A;  3MN7 A;  4CZF A;  3AVM A;  4J2E A;  1JXB A;  5CYQ A;  2HW3 A;  2NZT A;  4KHW A;  1P90 A;  3HOT A;  4HWI A;  1RTD A;  5J2N A;  3KVG A;  4GVE A;  3CCS N;  3MX2 A;  2UXD K;  3SK3 A;  5C15 A;  3NAE A;  4K41 A;  3EL2 A;  4DR1 K;  2A40 A;  1KFS A;  5M1N A;  3TAN A;  1HNI A;  4DHY A;  1BA0 A;  1QVF M;  4JD2 A;  2XO7 A;  2GTD A;  3CYM A;  4FK4 A;  1VQ9 N;  2FC0 A;  4JV5 K;  4C8M A;  4DV1 K;  2NRV A;  3S3N A;  2O8F B;  1HYV A;  4BGA A;  3ZT4 A;  2I7N A;  4NB4 A;  3VTH A;  2YJE A;  3NF6 A;  3VQ6 A;  2E8A A;  5BPL A;  3QFU A;  3M6G A;  2D0P A;  4K25 A;  3VQD A;  1GOC A;  4OX9 K;  2G8I A;  4JAX A;  5FLX O;  4IZ9 A;  3QEI A;  2ATQ A;  1NK9 A;  1L3S A;  4O5B A;  5AQO A;  3HPG A;  1S72 N;  4DR7 K;  1A5X A;  1HKC A;  4Z4C A;  3I55 N;  3L3V A;  2QEX N;  3C7N A;  4YHH K;  4DU1 A;  1IH7 A;  3M1F A;  1TYQ B;  2E4L A;  3FZF A;  2E88 A;  3TPQ A;  3K5L A;  3AY9 A;  2NRW A;  4IOX A;  3DLB A;  3HI0 A;  3TTC A;  2QWO A;  3TAE A;  3K58 A;  3WEE B;  2O8B B;  4N41 A;  4OPA A;  4C1N I;  2HBL A;  4H4O A;  5KGW A;  1R0A A;  5HRS A;  4YOY A;  2YJF A;  2ASM A;  4CGI A;  4CJ7 A;  3IFR A;  1S1W A;  1CZB A;  4E1M A;  3A5M C;  3FZK A;  3IS9 A;  4KTW A;  2NRZ A;  3EN9 A;  4JK8 A;  2P9S A;  4CEE A;  4BVO A;  3LAL A;  4BWJ A;  4H5V A;  1KVC A;  4PL8 A;  3O9Q A;  4CF2 A;  3CC7 N;  3V1Q A;  4Q5V A;  1VQ6 N;  3AO5 A;  1U04 A;  1BWF O;  3V1R A;  3KIO A;  3O80 A;  3MED A;  2X6S A;  1ATN A;  4DFJ A;  1VSF A;  2Z1I A;  3LP2 A;  4CZK A;  1IV0 A;  5HBM A;  3VGK A;  5A2Q O;  1BCO A;  1GLA G;  4H5W A;  1YTA A;  5KRT A;  1JJ2 M;  4JKG A;  3ID6 A;  5KTQ A;  4CZH A;  4BRD A;  1E4G T;  3DJC A;  3ZSZ A;  1NJY A;  3QNO A;  1K6Y A;  4CZI A;  4KHP K;  2HF3 A;  5BRD A;  1XNR K;  1FK9 A;  1CZA N;  3AO4 A;  3C0B A;  3PIP L;  3OYK A;  2UXB K;  1ILY A;  2D0O A;  5GIO A;  2WOM A;  2V7Z A;  3CG7 A;  4E7J A;  1LW0 A;  3S9H A;  5J2Q A;  4DTJ A;  5GIN A;  1TKX A;  1VRT A;  4KPY A;  2UUC K;  3IUC A;  5AJ3 K;  1C0F A;  5KPT A;  3R6M A;  3O1W A;  2QM1 A;  4LSL A;  4BRN A;  3TWH A;  2YI1 A;  4XEI A;  4CEQ A;  2FSN A;  3ZT3 A;  4J2A A;  5AQW A;  3UKR A;  4FYD A;  3JXU A;  1DLO A;  4FL9 A;  4H5N A;  4F9O A;  4KRF A;  1YJN N;  1TKT A;  2WFB A;  1BGX T;  4FWQ A;  4CHN A;  3KD1 E;  4WE1 A;  4CBW A;  4LFC K;  1L3U A;  5GAD P;  1RFQ A;  5KPZ A;  1YJW N;  1EP4 A;  2OPP A;  4CHY A;  3SQ2 A;  4GMJ B;  3LAK A;  4DFP A;  2D1K A;  3G4S N;  3THX A;  4CEZ A;  1JCF A;  4FWN A;  3O5B A;  4YOX A;  4MQ3 A;  4N76 A;  1J6Z A;  2PAV A;  3KWG A;  1ITG A;  2F4V K;  3HYF A;  1V4T A;  2P9I B;  4H8K A;  3VQA A;  4KBO A;  2IVN A;  1TL3 A;  1U4B A;  4A2B A;  4I7F A;  2ASP A;  4M3Y A;  1OKJ A;  1YTU A;  5LMN K;  1K8A O;  1LV5 A;  4QS9 A;  3ZSQ A;  1Y64 A;  3AAR A;  2GWK A;  1VSL A;  3G6E N;  4FLY A;  4BDP A;  3DXM B;  1XC3 A;  2UUB K;  2NUB A;  4FWO A;  4EIA A;  1HNV A;  2ZJP L;  2QA4 N;  1N36 K;  5DM7 L;  2IDO A;  5CE3 A;  1KXP A;  2GUP A;  3RR7 A;  1QZ6 A;  1Q8I A;  3KZB A;  1HUX A;  3UKU A;  1TK0 A;  1IKY A;  4KH6 A;  4DWI A;  2XY5 A;  2ZQB A;  4MDB A;  2GBZ A;  4CEA A;  3VEY A;  3NHG A;  4B1Z A;  3K0S A;  1X3M A; 
#chains in the Genus database with same CATH homology
 2DFF A;  3L3U A;  2QKB A;  2B4J A;  3O4N A;  1WSI A;  3V9W A;  1WSF A;  3OYN A;  1EET A;  1RDC A;  2I5J A;  4O0J A;  5C24 A;  1VK0 A;  4E1N A;  4OGC A;  3K57 A;  4B8A B;  4ICL A;  3SI6 A;  4CEF A;  4FJJ A;  1RDB A;  1A5V A;  3KLG A;  1KCF A;  4CF8 A;  2B6A A;  3AA5 X;  3JSM A;  4AHT A;  3LZJ A;  1W9H A;  4E0D A;  5KGX A;  5E41 A;  3SPZ A;  1BHL A;  4FJ9 A;  4JRP A;  3T1A A;  4HUE A;  4AIL C;  1TKD A;  1QQC A;  4CEO A;  2HHU A;  1WSJ A;  3IG1 A;  4CCH A;  2IAJ A;  4CGG A;  4BE0 A;  3SQ1 A;  4RG8 A;  1IO2 A;  2OPR A;  4FLW A;  1X9S A;  1B92 A;  3SUN A;  1RIL A;  4TSX A;  3MEG A;  3G0Z A;  1RT5 A;  1FKP A;  3AO3 A;  4FM2 A;  5SZT A;  2DFH A;  3SUO A;  4FXD A;  5HRO A;  3V9Z A;  2BAN A;  4CEB A;  4CJR A;  3I8D A;  1L3T A;  4FCY A;  3THV A;  3SV4 A;  2ITG A;  4RW9 A;  1RCH A;  1S9E A;  3AVI A;  3OYJ A;  4E3S A;  4KRE A;  1KFD A;  3F9K A;  4DTR A;  1CLQ A;  4M3Z A;  1X1P A;  2D0C A;  4JLH A;  2GUI A;  3KLH A;  3QER A;  4CK2 A;  4FJI A;  4I9L A;  4DTN A;  4CF1 A;  1HQE A;  4F2S A;  3SUP A;  1SL1 A;  1VSJ A;  3CM5 A;  4BDZ A;  3QIO A;  4W5R A;  3U6F A;  2HHV A;  4M3R A;  3AV9 A;  4B9L A;  1Z25 A;  1VSD A;  1DTT A;  2W42 A;  4F3T A;  1CZ9 A;  3LAM A;  3OYC A;  1J54 A;  3ZT1 A;  3HJF A;  4OLA A;  3OYD A;  2XY6 A;  1Q9X A;  2HHQ A;  3KK1 A;  3SV3 A;  1VSH A;  3HVR A;  2JLE A;  4AHR A;  4EZ6 A;  1MU2 A;  4O4G A;  3L2U A;  3MAQ A;  3HPH A;  3M8P A;  4FLX A;  3K5M A;  3LDS A;  3OJS A;  3B6P A;  1VSE A;  3DLK A;  1RBS A;  2P1J A;  2G8U A;  3SJJ A;  4N47 A;  4DTM A;  4FW1 A;  3VQQ A;  4FJX A;  1S1X A;  2Q3S A;  3QLH A;  4FLV A;  1S9G A;  3AVL A;  2X6N A;  3AA4 A;  3MEE A;  4O44 A;  4E7I A;  2ZD1 A;  3AVK A;  3OYL A;  2OZM A;  1S1V A;  4B3O A;  1IKW A;  3SUQ A;  4KHQ A;  1UAX A;  1WSH A;  1BIU A;  4CHO A;  1SL2 A;  3QEW A;  2OA8 A;  4CFA A;  4FJG A;  3VQB A;  4AH9 A;  5SWM A;  1BIS A;  1Z26 A;  3OYH A;  3ISN C;  3SNN A;  1TK8 A;  4YFU A;  2IS3 A;  3EY1 A;  3VQ9 A;  3M8S A;  2DTU A;  4IDK A;  3L2V A;  4HUG A;  1T05 A;  4OPK A;  1NJW A;  1T7P A;  3BDP A;  1HYZ A;  4FJ7 A;  3B6O A;  3TR8 A;  4R5P A;  4JRQ A;  3I0S A;  4CED A;  4KHY A;  3OJU A;  4DQS A;  3HM9 A;  2HVI A;  1J53 A;  2VG6 A;  4CHZ A;  4C8O A;  4ID1 A;  2BE2 A;  4CHP A;  3T3F A;  1NK7 A;  1RDA A;  2YKM A;  5HRR A;  4DG1 A;  4LD0 A;  3CQ8 A;  3NH0 A;  3VQ5 A;  1QSY A;  1C0M A;  1QHT A;  1HPZ A;  3DRP A;  2P51 A;  1TAQ A;  4PQU A;  4HVJ A;  4E7H A;  1Y97 A;  4RW7 A;  3OVN A;  2XRI A;  4BDY A;  2YHA A;  2AJQ A;  1VRU A;  1KVA A;  4AHC A;  4W5T A;  1D5A A;  4B9V A;  4I9Q A;  1ZBF A;  4O0I A;  2KTQ A;  4CK3 A;  4CJE A;  3OYE A;  3LWL A;  1HJR A;  3AA2 A;  4DTS A;  4FK0 A;  1IKX A;  1YT3 A;  4OGE A;  3LP0 A;  4OKE A;  3OS0 A;  2Y1J A;  1NKE A;  2VWK A;  3K5N A;  4DSK A;  4FJL A;  5CY4 A;  4ZTJ A;  3KTQ A;  3HVT A;  4Z4G A;  4PWD A;  1T03 A;  1NJZ A;  2OPS A;  3MXJ A;  1X9M A;  3VA0 A;  4CJW A;  4CFB A;  1N5Y A;  5KI6 A;  3MXM A;  2PYL A;  1KLN A;  3DM2 A;  4CGD A;  4DU4 A;  1C0T A;  1XC9 A;  3OYI A;  1C1A A;  3K5O A;  1O1W A;  4I2Q A;  4O55 A;  3WNF A;  4AHV A;  4FJ8 A;  1SV5 A;  3AVF A;  2G8H A;  4E7L A;  4DFM A;  3DRS A;  4CER A;  3M8Q A;  3AVH A;  4IG3 A;  1NK0 A;  4OVL A;  3JYT A;  4W5O A;  4N56 A;  3VA3 A;  3DOL A;  2RN2 A;  3C6T A;  4OKJ A;  3WNH A;  3NGI A;  4DTU A;  3PO5 A;  2OZS A;  4KKO A;  4GVM A;  1SUQ A;  5K14 A;  1TGO A;  4HCB A;  3ALY A;  3VQP A;  3P83 D;  3PUF A;  1HYS A;  4CJK A;  4K8Z A;  1JXE A;  3MEC A;  2EX3 A;  2D5R A;  3SZ2 A;  3V9U A;  1BQM A;  3TI0 A;  4Z4E A;  1B9D A;  4DQR A;  4M3X A;  1KLM A;  3HL8 A;  4LSN A;  1WAF A;  1XHX A;  3DLH A;  4C8L A;  4I2P A;  3HP9 A;  3PX6 A;  2KZZ A;  4RW6 A;  3NF7 A;  5CYM A;  4M3U A;  3LP1 A;  1GOB A;  2YNH A;  1QSS A;  4AHS A;  3KLI A;  4B9T A;  4GW6 A;  1SKW A;  4DSF A;  1ASV A;  5T7B A;  3AVC A;  5DK5 A;  3ZSX A;  2PY5 A;  1JLB A;  3LZI A;  1YVU A;  4W5Q A;  1WSE A;  2YV0 X;  3HST B;  3TAM A;  5HRP A;  1DTQ A;  4NCA A;  4CJ3 A;  2X78 A;  1EX4 A;  4KO0 A;  5J2M A;  2JGU A;  2HNZ A;  4IFV A;  4NYF A;  4IKF A;  1U47 A;  1UOC A;  4FLU A;  4FZZ A;  3WNE A;  4FZX C;  4KI6 A;  3RMD A;  3D45 A;  3I0R A;  4CJ4 A;  4UQG A;  2XY7 A;  3ZT2 A;  4CGJ A;  3AO2 A;  1QE1 A;  5EU7 A;  3HP6 A;  3L8B A;  1ZYQ A;  3L2W A;  1TKZ A;  3RTV A;  1XHZ A;  1SL0 A;  1A5W A;  3A2F A;  1CXU A;  3O3H A;  3RWU A;  4KHS A;  3TAB A;  1S1U A;  3QEX A;  1RT4 A;  4JS5 A;  1SKS A;  4FK2 A;  4BAC A;  1T8E A;  3QIP A;  3U3G A;  4DF8 A;  5J2P A;  2ZE2 A;  2RF2 A;  3OS2 A;  4J2E A;  2RKI A;  3S3O A;  3AVM A;  4OLB A;  4CFD A;  1KTQ A;  1JXB A;  5CYQ A;  2YHB A;  2HW3 A;  1JLC A;  3IRX A;  4EP4 A;  3V9S A;  4HHT A;  1RBU A;  3IAY A;  4KHW A;  4DSI A;  2Z1H A;  4FJH A;  1KRP A;  1TL1 A;  1RTD A;  4DU3 A;  3AVJ A;  5J2N A;  3V1O A;  1I3A A;  3HK2 A;  2HHX A;  2O4I A;  2PZS A;  2O4G A;  3ITH A;  3F73 A;  3NAE A;  3SCX A;  2QK9 A;  4Q0B A;  1U49 A;  3EZ5 A;  5FRO A;  1KFS A;  4CJP A;  3DMJ A;  3TAN A;  1FXX A;  2HNY A;  3KK2 A;  1HNI A;  4KHN A;  4CES A;  2FBX A;  3NE6 A;  3DI6 A;  3U3Y A;  4EZ9 A;  3L2R A;  3E01 A;  1U45 A;  1FKO A;  4CJU A;  2XO7 A;  4ID5 A;  3CYM A;  3K59 A;  4K8X A;  3CFP A;  4FK4 A;  2FC0 A;  4M41 A;  4C8M A;  2BGG A;  1W0H A;  4CJL A;  1LW2 A;  3NH1 A;  3S3N A;  2P5O A;  4FM0 A;  1LAW A;  4F4K A;  4C8N A;  1HYV A;  3C94 A;  3DYA A;  3O4Q A;  3ZT4 A;  3O3F A;  3NDK A;  2LSN A;  5C42 A;  2D0A A;  5D3G A;  1S5J A;  1EXQ A;  5I42 A;  1IG9 A;  3KKS A;  3HPO A;  3NF6 A;  4CJT A;  3VQ6 A;  3SPY A;  1X9W A;  1J5O A;  3ULD A;  1D9F A;  2HMI A;  4KFB A;  3VQD A;  1GOC A;  2G8I A;  4XIU A;  2IC3 A;  3DLR A;  3V6D A;  3PO4 A;  3SQ0 A;  5JS2 A;  4RW4 A;  4RW8 A;  4DSL A;  3PX4 A;  3ZT0 A;  4CJ5 A;  3QEI A;  2ATQ A;  1NK9 A;  1L3S A;  4O5B A;  4CK1 A;  3HPG A;  4QCL A;  1NOZ A;  1A5X A;  2HHT A;  3QNN A;  1I39 A;  4B8C A;  4Z4C A;  3L3V A;  4CGF A;  4E89 A;  4DLG A;  2FBY A;  3TAP A;  4F2R A;  4DU1 A;  2HVH A;  1IH7 A;  1IKV A;  3OY9 A;  1QSL A;  2IGI A;  1JL2 A;  2VWJ A;  3NBP A;  4DF4 A;  1WAJ A;  1NK5 A;  1D9D A;  2E4L A;  2E6M A;  3K5L A;  1ZBH A;  5FRM A;  2KFZ A;  3DLB A;  1KVB A;  3D0P A;  3LWM A;  4FVM A;  2Z1J A;  4DMN A;  4JS4 A;  4FJN A;  1WSG A;  1XWL A;  3K58 A;  4CIE A;  3TAE A;  1BIZ A;  1BI4 B;  4N41 A;  2HHS A;  3VQC A;  4IFY A;  2YNG A;  4H4O A;  1R0A A;  5KGW A;  4NCG A;  5HRS A;  3NH2 A;  1J9A A;  3QEP A;  1QS4 A;  1VSK A;  2RPI A;  4Z0U A;  4YNQ A;  2G8V A;  4LY7 A;  4FLZ A;  4CGI A;  3CM6 A;  3QO9 A;  3T19 A;  4Z4H A;  5C25 A;  4DQQ A;  3QET A;  1S1W A;  4ELU A;  4DSJ A;  4DSE A;  1S6P A;  5J1E A;  1S1T A;  1CZB A;  4KI4 A;  4E1M A;  3IS9 A;  1JLQ A;  1VSI A;  3P5J A;  4KTW A;  1D8Y A;  1WNS A;  4CEE A;  4DQI A;  5HLF A;  4KB0 A;  4CIF A;  3LAL A;  4KAZ A;  4FZY A;  1NKC A;  4BWJ A;  2DY4 A;  4CJS A;  1KVC A;  3ZSR A;  2KZM A;  1LWF A;  1BL3 A;  1C1C A;  2E6L A;  2DFE A;  3RR8 A;  2FBT A;  4CF2 A;  3V1Q A;  3VQE A;  4Q5V A;  3V9X A;  3AO5 A;  5I3U A;  1F21 A;  1U04 A;  3RRH A;  1ZBI A;  3V1R A;  3KIO A;  4MFB A;  4BE2 A;  1Q9Y A;  3MED A;  4KTZ A;  3CFO A;  1LAV A;  4EP5 A;  2X6S A;  4LH4 A;  3HO1 A;  4PA1 A;  4DFJ A;  1NJX A;  4CJF A;  1VSF A;  2Z1I A;  3LP2 A;  3NF9 A;  3QEV A;  3KD5 E;  4ELV A;  5HBM A;  4Z4I A;  1RT1 A;  4B08 A;  3OS1 A;  2GV9 A;  5CZ2 A;  5DMR A;  2YNF A;  1BCO A;  3P1G A;  5KRS A;  2Z1G A;  1BI4 A;  4BE1 A;  4G1Q A;  4CGH A;  2QKK A;  1YTA A;  5KRT A;  2KQ2 A;  4BWM A;  4H4M A;  3M8R A;  3NGY A;  3CFR A;  5KTQ A;  3FFI A;  3DLE A;  2A1S A;  1N6Q A;  2G8F A;  4ZHR A;  3UIQ A;  4FJM A;  2KFN A;  2YKN A;  4CEC A;  2XHB A;  3DOK A;  3ZSZ A;  4KHU A;  1NJY A;  3QNO A;  3TAQ A;  1UA1 A;  1SKR A;  4OPJ A;  3PV8 A;  1K6Y A;  3BGR A;  1REV A;  3TAG A;  1RBR A;  4B9U A;  3QIN A;  3KKR A;  3AVB A;  3VQ4 A;  3KJV A;  4KTQ A;  1RBT A;  2OPQ A;  4B9M A;  3AO1 A;  1QTM A;  1RTH A;  1EKE A;  4DLE A;  2VG7 A;  1UA0 A;  5FRN A;  4AHU A;  1FK9 A;  1NK6 A;  1HMV A;  3O3G A;  1S6Q A;  1KSP A;  3AO4 A;  1RTI A;  3OYK A;  2XY8 A;  3RRG A;  1C1B A;  2D0B A;  3ZCM A;  1LWE A;  1RDD A;  5HRN A;  2WOM A;  4E7J A;  3CG7 A;  3VQ8 A;  1LW0 A;  1NOY A;  1JLG A;  3OYM A;  4B9S A;  3S9H A;  5J2Q A;  4DTJ A;  4J2D A;  3G10 A;  1TKX A;  1VRT A;  4LH5 A;  1JL1 A;  2QXF A;  1TK5 A;  4KPY A;  4CJQ A;  3V81 A;  1U48 A;  1UWB A;  3C6U A;  1C0U A;  1TV6 A;  3AA3 A;  3RMA A;  1HRH A;  1NKB A;  3PX0 A;  4M3W A;  4E7K A;  4LSL A;  1RT2 A;  1LWC A;  1ZBU A;  4CEQ A;  3TWH A;  3ZT3 A;  1RT6 A;  3QES A;  3ZSO A;  4J2A A;  2F8S A;  3KK3 A;  3DLG A;  3LPT A;  1VSM A;  4CHQ A;  4FYD A;  3K2P A;  4HCC A;  2F8T A;  3OYA A;  1DLO A;  4CE9 A;  4FJK A;  1TAU A;  2IOC A;  2R7Y A;  1WLJ A;  1JKH A;  2EHG A;  4KRF A;  1TKT A;  3NGZ A;  4DS5 A;  1BGX T;  4DWI A;  4CHN A;  2BDP A;  2A1R A;  3KD1 E;  4WE1 A;  5FDL A;  1L3U A;  1GOA A;  3OYB A;  3LAN A;  1JLF A;  3LP3 A;  4L8R B;  1EP4 A;  2OPP A;  4CHY A;  3ZSW A;  3SQ2 A;  3TAR A;  1JLA A;  3H08 A;  3LAK A;  4GMJ B;  4DTX A;  4DFP A;  4Z4F A;  1CXQ A;  4OJR A;  4J2B A;  4OKK A;  4CEZ A;  4FLT A;  4ZTF A;  5CZ1 A;  3ZSY A;  2Y1I A;  3RMC A;  1RT7 A;  3NFA A;  4MQ3 A;  4Y1D A;  3NCI A;  4KB1 A;  4N76 A;  1HQU A;  2ETJ A;  4CF0 A;  2VG5 A;  4QOZ B;  1ITG A;  3HYF A;  4M42 A;  4PY5 A;  1RTJ A;  3L2Q A;  4FM1 A;  3OYG A;  1C6V A;  3HT3 A;  4DFK A;  4H8K A;  1RT3 A;  3VQA A;  4CF9 A;  3LPU A;  3TAF A;  4W5N A;  4E19 A;  4M45 A;  1L5U A;  1TL3 A;  4HUF A;  1U4B A;  4C8K A;  3HXM A;  4I7F A;  4CIG A;  3OYF A;  2OYQ A;  2F96 A;  4FW2 A;  1B9F A;  4NCB A;  4M3Y A;  4DTO A;  3KLF A;  1YTU A;  4IBN A;  3ZSV A;  1LV5 A;  3VN5 A;  3VQ7 A;  4F3O A;  2WON A;  4DS4 A;  1JLE A;  3ZSQ A;  2HHW A;  3NF8 A;  3MXI A;  4DQP A;  3ASM A;  4M3T A;  3SQ4 A;  3AVN A;  4KV8 A;  1VSL A;  1WN7 A;  4FLY A;  4BDP A;  3AVG A;  4IG0 A;  4CFC A;  2KW4 A;  1BQN A;  4B9N A;  3S3M A;  2G8W A;  2NUB A;  3RMB A;  4ELT A;  4FJ5 A;  3PY8 A;  1HNV A;  4DTP A;  3SYZ A;  4F8R A;  2IDO A;  5HP1 A;  3C95 A;  3WNG A;  3KLE A;  1RNH A;  4CJV A;  1BCM A;  2G8K A;  3RR7 A;  1Q8I A;  1NK8 A;  1ASW A;  1ZBL A;  1IKY A;  4HTU A;  4N5S A;  4QAG A;  2XY5 A;  1RBV A;  1XI1 A;  1TK0 A;  3AVA A;  1ASU A;  1G15 A;  2ZQB A;  2HB5 A;  4PUO A;  2GBZ A;  4CEA A;  5JS1 A;  2PYJ A;  2HND A;  2YNI A;  3NHG A;  3V4I A;  1NK4 A;  4Y1C A;  2X74 A;  3DRR A;  2B5J A;  2FBV A;  1L3V A;  1TVR A;  4NYN A;  3EYZ A;  2P5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...