The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
97
|
structure length |
97
|
Chain Sequence |
NNKLKTQAVEQLFQAILSLKDLDEAYDFFEDVCTINEILSLSQRFEVAKMLREHRTYLDIAEKTGASTATISRVNRSLNYGNDGYDRVFERLGMLEK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription, dna binding protein
|
molecule keywords |
The TrpR like protein from Eubacterium eligens ATCC 27750
|
publication title |
The crystal structure of a TrpR like protein from Eubacterium eligens ATCC 27750
rcsb |
source organism |
Eubacterium eligens
|
total genus |
36
|
structure length |
97
|
sequence length |
97
|
ec nomenclature | |
pdb deposition date | 2009-01-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01371 | Trp_repressor | Trp repressor protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Trp Operon Repressor; Chain A | TrpR-like |
#chains in the Genus database with same CATH superfamily 3G1C A; 2OZ9 R; 1ZT9 A; 1WRT R; 3SSX N; 2XDI A; 1JHG A; 1CO0 A; 1WRS R; 3KOR A; 1WRP R; 1MI7 R; 3FRW A; 3SSW N; 1RCS A; 1TRO A; 3WRP A; 1TRR A; #chains in the Genus database with same CATH topology 4YQN A; 4YVI A; 3KY7 A; 4YQO A; 4MCD A; 1WRS R; 3KOR A; 1UAJ A; 1MI7 R; 4YQR A; 1TRR A; 4YPZ A; 3WRP A; 1OY5 A; 4YPY A; 4YQG A; 4YVG A; 3SSX N; 4MCC A; 4YQ4 A; 4YQ0 A; 4YQ8 A; 3FRW A; 4YVJ A; 4YQ5 A; 1P9P A; 4MCB A; 3IEF A; 4YQI A; 4YQD A; 4YQQ A; 4H3Y A; 5D9F A; 2OZ9 R; 4YQJ A; 4YQ9 A; 4YVK A; 1UAK A; 1UAM A; 1JHG A; 4YPX A; 1CO0 A; 4YQ2 A; 4YQS A; 4H3Z A; 4YQT A; 3AXZ A; 4YQ3 A; 3G1C A; 4YPW A; 4YQK A; 4YQA A; 4IG6 A; 4YVH A; 3QUV A; 1ZT9 A; 1WRT R; 4YQ7 A; 2XDI A; 4YQ1 A; 1UAL A; 4YQ6 A; 4YQC A; 1WRP R; 4YQB A; 4YQL A; 3SSW N; 1RCS A; 3KNU A; 1TRO A; 4YQP A; #chains in the Genus database with same CATH homology 3G1C A; 2OZ9 R; 1ZT9 A; 1WRT R; 3SSX N; 2XDI A; 1JHG A; 1CO0 A; 1WRS R; 3KOR A; 1WRP R; 1MI7 R; 3FRW A; 3SSW N; 1RCS A; 1TRO A; 3WRP A; 1TRR A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...