3G16A

Crystal structure of protein of unknown function with cystatin-like fold (yp_001022489.1) from methylobium petroleophilum pm1 at 1.45 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
b'GMTAPTLSRAAMEKVIRTYYDGCNEADEAKMIACFVPEAVHYFPAGMYGGAFRGAAQIAHRWRTAVETLGSYWTIDALVIDAETAEAAIEWTHFKTNQDKVLRGAECVEFDRASGLIREIRAFYASPQAEGIARLELGDFDYAGRGYRVTSPRKPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein with cystatin-like fold
publication title Crystal structure of protein of unknown function with cystatin-like fold (YP_001022489.1) from METHYLOBIUM PETROLEOPHILUM PM1 at 1.45 A resolution
rcsb
source organism Methylibium petroleiphilum pm1
molecule tags Structural genomics, unknown function
total genus 44
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3g16A00
3ER7A 2BMOB 3DUKA 3FF2A 4WYKB 2BMQB 4R1KA 3DMCA 4J8TA 5IEOA 3FKAA 4K1UA 2IMJA 1NU3A 3F7XA 1OF5B 2INXA 1VZZA 4L7KA 1JKGA 1AR0A 5CF1A 4HM1B 1DMMA 1GYBA 4ORLA 2OWPA 2RCDA 5IG0A 3EN1B 3OV4A 2HMLB 3JUQA 5AIHA 2RFRA 4IIAA 2GBXB 3FLJA 2QGUA 1U5OA 3B7CA 3SEDA 1JN5A 2F99A 2UX0A 1OHSA 4HZ9B 4XDWA 1DMQA 3JUPA 5IENA 3WMDA 3GRDA 2QIYA 2GBWB 1UUVB 2F98A 3K7CA 4OVMA 3NM2A 1QMAA 2A15A 3FGYA 3EN8A 3JUMA 3B4PA 2GEYA 3FF0A 3NUVA 3KKGA 1NDOB 2BNGA 5D81A 2F86B 1W00A 2JQ5A 3LYGA 5CLKA 8CHOA 3HX8A 3G8ZA 2R4IA 3VSYA 5AIGA 1E3RA 2HMNB 4CDLA 3I0YA 1TUHA 1W01A 1GY7A 1OHOA 3MHEA 5CK6A 1OH0A 3EBYA 4R9KA 1O7NB 1OUNA 3D9RA 4XBYA 4HM3B 2BMRB 3H3HA 3F9SA 3G16A 3CU3A 3FSDA 1W6YA 3NXJA 3OWSA 1E3VA 1JKGB 4WYKA 3K0ZA 4MJDA 1EA2A 4HM8B 3RGAA 3EF8A 3STDA 4I4KA 3KSPA 3EJVA 1ZO2A 1JB5A 1TP6A 2PZVA 1NWWA 2HMKB 4HM4B 4J9AA 4Q53A 4HM0B 3EX9A 3DXOA 4X2HA 3GZYB 3Q90A 3HZPA 3BLZA 1OF5A 2YFLB 3S5CA 1STDA 4L8OA 3F14A 2CHCA 1OGXA 1O7WB 4HM2B 4WWUC 3A76A 5JPUA 2K54A 3F8HA 1Q40B 3GZRA 4STDA 2YFIB 5JPPA 3DZLA 1EG9B 5BVBA 4FCJA 4N3VA 4OUQA 1O7HB 1A2KA 3OX9A 4LMIA 3EHCA 3BB9A 2XSOB 5CF2A 1SJWA 3NV0A 3MYTA 1HKXA 2CKFB 5D82A 5IERA 4H3UA 5IF6A 5IEPA 1O7PB 3GZXB 3UNLA 5KP4A 5G2GA 4HM5B 2Z7AA 4RZMA 3EBTA 5CXOA 5HGRA 5D83A 2HMMB 3ROBA 1JB2A 3B4OA 3VGNA 5DREA 5AEUB 1UUWB 1QJGA 2HMOB 3GWRA 1BUQA 3FH1A 1OHPA 4HM6B 4FCMA 1ASKA 1Z1SA 4KVHA 3SOAA 3B8LA 1ISKA 3F7SA 3NHXA 4HM7B 4XDVA 1S5AA 1GS3A 5IG3A 3EQQB 4HZBB 2HMJB 2W2CA 5KP1A 3CNXA 5KP3A 7STDA 1CQSA 2Z77A 1OGZA 4XM4A 3SOYA 1O7MB 2Z76A 3G0KA 1OCVA 2STDA 1WQLB 3HK4A 3RGRA 3EC9A 2B24B 3F8XA 3H51A 3CNMA 4PEJA 5DRVA 3JUNA 6STDA 3UJMA 4LEHA 5BXQA 2XR8B 5TGNA 3OWUA 2YFJB 4HVNA 1JN5B 3MG3A 5STDA 3FZWA 2GXFA 3KE7A 3MSOA 1E97A 1W02A 2B1XB 3OWYA 3M8CA 3LZAA 4X2OA 2RGQA 3DM8A 1ULJB 4K1VA 1Q42A 4HJLB 3JUOA 3GZBA 5AI1A 3NV0B 1OPYA 5IG4A 3CPOA 3ECFA 4LGQA 3KZTA 1Q40A 3MKIA 1K41A 3E99A 4HKVB 5AEWB 3OXAA 3IPTA 4WP5A 2GEXA 1O7GB 2XRXB 3NBRA 2XSHB 3T8NA 2I9WA 5EVHA 1JB4A 4R9LA 5AIFA 5AIIA 1C7HA 4XBXA 4XB5A 1ZX2A 1GY6A 3MG1A 4XBTA 5FW5A 1IDPA 3MG2A 1ULIB 4U13A 5IG5A 3F40A 1GY5A 3T8UA 4L8PA 1DMNA 4GB5A
chains in the Genus database with same CATH superfamily
1I3IA 1NO3A 3D79A 3ER7A 1QVF2 2BMOB 1ZS7A 3DUKA 4J5GA 3DGOA 2BU4A 3FF2A 1TIJA 1K8A4 3NBBA 1VQN3 1DE3A 3HI7A 4EW5A 4WYKB 3AGOA 1YIJ3 1BRSA 2BMQB 4R1KA 1RMSA 3DMCA 4J8TA 3N8BA 2HOHA 3V99A 5IEOA 5M19A 1FUWA 3LH4A 1AVLA 3BNEA 4AKYA 3KN4A 3FKAA 1Q814 4EC6A 1IT7A 4K1UA 2IMJA 5HOHA 3LT8A 3S27A 1MWRA 4JRFA 3CD63 1NU3A 1YHQ3 5LC6A 4MMYB 4GHOA 2F56A 1D6ZA 2FGTA 5G1KA 3U97A 3F7XA 1OF5B 1T5YA 3CCE3 1JZOA 1IU7A 4FR9A 1NNVA 2BT3A 1BSAA 3SVAA 1GSPA 2INXA 1VZZA 4L7KA 1N9JA 1JKGA 1VQ83 1AR0A 1BNGA 3LTDA 4O02B 1X1WA 1JNQA 4K90B 4N6TA 4MMXB 1BSCA 3S29A 4EBGA 1S723 5CF1A 4EYCA 2LYXA 1RCKA 4HM1B 1CYUA 1RLSA 1DMMA 1GYBA 4ORLA 2ZDJA 3KFQC 2OWPA 1GOUA 4TX4A 5JBSA 1UCKA 2RCDA 5IG0A 1SIHA 2CW9A 3EN1B 3N9HA 3CCS3 1IV7A 1VQ63 3EB8A 3OV4A 1V57A 1LNIA 1FGQA 1HZ1A 1UUGB 2CX0A 2HMLB 3AMOA 3JUQA 1GMRA 3LTAA 5AIHA 2WOHA 2CFDA 1TJDA 2RFRA 3MWZA 4KT3B 1LOVA 3I553 1VQO3 1TRQA 2SARA 1RN7A 2GBXB 4IIAA 2CFWA 3FLJA 2QGUA 1EQKA 3L0RA 5LC7A 1U5OA 1BRGA 1BRIA 3B7CA 1RGLA 1UI8A 1VQ93 1M904 1G0TA 1UCIA 1IVWA 2KF6A 3KIIA 3SEDA 1JN5A 1IYYA 2F99A 2UX0A 1OHSA 4HZ9B 1I70A 4ILFA 4XDWA 1DMQA 2UGIA 3JUPA 1RDSA 3WMDA 1RCLA 5IENA 3WOFB 3GRDA 3BNCA 2QIYA 1JBTA 2W6JH 4BIRA 2GBWB 1D6UA 1KSIA 1UUVB 3SXXA 3U1WA 1QALA 1JRQA 2F98A 3K7CA 2QA43 1VQ43 4OVMA 3LTCA 2IUJA 3NM2A 1QMAA 2A15A 2R41A 3FGYA 1A90A 2MC8A 3EN8A 3JUMA 3B4PA 3T0UA 3DY5A 1J2BA 2GEYA 2ML6A 4BU4A 3FF0A 3GSPA 3NQZA 1JV2B 3EE1A 3X3ZA 1FYSA 3NUVA 3KKGA 1MGRA 3S28A 1W4NA 3SLUA 1PU4A 3SX1A 1NDOB 2BNGA 2E2VA 1RNBA 1OACA 2P0XA 2RSXA 5D81A 2F86B 3PZWA 4HOHA 1MOLA 1V58A 1LRAA 1W00A 3MPHA 4FMDA 1Q7Y4 1MWUA 2RBIA 3FG4A 2KF4A 1FGMA 1WTHA 3K63A 2OTL3 2JQ5A 3LYGA 1YGEA 1QVG2 5CLKA 8CHOA 3HX8A 2E2UA 1NJI4 3G8ZA 2R4IA 3VSYA 2Y74A 2XF3A 4BTWA 1K28A 2P05A 2F5MA 5AIGA 1E3RA 1DVCA 2HMNB 1MNLA 4PEJA 1RGHA 4CDLA 1LOXA 3I0YA 3PCRA 1TUHA 3AGNA 1V74A 1R4CA 2CK3H 1W2B2 3URPA 1Y4KA 1GOVA 1RGKA 1W01A 4NPBA 2WOFA 1GY7A 1IQXA 1IK3A 2OQEC 3X42A 3X3XA 1OHOA 1UW1A 1YJ93 1C54A 1EKMA 2KCDA 5FGOA 4JF8A 3MHEA 5BIRA 5CK6A 4O3VA 1OH0A 3EBYA 4R9KA 3S67A 4WFOA 1N8QA 3QRDA 1T2HA 1O7NB 1OUNA 1ROAA 1YNVX 2L1SA 2Y73A 3OW22 1N5PA 9RNTA 2KRTA 1A2VA 2W04A 3D9RA 4XBYA 3NBJA 4HM3B 2BMRB 3H3HA 7GSPA 1RNTA 5BU4A 1IVXA 3F9SA 3G16A 1X1UA 1WMPA 3CU3A 3FSDA 1W2ZA 3CCJ3 2QEX3 4HBRA 2XGLA 1W6YA 1BIRA 1BOXA 1RTUA 3NXJA 3OWSA 1B3SA 2XFTA 1E3VA 4EXRA 3CC43 1LOWA 1MGWA 1JKGB 1TFKA 4WYKA 3FG1A 3K0ZA 3PS8A 1LQGC 4MJDA 1EA2A 4HM8B 3RGAA 3EF8A 3STDA 5G1LA 1TFOA 1U8CB 2CX1A 4I4KA 2GU1A 3KSPA 5GSPA 2IYJA 3EJVA 2C11A 1ZO2A 2J8XB 1JB5A 1LQMB 1IQ8A 1TP6A 1NWWA 2HMKB 1YVSA 2IUKA 2PZVA 2XH9A 4HM4B 4LSOA 5AYSC 4J9AA 1G02A 1FGTA 1I8VA 2OOVC 4Q53A 4BL2A 3FG3A 3EX9A 3DXOA 4HM0B 1ZGXA 4MEIA 4N6OB 4X2HA 4I5QA 1GMPA 5M1AA 3X40A 3GZYB 3Q90A 3J7Yd 3LMLA 2P0MA 3HZPA 1RHLA 1BAOA 2XEPA 3BLZA 1B21A 1OF5A 3K9MC 3ZG0A 1RGAA 1UGIA 2L4VA 2YFLB 3S5CA 1STDA 3O8YA 3ZG5A 1IQYA 4N6NB 3CCL3 4N6LA 1AY7A 4L8OA 1K9M4 3F14A 3WR2A 1HYFA 2CIUA 2W0QA 4O8SA 2FXTA 1G96A 4RNYA 3RDEA 2CFLA 4N6V0 3G6E3 5ELJA 2CFKA 1BGSA 1SARA 4RBNA 1BRNL 2RNTA 1RGFA 1OGXA 2CHCA 1O7WB 1AQZA 2Q07A 4HM2B 1YIT3 4WWUC 1RRLA 1N9EA 4CPKA 3A76A 2H0HA 5JPUA 2K54A 1BSEA 2MF7A 3K5TA 1B2UA 3F8HA 1YJN3 1B20A 2AAEA 4GL6A 2K3DA 1BRKA 1Q40B 1AV4A 2V1LA 3GZRA 4STDA 1TTOA 3IJEB 2YFIB 4O2HA 1FUSA 1PFPA 1RRHA 1BNEA 1SPUA 5JPPA 2WGOA 6RNTA 3DZLA 1RGEA 1EG9B 5BVBA 1GMQA 3LOYA 4FCJA 4N3VA 4OUQA 1O7HB 2GSPA 3UL6A 3VF1A 1A2KA 1BRJA 4KFDA 1R4YA 3DGLA 3OX9A 4LMIA 3V98A 2OCTA 3D4AA 1I2FA 2CFGA 1A2PA 1SIIA 2W56B 3EHCA 6GSPA 2W9QA 3BB9A 4BL3A 2XSOB 1X1XA 3DGNA 1RN1A 5EEOA 5CF2A 2P09A 3BNDA 4MMZB 1SJWA 1YVBI 3NV0A 5AYRB 3Q1CA 3MYTA 2CC3A 2YX9A 4KFFA 4RNTA 1BRHA 4DKIA 1VQL3 1HKXA 1CEWI 3CMA3 3IMAB 5RNTA 1D6YA 2CKFB 2C4BA 3X3YA 4LYLB 5D82A 5IERA 2BIRA 3FCSB 1SQWA 1JZDA 4H3UA 3BU4A 2ZHXB 5IF6A 1TU5A 2W9PA 5IEPA 1O7PB 2LQVA 3JVCA 1WMOA 1LNHA 1BNRA 2P38A 3GZXB 1QAFA 1JBRA 1BNJA 1RSNA 2JDIH 3UNLA 5KP4A 1N5HA 3AHSA 2W03A 1DETA 3WDGB 5G2GA 2D1WA 4HM5B 2Z7AA 3HIGA 3PGBA 4RZMA 3WA3A 1RGGA 3EBTA 5CXOA 1CYVA 5D83A 2HMMB 5HGRA 3LT9A 4FCZA 3ROBA 1QAKA 3GAXA 1JB2A 3B4OA 3ZFZA 3D5GA 3VGNA 5DREA 4EV2A 1BSDA 1LXEA 3WOEB 5AEUB 1UUWB 1QJGA 8RNTA 3G713 1DYUA 3D5IA 4KZ1A 2HMOB 3NQYA 3GWRA 1T2IA 1I0VA 4HAAA 1BUQA 3QK9A 3Q3FA 3FH1A 3HIIA 3X41A 1OHPA 1VQK3 1A67A 4KFEA 4HM6B 1N8R4 4FCMA 1ASKA 1Z1SA 4KVHA 3SOAA 2GU3A 3B8LA 2WO0A 2H0IA 2WGQA 2KF3A 1ISKA 3F7SA 1X1YA 3NHXA 4HM7B 4XDVA 2E2TA 1S5AA 2KAAA 1IT8A 1GS3A 5IG3A 1WNHA 3EQQB 1I2EA 1WMNA 2C10A 2HMJB 4HZBB 1I2GA 1BANA 2CG1A 5I97A 1I0XA 1RN4A 4IT7A 1GD4A 1BNFA 4G1MB 2W2CA 4AKZA 5KP1A 3CNXA 2OOVA 2CWUA 1LVNA 2BHMA 5KP3A 2SBLA 1AVKA 4NREA 7STDA 1CQSA 2Z77A 1OGZA 4NHFA 1FA3A 2CWVA 4XM4A 1FGRA 3SOYA 3WODG 1O7MB 2Z76A 1EUIC 3G0KA 1OCVA 2STDA 1WQLB 4CCVA 3HK4A 3EC9A 3RGRA 2B24B 1M9GA 1FZUA 1RGCA 3F8XA 4K61A 3H51A 1B2SA 2PNCA 1UCJA 3A5EA 3CNMA 3AMOB 2XFSA 3KCHA 4FMBA 1UCLA 3JUNA 3BIRA 5DRVA 5A0OB 1JBSA 6STDA 3UJMA 4LEHA 3V92A 5BXQA 2XR8B 4FMAA 1NB3I 1T3BA 1ROVA 2O3OA 2AADA 4R80A 3TDGA 1B2XA 3ALAA 5TGNA 3OWUA 1KWIA 2YFJB 3D3LA 1MWTA 4HVNA 3UB1A 1JN5B 3MG3A 4AEQA 1YI23 2IA7A 5STDA 3DGYA 4ZM8A 3G4S3 3FZWA 1UGHI 1BUJA 2H0GA 3CC73 3DGMA 2GXFA 1FUTA 3KE7A 1W7CA 1B27A 3MSOA 1FW7A 1E97A 1FGOA 1EEJA 3LXUX 1W02A 2KXGA 2B1XB 4GSPA 4J5KA 7RNTA 1STFI 3KSED 4OK0A 1GD3A 3CCR3 3OWYA 3M8CA 1IV9A 4FMCA 1VQM3 3LZAA 3Q2PA 2RGQA 4X2OA 3NX0A 3CCV3 1K734 3DM8A 5IW9A 1YGWA 1ULJB 3CCU3 4N6UA 4CJNA 4K1VA 2CH9A 3CCM3 1Q42A 2M7OA 2KF5A 2CWTA 4HJLB 1Q864 1PYLA 1W6CA 3JUOA 3GZBA 1DVDA 1TRPA 1BSBA 5AI1A 3NV0B 4IPBA 1OPYA 5IG4A 3CPOA 3ECFA 3SYUA 1LOYA 1YJW3 2O9UX 4LGQA 3KZTA 3CPW2 4RNZA 1Q40A 3CME3 1M1K4 3MKIA 1K41A 3E99A 3PCSA 2Z6BA 4HKVB 1BNIA 5AEWB 4WHAA 2K0MA 2CG0A 3OXAA 1RJOA 4EV5A 3IPTA 4QWTA 4WP5A 1RKYA 2GEXA 1O7GB 2F5WA 5M18A 1GOYA 4HYZA 2XRXB 3NBRA 2FNQA 1BU4A 3PXMA 3HOHA 1KC84 3NM7A 2XSHB 2ZA4A 3T8NA 1PY3A 2ZL8A 3PYJA 2W56A 1CH0A 2OQEA 2I9WA 1IVUA 1JJ22 3LTBA 5EVHA 1KQS2 3UL5A 1JB4A 5ELUA 4R9LA 3DH2A 4N6MA 2IY2A 5AIFA 4R4KA 5AIIA 1C7HA 1UI7A 4BTXA 3I563 4XBXA 2ML5A 1HU9A 1W5ZA 4XB5A 1Q824 1B2ZA 1Q7HA 4LZIA 1ZX2A 1VQQA 3BNBA 1MWSA 1US1A 1GY6A 3WA2X 1W6GA 2XGNA 1M1XB 3AHWA 3MG1A 4XBTA 2BO9B 4BTYA 1I3FA 1KD14 1VQ53 5FW5A 1VQ73 4H61A 1IDPA 1F8NA 2F4YA 1NB5I 3MG2A 3CXC2 2OTJ3 1BVIA 1ULIB 4U13A 3F40A 5EQLA 5IG5A 3RNTA 1IVVA 1GY5A 2UUGC 1BNSA 2D42A 1Q9EA 3N54B 4L8PA 1L5GB 3T8UA 3CC23 1DMNA 3CCQ3 3WHOA 1UDII 4GB5A 1B2MA 1VQP3
chains in the Genus database with same CATH topology
1NO3A 3ER7A 1QVF2 2BMOB 3DUKA 3DGOA 3FF2A 1TIJA 1K8A4 3NBBA 1VQN3 3HI7A 4WYKB 1YIJ3 2BMQB 4R1KA 3DMCA 4J8TA 3N8BA 3V99A 5IEOA 1FUWA 3LH4A 1AVLA 3BNEA 4AKYA 3KN4A 3FKAA 1Q814 4EC6A 1IT7A 4K1UA 2IMJA 3LT8A 3S27A 4JRFA 3CD63 1NU3A 1YHQ3 5LC6A 4MMYB 3U97A 1D6ZA 2FGTA 3F7XA 1OF5B 1T5YA 3CCE3 1IU7A 4FR9A 2BT3A 3SVAA 2INXA 1VZZA 4L7KA 1N9JA 1JKGA 1VQ83 1AR0A 3LTDA 4O02B 4N6TA 1JNQA 4K90B 4EBGA 4MMXB 3S29A 1S723 5CF1A 4EYCA 2LYXA 1CYUA 4HM1B 1DMMA 1GYBA 4ORLA 2ZDJA 3KFQC 2OWPA 4TX4A 5JBSA 2RCDA 5IG0A 3CCS3 1SIHA 2CW9A 3EN1B 3N9HA 1VQ63 1IV7A 3EB8A 3OV4A 1FGQA 2HMLB 3AMOA 3JUQA 3LTAA 5AIHA 2WOHA 2CFDA 2RFRA 3I553 3MWZA 1VQO3 4IIAA 1RN7A 2GBXB 2CFWA 3FLJA 2QGUA 1EQKA 3L0RA 5LC7A 1U5OA 3B7CA 1UI8A 1VQ93 1M904 1IVWA 3KIIA 3SEDA 1JN5A 2F99A 2UX0A 1OHSA 4HZ9B 4XDWA 1DMQA 3JUPA 5IENA 3WMDA 3WOFB 3GRDA 3BNCA 2QIYA 2W6JH 2GBWB 1D6UA 1KSIA 1UUVB 3SXXA 3U1WA 1QALA 1JRQA 2F98A 3K7CA 2QA43 1VQ43 4OVMA 3LTCA 2IUJA 3NM2A 1QMAA 2A15A 3FGYA 1A90A 2MC8A 3EN8A 3JUMA 3B4PA 3T0UA 3DY5A 1J2BA 2GEYA 2ML6A 3FF0A 3NQZA 1JV2B 3EE1A 3X3ZA 3NUVA 3KKGA 3S28A 1W4NA 3SLUA 1PU4A 3SX1A 1NDOB 2BNGA 2E2VA 1OACA 2P0XA 2RSXA 5D81A 2F86B 3PZWA 1MOLA 1W00A 3MPHA 4FMDA 1Q7Y4 3FG4A 1FGMA 1WTHA 3K63A 2OTL3 2JQ5A 3LYGA 1YGEA 1QVG2 5CLKA 8CHOA 3HX8A 2E2UA 1NJI4 3G8ZA 2R4IA 3VSYA 2Y74A 2XF3A 4BTWA 1K28A 2P05A 5AIGA 1E3RA 1DVCA 2HMNB 1MNLA 4CDLA 1LOXA 3I0YA 3PCRA 1TUHA 1V74A 1R4CA 2CK3H 1W2B2 1Y4KA 1W01A 2WOFA 1GY7A 1IQXA 1IK3A 2OQEC 3X42A 3X3XA 1OHOA 1UW1A 1EKMA 2KCDA 5FGOA 4JF8A 3MHEA 5CK6A 4O3VA 1OH0A 3EBYA 4R9KA 3S67A 4WFOA 1N8QA 3QRDA 1O7NB 1OUNA 1ROAA 2Y73A 3OW22 1N5PA 2KRTA 1A2VA 2W04A 3D9RA 4XBYA 3NBJA 4HM3B 2BMRB 3H3HA 1IVXA 3F9SA 3G16A 1WMPA 3CU3A 3FSDA 1W2ZA 3CCJ3 2QEX3 4HBRA 2XGLA 1W6YA 3NXJA 3OWSA 2XFTA 1E3VA 4EXRA 3CC43 1TFKA 1JKGB 4WYKA 3FG1A 3K0ZA 3PS8A 4MJDA 1EA2A 4HM8B 3RGAA 3EF8A 3STDA 1TFOA 1U8CB 4I4KA 2GU1A 3KSPA 3EJVA 2C11A 1ZO2A 1JB5A 1IQ8A 1TP6A 1NWWA 2HMKB 2IUKA 2PZVA 2XH9A 4HM4B 4LSOA 5AYSC 4J9AA 1FGTA 2OOVC 4Q53A 3FG3A 3EX9A 3DXOA 4HM0B 3X40A 4MEIA 4N6OB 4X2HA 1YJ93 3GZYB 3Q90A 3J7Yd 3LMLA 2P0MA 3HZPA 2XEPA 3BLZA 3K9MC 1OF5A 2L4VA 2YFLB 3S5CA 1STDA 3O8YA 1IQYA 4N6NB 3CCL3 4N6LA 1K9M4 4L8OA 3F14A 2CIUA 2W0QA 4O8SA 2FXTA 1G96A 4RNYA 3RDEA 2CFLA 4N6V0 3G6E3 5ELJA 2CFKA 4RBNA 2CHCA 1OGXA 1O7WB 2Q07A 4HM2B 1YIT3 4WWUC 1RRLA 1N9EA 3A76A 5JPUA 2K54A 2MF7A 3K5TA 3F8HA 4GL6A 2V1LA 1Q40B 1AV4A 3GZRA 4STDA 3IJEB 2YFIB 4O2HA 1PFPA 1RRHA 1SPUA 5JPPA 2WGOA 3DZLA 1EG9B 5BVBA 3LOYA 4FCJA 4N3VA 4OUQA 1O7HB 3UL6A 3VF1A 1A2KA 4KFDA 3DGLA 3OX9A 4LMIA 3V98A 2OCTA 2CFGA 1SIIA 2W56B 3EHCA 2W9QA 3BB9A 2XSOB 3DGNA 5EEOA 5CF2A 2P09A 3BNDA 4MMZB 1SJWA 1YVBI 3NV0A 5AYRB 3Q1CA 3MYTA 2CC3A 2YX9A 4KFFA 1VQL3 1HKXA 1CEWI 3CMA3 3IMAB 1D6YA 2CKFB 3X3YA 5D82A 5IERA 3FCSB 1SQWA 4H3UA 5IF6A 1TU5A 2W9PA 5IEPA 1O7PB 2LQVA 3JVCA 1WMOA 1LNHA 2P38A 3GZXB 1QAFA 2JDIH 3UNLA 5KP4A 1N5HA 2W03A 3WDGB 5G2GA 2D1WA 4HM5B 2Z7AA 3HIGA 3PGBA 4RZMA 3WA3A 3EBTA 5CXOA 5HGRA 1CYVA 5D83A 2HMMB 3LT9A 4FCZA 3ROBA 1QAKA 3GAXA 1JB2A 3B4OA 3VGNA 4EV2A 5DREA 1LXEA 3WOEB 5AEUB 1UUWB 1QJGA 3G713 1DYUA 4KZ1A 2HMOB 3NQYA 3GWRA 1BUQA 3QK9A 3FH1A 3HIIA 3X41A 1OHPA 1VQK3 1A67A 4KFEA 4HM6B 1N8R4 4FCMA 1ASKA 1Z1SA 4KVHA 3SOAA 2GU3A 3B8LA 2WO0A 2WGQA 1ISKA 3F7SA 3NHXA 4HM7B 4XDVA 2E2TA 1S5AA 1IT8A 1GS3A 5IG3A 1WNHA 3EQQB 4HZBB 1WMNA 2C10A 2HMJB 2CG1A 5I97A 4IT7A 1GD4A 4G1MB 2W2CA 4AKZA 5KP1A 3CNXA 2OOVA 2CWUA 1LVNA 2BHMA 5KP3A 2SBLA 1AVKA 4NREA 7STDA 1CQSA 2Z77A 1OGZA 4NHFA 1FA3A 2CWVA 4XM4A 1FGRA 3SOYA 3WODG 1O7MB 2Z76A 3G0KA 1OCVA 2STDA 1WQLB 4CCVA 3HK4A 3EC9A 3RGRA 2B24B 1M9GA 3F8XA 4K61A 3H51A 2PNCA 3CNMA 4FMBA 4LZIA 4PEJA 3AMOB 2XFSA 5DRVA 3JUNA 5A0OB 6STDA 3UJMA 4LEHA 3V92A 5BXQA 2XR8B 4FMAA 1NB3I 1ROVA 2O3OA 4R80A 3TDGA 3ALAA 5TGNA 3OWUA 1KWIA 2YFJB 3D3LA 4HVNA 3UB1A 1JN5B 3MG3A 4AEQA 1YI23 2IA7A 5STDA 4ZM8A 3G4S3 3FZWA 3CC73 3DGMA 2GXFA 3KE7A 1W7CA 3MSOA 1E97A 1FGOA 3LXUX 1W02A 2KXGA 2B1XB 1STFI 3KSED 4OK0A 1GD3A 3CCR3 3OWYA 3M8CA 1IV9A 4FMCA 1VQM3 3LZAA 3Q2PA 2RGQA 4X2OA 3NX0A 3CCV3 1K734 3DM8A 5IW9A 1ULJB 3CCU3 4N6UA 4K1VA 2CH9A 3CCM3 1Q42A 2M7OA 2CWTA 4HJLB 1Q864 1W6CA 3JUOA 3GZBA 1DVDA 5AI1A 3NV0B 4IPBA 1OPYA 5IG4A 3CPOA 3ECFA 1YJW3 2O9UX 4LGQA 3KZTA 3CPW2 4RNZA 1Q40A 3CME3 1M1K4 3MKIA 1K41A 3E99A 3PCSA 2Z6BA 4HKVB 5AEWB 4WHAA 2K0MA 2CG0A 3OXAA 1RJOA 4EV5A 3IPTA 4QWTA 4WP5A 1RKYA 2GEXA 1O7GB 4HYZA 2XRXB 3NBRA 2FNQA 3PXMA 1KC84 3NM7A 2XSHB 3T8NA 2ZL8A 3PYJA 2W56A 2OQEA 1JJ22 2I9WA 1IVUA 3LTBA 5EVHA 1KQS2 3UL5A 1JB4A 5ELUA 4R9LA 5AIFA 4N6MA 4R4KA 5AIIA 1C7HA 1UI7A 4BTXA 3I563 4XBXA 2ML5A 1HU9A 1W5ZA 4XB5A 1Q824 1ZX2A 3BNBA 1US1A 1GY6A 3WA2X 2XGNA 1W6GA 1M1XB 3MG1A 4XBTA 4BTYA 2BO9B 1KD14 1VQ53 5FW5A 1VQ73 4H61A 1IDPA 1F8NA 1NB5I 3MG2A 3CXC2 2OTJ3 1ULIB 4U13A 5IG5A 3F40A 5EQLA 1IVVA 1GY5A 3N54B 4L8PA 2D42A 1L5GB 3T8UA 3CC23 1YJN3 3CCQ3 1DMNA 4GB5A 1VQP3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ER7 A;  2BMO B;  3DUK A;  3FF2 A;  4WYK B;  2BMQ B;  4R1K A;  3DMC A;  4J8T A;  5IEO A;  3FKA A;  4K1U A;  2IMJ A;  1NU3 A;  3F7X A;  1OF5 B;  2INX A;  1VZZ A;  4L7K A;  1JKG A;  1AR0 A;  5CF1 A;  4HM1 B;  1DMM A;  1GYB A;  4ORL A;  2OWP A;  2RCD A;  5IG0 A;  3EN1 B;  3OV4 A;  2HML B;  3JUQ A;  5AIH A;  2RFR A;  4IIA A;  2GBX B;  3FLJ A;  2QGU A;  1U5O A;  3B7C A;  3SED A;  1JN5 A;  2F99 A;  2UX0 A;  1OHS A;  4HZ9 B;  4XDW A;  1DMQ A;  3JUP A;  5IEN A;  3WMD A;  3GRD A;  2QIY A;  2GBW B;  1UUV B;  2F98 A;  3K7C A;  4OVM A;  3NM2 A;  1QMA A;  2A15 A;  3FGY A;  3EN8 A;  3JUM A;  3B4P A;  2GEY A;  3FF0 A;  3NUV A;  3KKG A;  1NDO B;  2BNG A;  5D81 A;  2F86 B;  1W00 A;  2JQ5 A;  3LYG A;  5CLK A;  8CHO A;  3HX8 A;  3G8Z A;  2R4I A;  3VSY A;  5AIG A;  1E3R A;  2HMN B;  4CDL A;  3I0Y A;  1TUH A;  1W01 A;  1GY7 A;  1OHO A;  3MHE A;  5CK6 A;  1OH0 A;  3EBY A;  4R9K A;  1O7N B;  1OUN A;  3D9R A;  4XBY A;  4HM3 B;  2BMR B;  3H3H A;  3F9S A;  3G16 A;  3CU3 A;  3FSD A;  1W6Y A;  3NXJ A;  3OWS A;  1E3V A;  1JKG B;  4WYK A;  3K0Z A;  4MJD A;  1EA2 A;  4HM8 B;  3RGA A;  3EF8 A;  3STD A;  4I4K A;  3KSP A;  3EJV A;  1ZO2 A;  1JB5 A;  1TP6 A;  2PZV A;  1NWW A;  2HMK B;  4HM4 B;  4J9A A;  4Q53 A;  4HM0 B;  3EX9 A;  3DXO A;  4X2H A;  3GZY B;  3Q90 A;  3HZP A;  3BLZ A;  1OF5 A;  2YFL B;  3S5C A;  1STD A;  4L8O A;  3F14 A;  2CHC A;  1OGX A;  1O7W B;  4HM2 B;  4WWU C;  3A76 A;  5JPU A;  2K54 A;  3F8H A;  1Q40 B;  3GZR A;  4STD A;  2YFI B;  5JPP A;  3DZL A;  1EG9 B;  5BVB A;  4FCJ A;  4N3V A;  4OUQ A;  1O7H B;  1A2K A;  3OX9 A;  4LMI A;  3EHC A;  3BB9 A;  2XSO B;  5CF2 A;  1SJW A;  3NV0 A;  3MYT A;  1HKX A;  2CKF B;  5D82 A;  5IER A;  4H3U A;  5IF6 A;  5IEP A;  1O7P B;  3GZX B;  3UNL A;  5KP4 A;  5G2G A;  4HM5 B;  2Z7A A;  4RZM A;  3EBT A;  5CXO A;  5HGR A;  5D83 A;  2HMM B;  3ROB A;  1JB2 A;  3B4O A;  3VGN A;  5DRE A;  5AEU B;  1UUW B;  1QJG A;  2HMO B;  3GWR A;  1BUQ A;  3FH1 A;  1OHP A;  4HM6 B;  4FCM A;  1ASK A;  1Z1S A;  4KVH A;  3SOA A;  3B8L A;  1ISK A;  3F7S A;  3NHX A;  4HM7 B;  4XDV A;  1S5A A;  1GS3 A;  5IG3 A;  3EQQ B;  4HZB B;  2HMJ B;  2W2C A;  5KP1 A;  3CNX A;  5KP3 A;  7STD A;  1CQS A;  2Z77 A;  1OGZ A;  4XM4 A;  3SOY A;  1O7M B;  2Z76 A;  3G0K A;  1OCV A;  2STD A;  1WQL B;  3HK4 A;  3RGR A;  3EC9 A;  2B24 B;  3F8X A;  3H51 A;  3CNM A;  4PEJ A;  5DRV A;  3JUN A;  6STD A;  3UJM A;  4LEH A;  5BXQ A;  2XR8 B;  5TGN A;  3OWU A;  2YFJ B;  4HVN A;  1JN5 B;  3MG3 A;  5STD A;  3FZW A;  2GXF A;  3KE7 A;  3MSO A;  1E97 A;  1W02 A;  2B1X B;  3OWY A;  3M8C A;  3LZA A;  4X2O A;  2RGQ A;  3DM8 A;  1ULJ B;  4K1V A;  1Q42 A;  4HJL B;  3JUO A;  3GZB A;  5AI1 A;  3NV0 B;  1OPY A;  5IG4 A;  3CPO A;  3ECF A;  4LGQ A;  3KZT A;  1Q40 A;  3MKI A;  1K41 A;  3E99 A;  4HKV B;  5AEW B;  3OXA A;  3IPT A;  4WP5 A;  2GEX A;  1O7G B;  2XRX B;  3NBR A;  2XSH B;  3T8N A;  2I9W A;  5EVH A;  1JB4 A;  4R9L A;  5AIF A;  5AII A;  1C7H A;  4XBX A;  4XB5 A;  1ZX2 A;  1GY6 A;  3MG1 A;  4XBT A;  5FW5 A;  1IDP A;  3MG2 A;  1ULI B;  4U13 A;  5IG5 A;  3F40 A;  1GY5 A;  3T8U A;  4L8P A;  1DMN A;  4GB5 A; 
#chains in the Genus database with same CATH topology
 1I3I A;  1NO3 A;  3D79 A;  3ER7 A;  1QVF 2;  2BMO B;  1ZS7 A;  3DUK A;  4J5G A;  3DGO A;  2BU4 A;  3FF2 A;  1TIJ A;  1K8A 4;  3NBB A;  1VQN 3;  1DE3 A;  3HI7 A;  4EW5 A;  4WYK B;  3AGO A;  1YIJ 3;  1BRS A;  2BMQ B;  4R1K A;  1RMS A;  3DMC A;  4J8T A;  3N8B A;  2HOH A;  3V99 A;  5IEO A;  5M19 A;  1FUW A;  3LH4 A;  1AVL A;  3BNE A;  4AKY A;  3KN4 A;  3FKA A;  1Q81 4;  4EC6 A;  1IT7 A;  4K1U A;  2IMJ A;  5HOH A;  3LT8 A;  3S27 A;  1MWR A;  4JRF A;  3CD6 3;  1NU3 A;  1YHQ 3;  5LC6 A;  4MMY B;  4GHO A;  2F56 A;  1D6Z A;  2FGT A;  5G1K A;  3U97 A;  3F7X A;  1OF5 B;  1T5Y A;  3CCE 3;  1JZO A;  1IU7 A;  4FR9 A;  1NNV A;  2BT3 A;  1BSA A;  3SVA A;  1GSP A;  2INX A;  1VZZ A;  4L7K A;  1N9J A;  1JKG A;  1VQ8 3;  1AR0 A;  1BNG A;  3LTD A;  4O02 B;  1X1W A;  1JNQ A;  4K90 B;  4N6T A;  4MMX B;  1BSC A;  3S29 A;  4EBG A;  1S72 3;  5CF1 A;  4EYC A;  2LYX A;  1RCK A;  4HM1 B;  1CYU A;  1RLS A;  1DMM A;  1GYB A;  4ORL A;  2ZDJ A;  3KFQ C;  2OWP A;  1GOU A;  4TX4 A;  5JBS A;  1UCK A;  2RCD A;  5IG0 A;  1SIH A;  2CW9 A;  3EN1 B;  3N9H A;  3CCS 3;  1IV7 A;  1VQ6 3;  3EB8 A;  3OV4 A;  1V57 A;  1LNI A;  1FGQ A;  1HZ1 A;  1UUG B;  2CX0 A;  2HML B;  3AMO A;  3JUQ A;  1GMR A;  3LTA A;  5AIH A;  2WOH A;  2CFD A;  1TJD A;  2RFR A;  3MWZ A;  4KT3 B;  1LOV A;  3I55 3;  1VQO 3;  1TRQ A;  2SAR A;  1RN7 A;  2GBX B;  4IIA A;  2CFW A;  3FLJ A;  2QGU A;  1EQK A;  3L0R A;  5LC7 A;  1U5O A;  1BRG A;  1BRI A;  3B7C A;  1RGL A;  1UI8 A;  1VQ9 3;  1M90 4;  1G0T A;  1UCI A;  1IVW A;  2KF6 A;  3KII A;  3SED A;  1JN5 A;  1IYY A;  2F99 A;  2UX0 A;  1OHS A;  4HZ9 B;  1I70 A;  4ILF A;  4XDW A;  1DMQ A;  2UGI A;  3JUP A;  1RDS A;  3WMD A;  1RCL A;  5IEN A;  3WOF B;  3GRD A;  3BNC A;  2QIY A;  1JBT A;  2W6J H;  4BIR A;  2GBW B;  1D6U A;  1KSI A;  1UUV B;  3SXX A;  3U1W A;  1QAL A;  1JRQ A;  2F98 A;  3K7C A;  2QA4 3;  1VQ4 3;  4OVM A;  3LTC A;  2IUJ A;  3NM2 A;  1QMA A;  2A15 A;  2R41 A;  3FGY A;  1A90 A;  2MC8 A;  3EN8 A;  3JUM A;  3B4P A;  3T0U A;  3DY5 A;  1J2B A;  2GEY A;  2ML6 A;  4BU4 A;  3FF0 A;  3GSP A;  3NQZ A;  1JV2 B;  3EE1 A;  3X3Z A;  1FYS A;  3NUV A;  3KKG A;  1MGR A;  3S28 A;  1W4N A;  3SLU A;  1PU4 A;  3SX1 A;  1NDO B;  2BNG A;  2E2V A;  1RNB A;  1OAC A;  2P0X A;  2RSX A;  5D81 A;  2F86 B;  3PZW A;  4HOH A;  1MOL A;  1V58 A;  1LRA A;  1W00 A;  3MPH A;  4FMD A;  1Q7Y 4;  1MWU A;  2RBI A;  3FG4 A;  2KF4 A;  1FGM A;  1WTH A;  3K63 A;  2OTL 3;  2JQ5 A;  3LYG A;  1YGE A;  1QVG 2;  5CLK A;  8CHO A;  3HX8 A;  2E2U A;  1NJI 4;  3G8Z A;  2R4I A;  3VSY A;  2Y74 A;  2XF3 A;  4BTW A;  1K28 A;  2P05 A;  2F5M A;  5AIG A;  1E3R A;  1DVC A;  2HMN B;  1MNL A;  4PEJ A;  1RGH A;  4CDL A;  1LOX A;  3I0Y A;  3PCR A;  1TUH A;  3AGN A;  1V74 A;  1R4C A;  2CK3 H;  1W2B 2;  3URP A;  1Y4K A;  1GOV A;  1RGK A;  1W01 A;  4NPB A;  2WOF A;  1GY7 A;  1IQX A;  1IK3 A;  2OQE C;  3X42 A;  3X3X A;  1OHO A;  1UW1 A;  1YJ9 3;  1C54 A;  1EKM A;  2KCD A;  5FGO A;  4JF8 A;  3MHE A;  5BIR A;  5CK6 A;  4O3V A;  1OH0 A;  3EBY A;  4R9K A;  3S67 A;  4WFO A;  1N8Q A;  3QRD A;  1T2H A;  1O7N B;  1OUN A;  1ROA A;  1YNV X;  2L1S A;  2Y73 A;  3OW2 2;  1N5P A;  9RNT A;  2KRT A;  1A2V A;  2W04 A;  3D9R A;  4XBY A;  3NBJ A;  4HM3 B;  2BMR B;  3H3H A;  7GSP A;  1RNT A;  5BU4 A;  1IVX A;  3F9S A;  3G16 A;  1X1U A;  1WMP A;  3CU3 A;  3FSD A;  1W2Z A;  3CCJ 3;  2QEX 3;  4HBR A;  2XGL A;  1W6Y A;  1BIR A;  1BOX A;  1RTU A;  3NXJ A;  3OWS A;  1B3S A;  2XFT A;  1E3V A;  4EXR A;  3CC4 3;  1LOW A;  1MGW A;  1JKG B;  1TFK A;  4WYK A;  3FG1 A;  3K0Z A;  3PS8 A;  1LQG C;  4MJD A;  1EA2 A;  4HM8 B;  3RGA A;  3EF8 A;  3STD A;  5G1L A;  1TFO A;  1U8C B;  2CX1 A;  4I4K A;  2GU1 A;  3KSP A;  5GSP A;  2IYJ A;  3EJV A;  2C11 A;  1ZO2 A;  2J8X B;  1JB5 A;  1LQM B;  1IQ8 A;  1TP6 A;  1NWW A;  2HMK B;  1YVS A;  2IUK A;  2PZV A;  2XH9 A;  4HM4 B;  4LSO A;  5AYS C;  4J9A A;  1G02 A;  1FGT A;  1I8V A;  2OOV C;  4Q53 A;  4BL2 A;  3FG3 A;  3EX9 A;  3DXO A;  4HM0 B;  1ZGX A;  4MEI A;  4N6O B;  4X2H A;  4I5Q A;  1GMP A;  5M1A A;  3X40 A;  3GZY B;  3Q90 A;  3J7Y d;  3LML A;  2P0M A;  3HZP A;  1RHL A;  1BAO A;  2XEP A;  3BLZ A;  1B21 A;  1OF5 A;  3K9M C;  3ZG0 A;  1RGA A;  1UGI A;  2L4V A;  2YFL B;  3S5C A;  1STD A;  3O8Y A;  3ZG5 A;  1IQY A;  4N6N B;  3CCL 3;  4N6L A;  1AY7 A;  4L8O A;  1K9M 4;  3F14 A;  3WR2 A;  1HYF A;  2CIU A;  2W0Q A;  4O8S A;  2FXT A;  1G96 A;  4RNY A;  3RDE A;  2CFL A;  4N6V 0;  3G6E 3;  5ELJ A;  2CFK A;  1BGS A;  1SAR A;  4RBN A;  1BRN L;  2RNT A;  1RGF A;  1OGX A;  2CHC A;  1O7W B;  1AQZ A;  2Q07 A;  4HM2 B;  1YIT 3;  4WWU C;  1RRL A;  1N9E A;  4CPK A;  3A76 A;  2H0H A;  5JPU A;  2K54 A;  1BSE A;  2MF7 A;  3K5T A;  1B2U A;  3F8H A;  1YJN 3;  1B20 A;  2AAE A;  4GL6 A;  2K3D A;  1BRK A;  1Q40 B;  1AV4 A;  2V1L A;  3GZR A;  4STD A;  1TTO A;  3IJE B;  2YFI B;  4O2H A;  1FUS A;  1PFP A;  1RRH A;  1BNE A;  1SPU A;  5JPP A;  2WGO A;  6RNT A;  3DZL A;  1RGE A;  1EG9 B;  5BVB A;  1GMQ A;  3LOY A;  4FCJ A;  4N3V A;  4OUQ A;  1O7H B;  2GSP A;  3UL6 A;  3VF1 A;  1A2K A;  1BRJ A;  4KFD A;  1R4Y A;  3DGL A;  3OX9 A;  4LMI A;  3V98 A;  2OCT A;  3D4A A;  1I2F A;  2CFG A;  1A2P A;  1SII A;  2W56 B;  3EHC A;  6GSP A;  2W9Q A;  3BB9 A;  4BL3 A;  2XSO B;  1X1X A;  3DGN A;  1RN1 A;  5EEO A;  5CF2 A;  2P09 A;  3BND A;  4MMZ B;  1SJW A;  1YVB I;  3NV0 A;  5AYR B;  3Q1C A;  3MYT A;  2CC3 A;  2YX9 A;  4KFF A;  4RNT A;  1BRH A;  4DKI A;  1VQL 3;  1HKX A;  1CEW I;  3CMA 3;  3IMA B;  5RNT A;  1D6Y A;  2CKF B;  2C4B A;  3X3Y A;  4LYL B;  5D82 A;  5IER A;  2BIR A;  3FCS B;  1SQW A;  1JZD A;  4H3U A;  3BU4 A;  2ZHX B;  5IF6 A;  1TU5 A;  2W9P A;  5IEP A;  1O7P B;  2LQV A;  3JVC A;  1WMO A;  1LNH A;  1BNR A;  2P38 A;  3GZX B;  1QAF A;  1JBR A;  1BNJ A;  1RSN A;  2JDI H;  3UNL A;  5KP4 A;  1N5H A;  3AHS A;  2W03 A;  1DET A;  3WDG B;  5G2G A;  2D1W A;  4HM5 B;  2Z7A A;  3HIG A;  3PGB A;  4RZM A;  3WA3 A;  1RGG A;  3EBT A;  5CXO A;  1CYV A;  5D83 A;  2HMM B;  5HGR A;  3LT9 A;  4FCZ A;  3ROB A;  1QAK A;  3GAX A;  1JB2 A;  3B4O A;  3ZFZ A;  3D5G A;  3VGN A;  5DRE A;  4EV2 A;  1BSD A;  1LXE A;  3WOE B;  5AEU B;  1UUW B;  1QJG A;  8RNT A;  3G71 3;  1DYU A;  3D5I A;  4KZ1 A;  2HMO B;  3NQY A;  3GWR A;  1T2I A;  1I0V A;  4HAA A;  1BUQ A;  3QK9 A;  3Q3F A;  3FH1 A;  3HII A;  3X41 A;  1OHP A;  1VQK 3;  1A67 A;  4KFE A;  4HM6 B;  1N8R 4;  4FCM A;  1ASK A;  1Z1S A;  4KVH A;  3SOA A;  2GU3 A;  3B8L A;  2WO0 A;  2H0I A;  2WGQ A;  2KF3 A;  1ISK A;  3F7S A;  1X1Y A;  3NHX A;  4HM7 B;  4XDV A;  2E2T A;  1S5A A;  2KAA A;  1IT8 A;  1GS3 A;  5IG3 A;  1WNH A;  3EQQ B;  1I2E A;  1WMN A;  2C10 A;  2HMJ B;  4HZB B;  1I2G A;  1BAN A;  2CG1 A;  5I97 A;  1I0X A;  1RN4 A;  4IT7 A;  1GD4 A;  1BNF A;  4G1M B;  2W2C A;  4AKZ A;  5KP1 A;  3CNX A;  2OOV A;  2CWU A;  1LVN A;  2BHM A;  5KP3 A;  2SBL A;  1AVK A;  4NRE A;  7STD A;  1CQS A;  2Z77 A;  1OGZ A;  4NHF A;  1FA3 A;  2CWV A;  4XM4 A;  1FGR A;  3SOY A;  3WOD G;  1O7M B;  2Z76 A;  1EUI C;  3G0K A;  1OCV A;  2STD A;  1WQL B;  4CCV A;  3HK4 A;  3EC9 A;  3RGR A;  2B24 B;  1M9G A;  1FZU A;  1RGC A;  3F8X A;  4K61 A;  3H51 A;  1B2S A;  2PNC A;  1UCJ A;  3A5E A;  3CNM A;  3AMO B;  2XFS A;  3KCH A;  4FMB A;  1UCL A;  3JUN A;  3BIR A;  5DRV A;  5A0O B;  1JBS A;  6STD A;  3UJM A;  4LEH A;  3V92 A;  5BXQ A;  2XR8 B;  4FMA A;  1NB3 I;  1T3B A;  1ROV A;  2O3O A;  2AAD A;  4R80 A;  3TDG A;  1B2X A;  3ALA A;  5TGN A;  3OWU A;  1KWI A;  2YFJ B;  3D3L A;  1MWT A;  4HVN A;  3UB1 A;  1JN5 B;  3MG3 A;  4AEQ A;  1YI2 3;  2IA7 A;  5STD A;  3DGY A;  4ZM8 A;  3G4S 3;  3FZW A;  1UGH I;  1BUJ A;  2H0G A;  3CC7 3;  3DGM A;  2GXF A;  1FUT A;  3KE7 A;  1W7C A;  1B27 A;  3MSO A;  1FW7 A;  1E97 A;  1FGO A;  1EEJ A;  3LXU X;  1W02 A;  2KXG A;  2B1X B;  4GSP A;  4J5K A;  7RNT A;  1STF I;  3KSE D;  4OK0 A;  1GD3 A;  3CCR 3;  3OWY A;  3M8C A;  1IV9 A;  4FMC A;  1VQM 3;  3LZA A;  3Q2P A;  2RGQ A;  4X2O A;  3NX0 A;  3CCV 3;  1K73 4;  3DM8 A;  5IW9 A;  1YGW A;  1ULJ B;  3CCU 3;  4N6U A;  4CJN A;  4K1V A;  2CH9 A;  3CCM 3;  1Q42 A;  2M7O A;  2KF5 A;  2CWT A;  4HJL B;  1Q86 4;  1PYL A;  1W6C A;  3JUO A;  3GZB A;  1DVD A;  1TRP A;  1BSB A;  5AI1 A;  3NV0 B;  4IPB A;  1OPY A;  5IG4 A;  3CPO A;  3ECF A;  3SYU A;  1LOY A;  1YJW 3;  2O9U X;  4LGQ A;  3KZT A;  3CPW 2;  4RNZ A;  1Q40 A;  3CME 3;  1M1K 4;  3MKI A;  1K41 A;  3E99 A;  3PCS A;  2Z6B A;  4HKV B;  1BNI A;  5AEW B;  4WHA A;  2K0M A;  2CG0 A;  3OXA A;  1RJO A;  4EV5 A;  3IPT A;  4QWT A;  4WP5 A;  1RKY A;  2GEX A;  1O7G B;  2F5W A;  5M18 A;  1GOY A;  4HYZ A;  2XRX B;  3NBR A;  2FNQ A;  1BU4 A;  3PXM A;  3HOH A;  1KC8 4;  3NM7 A;  2XSH B;  2ZA4 A;  3T8N A;  1PY3 A;  2ZL8 A;  3PYJ A;  2W56 A;  1CH0 A;  2OQE A;  2I9W A;  1IVU A;  1JJ2 2;  3LTB A;  5EVH A;  1KQS 2;  3UL5 A;  1JB4 A;  5ELU A;  4R9L A;  3DH2 A;  4N6M A;  2IY2 A;  5AIF A;  4R4K A;  5AII A;  1C7H A;  1UI7 A;  4BTX A;  3I56 3;  4XBX A;  2ML5 A;  1HU9 A;  1W5Z A;  4XB5 A;  1Q82 4;  1B2Z A;  1Q7H A;  4LZI A;  1ZX2 A;  1VQQ A;  3BNB A;  1MWS A;  1US1 A;  1GY6 A;  3WA2 X;  1W6G A;  2XGN A;  1M1X B;  3AHW A;  3MG1 A;  4XBT A;  2BO9 B;  4BTY A;  1I3F A;  1KD1 4;  1VQ5 3;  5FW5 A;  1VQ7 3;  4H61 A;  1IDP A;  1F8N A;  2F4Y A;  1NB5 I;  3MG2 A;  3CXC 2;  2OTJ 3;  1BVI A;  1ULI B;  4U13 A;  3F40 A;  5EQL A;  5IG5 A;  3RNT A;  1IVV A;  1GY5 A;  2UUG C;  1BNS A;  2D42 A;  1Q9E A;  3N54 B;  4L8P A;  1L5G B;  3T8U A;  3CC2 3;  1DMN A;  3CCQ 3;  3WHO A;  1UDI I;  4GB5 A;  1B2M A;  1VQP 3; 
#chains in the Genus database with same CATH homology
 1NO3 A;  3ER7 A;  1QVF 2;  2BMO B;  3DUK A;  3DGO A;  3FF2 A;  1TIJ A;  1K8A 4;  3NBB A;  1VQN 3;  3HI7 A;  4WYK B;  1YIJ 3;  2BMQ B;  4R1K A;  3DMC A;  4J8T A;  3N8B A;  3V99 A;  5IEO A;  1FUW A;  3LH4 A;  1AVL A;  3BNE A;  4AKY A;  3KN4 A;  3FKA A;  1Q81 4;  4EC6 A;  1IT7 A;  4K1U A;  2IMJ A;  3LT8 A;  3S27 A;  4JRF A;  3CD6 3;  1NU3 A;  1YHQ 3;  5LC6 A;  4MMY B;  3U97 A;  1D6Z A;  2FGT A;  3F7X A;  1OF5 B;  1T5Y A;  3CCE 3;  1IU7 A;  4FR9 A;  2BT3 A;  3SVA A;  2INX A;  1VZZ A;  4L7K A;  1N9J A;  1JKG A;  1VQ8 3;  1AR0 A;  3LTD A;  4O02 B;  4N6T A;  1JNQ A;  4K90 B;  4EBG A;  4MMX B;  3S29 A;  1S72 3;  5CF1 A;  4EYC A;  2LYX A;  1CYU A;  4HM1 B;  1DMM A;  1GYB A;  4ORL A;  2ZDJ A;  3KFQ C;  2OWP A;  4TX4 A;  5JBS A;  2RCD A;  5IG0 A;  3CCS 3;  1SIH A;  2CW9 A;  3EN1 B;  3N9H A;  1VQ6 3;  1IV7 A;  3EB8 A;  3OV4 A;  1FGQ A;  2HML B;  3AMO A;  3JUQ A;  3LTA A;  5AIH A;  2WOH A;  2CFD A;  2RFR A;  3I55 3;  3MWZ A;  1VQO 3;  4IIA A;  1RN7 A;  2GBX B;  2CFW A;  3FLJ A;  2QGU A;  1EQK A;  3L0R A;  5LC7 A;  1U5O A;  3B7C A;  1UI8 A;  1VQ9 3;  1M90 4;  1IVW A;  3KII A;  3SED A;  1JN5 A;  2F99 A;  2UX0 A;  1OHS A;  4HZ9 B;  4XDW A;  1DMQ A;  3JUP A;  5IEN A;  3WMD A;  3WOF B;  3GRD A;  3BNC A;  2QIY A;  2W6J H;  2GBW B;  1D6U A;  1KSI A;  1UUV B;  3SXX A;  3U1W A;  1QAL A;  1JRQ A;  2F98 A;  3K7C A;  2QA4 3;  1VQ4 3;  4OVM A;  3LTC A;  2IUJ A;  3NM2 A;  1QMA A;  2A15 A;  3FGY A;  1A90 A;  2MC8 A;  3EN8 A;  3JUM A;  3B4P A;  3T0U A;  3DY5 A;  1J2B A;  2GEY A;  2ML6 A;  3FF0 A;  3NQZ A;  1JV2 B;  3EE1 A;  3X3Z A;  3NUV A;  3KKG A;  3S28 A;  1W4N A;  3SLU A;  1PU4 A;  3SX1 A;  1NDO B;  2BNG A;  2E2V A;  1OAC A;  2P0X A;  2RSX A;  5D81 A;  2F86 B;  3PZW A;  1MOL A;  1W00 A;  3MPH A;  4FMD A;  1Q7Y 4;  3FG4 A;  1FGM A;  1WTH A;  3K63 A;  2OTL 3;  2JQ5 A;  3LYG A;  1YGE A;  1QVG 2;  5CLK A;  8CHO A;  3HX8 A;  2E2U A;  1NJI 4;  3G8Z A;  2R4I A;  3VSY A;  2Y74 A;  2XF3 A;  4BTW A;  1K28 A;  2P05 A;  5AIG A;  1E3R A;  1DVC A;  2HMN B;  1MNL A;  4CDL A;  1LOX A;  3I0Y A;  3PCR A;  1TUH A;  1V74 A;  1R4C A;  2CK3 H;  1W2B 2;  1Y4K A;  1W01 A;  2WOF A;  1GY7 A;  1IQX A;  1IK3 A;  2OQE C;  3X42 A;  3X3X A;  1OHO A;  1UW1 A;  1EKM A;  2KCD A;  5FGO A;  4JF8 A;  3MHE A;  5CK6 A;  4O3V A;  1OH0 A;  3EBY A;  4R9K A;  3S67 A;  4WFO A;  1N8Q A;  3QRD A;  1O7N B;  1OUN A;  1ROA A;  2Y73 A;  3OW2 2;  1N5P A;  2KRT A;  1A2V A;  2W04 A;  3D9R A;  4XBY A;  3NBJ A;  4HM3 B;  2BMR B;  3H3H A;  1IVX A;  3F9S A;  3G16 A;  1WMP A;  3CU3 A;  3FSD A;  1W2Z A;  3CCJ 3;  2QEX 3;  4HBR A;  2XGL A;  1W6Y A;  3NXJ A;  3OWS A;  2XFT A;  1E3V A;  4EXR A;  3CC4 3;  1TFK A;  1JKG B;  4WYK A;  3FG1 A;  3K0Z A;  3PS8 A;  4MJD A;  1EA2 A;  4HM8 B;  3RGA A;  3EF8 A;  3STD A;  1TFO A;  1U8C B;  4I4K A;  2GU1 A;  3KSP A;  3EJV A;  2C11 A;  1ZO2 A;  1JB5 A;  1IQ8 A;  1TP6 A;  1NWW A;  2HMK B;  2IUK A;  2PZV A;  2XH9 A;  4HM4 B;  4LSO A;  5AYS C;  4J9A A;  1FGT A;  2OOV C;  4Q53 A;  3FG3 A;  3EX9 A;  3DXO A;  4HM0 B;  3X40 A;  4MEI A;  4N6O B;  4X2H A;  1YJ9 3;  3GZY B;  3Q90 A;  3J7Y d;  3LML A;  2P0M A;  3HZP A;  2XEP A;  3BLZ A;  3K9M C;  1OF5 A;  2L4V A;  2YFL B;  3S5C A;  1STD A;  3O8Y A;  1IQY A;  4N6N B;  3CCL 3;  4N6L A;  1K9M 4;  4L8O A;  3F14 A;  2CIU A;  2W0Q A;  4O8S A;  2FXT A;  1G96 A;  4RNY A;  3RDE A;  2CFL A;  4N6V 0;  3G6E 3;  5ELJ A;  2CFK A;  4RBN A;  2CHC A;  1OGX A;  1O7W B;  2Q07 A;  4HM2 B;  1YIT 3;  4WWU C;  1RRL A;  1N9E A;  3A76 A;  5JPU A;  2K54 A;  2MF7 A;  3K5T A;  3F8H A;  4GL6 A;  2V1L A;  1Q40 B;  1AV4 A;  3GZR A;  4STD A;  3IJE B;  2YFI B;  4O2H A;  1PFP A;  1RRH A;  1SPU A;  5JPP A;  2WGO A;  3DZL A;  1EG9 B;  5BVB A;  3LOY A;  4FCJ A;  4N3V A;  4OUQ A;  1O7H B;  3UL6 A;  3VF1 A;  1A2K A;  4KFD A;  3DGL A;  3OX9 A;  4LMI A;  3V98 A;  2OCT A;  2CFG A;  1SII A;  2W56 B;  3EHC A;  2W9Q A;  3BB9 A;  2XSO B;  3DGN A;  5EEO A;  5CF2 A;  2P09 A;  3BND A;  4MMZ B;  1SJW A;  1YVB I;  3NV0 A;  5AYR B;  3Q1C A;  3MYT A;  2CC3 A;  2YX9 A;  4KFF A;  1VQL 3;  1HKX A;  1CEW I;  3CMA 3;  3IMA B;  1D6Y A;  2CKF B;  3X3Y A;  5D82 A;  5IER A;  3FCS B;  1SQW A;  4H3U A;  5IF6 A;  1TU5 A;  2W9P A;  5IEP A;  1O7P B;  2LQV A;  3JVC A;  1WMO A;  1LNH A;  2P38 A;  3GZX B;  1QAF A;  2JDI H;  3UNL A;  5KP4 A;  1N5H A;  2W03 A;  3WDG B;  5G2G A;  2D1W A;  4HM5 B;  2Z7A A;  3HIG A;  3PGB A;  4RZM A;  3WA3 A;  3EBT A;  5CXO A;  5HGR A;  1CYV A;  5D83 A;  2HMM B;  3LT9 A;  4FCZ A;  3ROB A;  1QAK A;  3GAX A;  1JB2 A;  3B4O A;  3VGN A;  4EV2 A;  5DRE A;  1LXE A;  3WOE B;  5AEU B;  1UUW B;  1QJG A;  3G71 3;  1DYU A;  4KZ1 A;  2HMO B;  3NQY A;  3GWR A;  1BUQ A;  3QK9 A;  3FH1 A;  3HII A;  3X41 A;  1OHP A;  1VQK 3;  1A67 A;  4KFE A;  4HM6 B;  1N8R 4;  4FCM A;  1ASK A;  1Z1S A;  4KVH A;  3SOA A;  2GU3 A;  3B8L A;  2WO0 A;  2WGQ A;  1ISK A;  3F7S A;  3NHX A;  4HM7 B;  4XDV A;  2E2T A;  1S5A A;  1IT8 A;  1GS3 A;  5IG3 A;  1WNH A;  3EQQ B;  4HZB B;  1WMN A;  2C10 A;  2HMJ B;  2CG1 A;  5I97 A;  4IT7 A;  1GD4 A;  4G1M B;  2W2C A;  4AKZ A;  5KP1 A;  3CNX A;  2OOV A;  2CWU A;  1LVN A;  2BHM A;  5KP3 A;  2SBL A;  1AVK A;  4NRE A;  7STD A;  1CQS A;  2Z77 A;  1OGZ A;  4NHF A;  1FA3 A;  2CWV A;  4XM4 A;  1FGR A;  3SOY A;  3WOD G;  1O7M B;  2Z76 A;  3G0K A;  1OCV A;  2STD A;  1WQL B;  4CCV A;  3HK4 A;  3EC9 A;  3RGR A;  2B24 B;  1M9G A;  3F8X A;  4K61 A;  3H51 A;  2PNC A;  3CNM A;  4FMB A;  4LZI A;  4PEJ A;  3AMO B;  2XFS A;  5DRV A;  3JUN A;  5A0O B;  6STD A;  3UJM A;  4LEH A;  3V92 A;  5BXQ A;  2XR8 B;  4FMA A;  1NB3 I;  1ROV A;  2O3O A;  4R80 A;  3TDG A;  3ALA A;  5TGN A;  3OWU A;  1KWI A;  2YFJ B;  3D3L A;  4HVN A;  3UB1 A;  1JN5 B;  3MG3 A;  4AEQ A;  1YI2 3;  2IA7 A;  5STD A;  4ZM8 A;  3G4S 3;  3FZW A;  3CC7 3;  3DGM A;  2GXF A;  3KE7 A;  1W7C A;  3MSO A;  1E97 A;  1FGO A;  3LXU X;  1W02 A;  2KXG A;  2B1X B;  1STF I;  3KSE D;  4OK0 A;  1GD3 A;  3CCR 3;  3OWY A;  3M8C A;  1IV9 A;  4FMC A;  1VQM 3;  3LZA A;  3Q2P A;  2RGQ A;  4X2O A;  3NX0 A;  3CCV 3;  1K73 4;  3DM8 A;  5IW9 A;  1ULJ B;  3CCU 3;  4N6U A;  4K1V A;  2CH9 A;  3CCM 3;  1Q42 A;  2M7O A;  2CWT A;  4HJL B;  1Q86 4;  1W6C A;  3JUO A;  3GZB A;  1DVD A;  5AI1 A;  3NV0 B;  4IPB A;  1OPY A;  5IG4 A;  3CPO A;  3ECF A;  1YJW 3;  2O9U X;  4LGQ A;  3KZT A;  3CPW 2;  4RNZ A;  1Q40 A;  3CME 3;  1M1K 4;  3MKI A;  1K41 A;  3E99 A;  3PCS A;  2Z6B A;  4HKV B;  5AEW B;  4WHA A;  2K0M A;  2CG0 A;  3OXA A;  1RJO A;  4EV5 A;  3IPT A;  4QWT A;  4WP5 A;  1RKY A;  2GEX A;  1O7G B;  4HYZ A;  2XRX B;  3NBR A;  2FNQ A;  3PXM A;  1KC8 4;  3NM7 A;  2XSH B;  3T8N A;  2ZL8 A;  3PYJ A;  2W56 A;  2OQE A;  1JJ2 2;  2I9W A;  1IVU A;  3LTB A;  5EVH A;  1KQS 2;  3UL5 A;  1JB4 A;  5ELU A;  4R9L A;  5AIF A;  4N6M A;  4R4K A;  5AII A;  1C7H A;  1UI7 A;  4BTX A;  3I56 3;  4XBX A;  2ML5 A;  1HU9 A;  1W5Z A;  4XB5 A;  1Q82 4;  1ZX2 A;  3BNB A;  1US1 A;  1GY6 A;  3WA2 X;  2XGN A;  1W6G A;  1M1X B;  3MG1 A;  4XBT A;  4BTY A;  2BO9 B;  1KD1 4;  1VQ5 3;  5FW5 A;  1VQ7 3;  4H61 A;  1IDP A;  1F8N A;  1NB5 I;  3MG2 A;  3CXC 2;  2OTJ 3;  1ULI B;  4U13 A;  5IG5 A;  3F40 A;  5EQL A;  1IVV A;  1GY5 A;  3N54 B;  4L8P A;  2D42 A;  1L5G B;  3T8U A;  3CC2 3;  1YJN 3;  3CCQ 3;  1DMN A;  4GB5 A;  1VQP 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...