3G1FA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydroorotidine 5'-monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
220
Chain Sequence
VDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 77
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1fA00
1KTNA 2HSAA 3TJLA 3TFCA 5AHIA 5AC7A 5J5DA 2C0AA 3N14A 1K02A 5LSMA 3PB0A 5D38A 1OX5A 4GUGA 3O05A 2VFGA 3L0KA 5AOUA 3VE9A 3DFOA 5U4NA 1Q6QA 3EWZA 1LYXA 3OIXA 4UMBA 4JXCA 2DJXA 4JY8A 5IBXC 2QDHA 4FNSA 5D2XA 1YTEA 3UWWA 2ISSA 3I65A 1JVNA 3GDMA 4XBKA 3KX6A 3GX9A 3P62A 4JD4A 1OVDA 1TREA 1W5OA 4JTHA 4LRSA 1I45A 3JRKA 3TU9A 5A8GA 2CFFA 2E6FA 1ONRA 1M7OA 2J9YA 3BW3A 5DN1A 3W7HA 2FTPA 3W84A 1ME7A 3N73A 4NJHA 5C55A 3A5VA 2JKPA 3YPIA 1KFLA 3B4UA 4GUJA 1FDZA 4CNNA 4RKAA 4ORIA 3TR2A 3LCXA 1K8ZA 1Z48A 1NF0A 4AHQA 4O28A 3IGSA 1R2RA 2BTMA 1S5WA 2QJHA 4MY9A 1TPH1 1QOPA 4TU1A 5E0KA 1H50A 3SY5A 4YL2A 4JTLA 1SW7A 2ZZ1A 4WY0A 2V82A 2OJPA 4HPJA 3LXBA 5HWJA 3W1TA 1ZAJA 4JTKA 2ZRUA 4M7SA 1LORA 1EX5A 4DBEA 2ZZ2A 3DFPA 3KRSA 5G1TA 5EA9A 3BV4A 2CZDA 3GVGA 4UC5A 2DZUA 3W85A 1I2QA 1CW2A 5IBXA 5BW6A 4XZ9A 1VCVA 3MO7A 3GDLA 3UD6A 2R14A 3F4NA 3UXAA 1YPIA 3ABRA 1D3GA 3O6YX 4FIRA 4GWEA 1QAPA 2E77A 1OFDA 1OFBA 1X8FA 4MY1A 1O95A 3OVQA 3GR8A 3S9YA 4A21A 1GOXA 4DO4A 1DKWA 2TRSA 2GUUA 4FXRA 1VLIA 1RR2A 4YWIA 4JTUA 1PIIA 3ANYA 3DFTA 4O0KA 4HNNA 1XBXA 5AC6A 2WNQA 3NZ1A 1U83A 2RKXA 3MW7A 3CC1A 3TQ0A 2TMDA 4UTUA 3NG3A 4HNTA 5L9FA 3TNOA 3PULA 4RCXA 2V9DA 4AB4A 4UMAA 3NM1A 1TPC1 3LM7A 1HUVA 1H1ZA 3NPXA 1QCWA 2CLHA 3DKLA 2ABBA 2V30A 4IPJA 4MFEA 2Y70A 4NVTA 4O0ZA 2PE4A 4ML9A 2Q3OA 3L67A 4P2VA 4RZ5A 3BW4A 5FF2A 4HT3A 3TIMA 2C16A 1LDCA 2A6LA 1JCJA 3LRMA 4AXKA 3MP4A 3HGOA 4M6PA 3G1HA 4UFLA 1ZAHA 3SGUA 4EIVA 3EX6A 4JTEA 4UXDA 4O18A 2X1SA 3L5MA 1VH7A 2FIQA 3RNDA 3KVMA 4DF2A 1JJKA 5G1YA 3NL6A 5D37A 4Z1BA 1TSIA 1RQHA 2FJKA 3PUDA 2Y61A 3PVFA 2EHHA 1CI1A 4JICA 4FF7A 3W72A 2E68A 1VPXA 3LERA 3MP5A 3P67A 4AHPA 1OYBA 3N19B 1I2NA 5F4WA 4NNBA 3WJYA 3LHWA 1L6YA 3EXRA 4JX5A 4X2RA 4D2JA 3TC7A 3G3MA 1JCYA 1PCWA 1B9BA 1N7KA 2E6AA 1D9EA 1YXCA 3RF9A 3W7QA 3AO0A 3THAA 4EOUA 3ATZA 5CSRA 1A50A 3NM3A 3G24A 2R91A 3P74A 4S1FA 2HS8A 6ALDA 1YTKA 4JDBA 1G6CA 1W1ZA 3IIOA 4IWWA 4LU0A 3UWYA 3SIZA 3QRHA 1TRDA 1C29A 1GG0A 3ABQA 3FKRA 3TC6A 1K8XA 3UYCA 3EWWA 2WO5A 2GJNA 2J9XA 3QPZA 3P8JA 5AYYA 5LGXA 2YR1A 4PEKA 4N4PA 1T0OA 4NJGA 4UFJA 1H7WA 3CPRA 5IM51 2J9ZA 4O53A 1B3OA 4OHQA 5DLCA 2H8XA 1KFKA 1HL2A 1KM3A 3KRZA 1ZFJA 1O4UA 2DZXA 2QAPA 1XM3A 1TPDA 2A7PA 4LVDA 1JUEA 3TMQA 1DJNA 5DCBA 1KV5A 1JUKA 2W0UA 1BEUA 3O16A 4DF0A 3QPYA 1A5AA 5D2VA 3LTPA 2CW6A 3RFAA 3PC0A 4FNUA 3TA6A 4Q32A 3EX3A 4LUJA 5K9XA 3FEMA 1F6KA 3S1XA 4LC6A 4NUWA 4NJKA 4HPXA 3IVTA 3L5LA 1AW2A 4GUIA 5TIMA 1KFCA 2F7FA 1XKYA 3VFLA 3MYPA 2Z6JA 5CG7A 2UV8G 1WAUA 1JCNA 3EWBX 1JCLA 3A21A 5F4SA 3DKJA 1GVSA 4NX0A 1A5SA 4O4WA 3T44A 2JKEA 4Y6GA 3PR2A 2XN0A 4CLMA 2G97A 3O07A 1KLYA 3S1VA 4WXYA 3KHJA 1AW1A 2VEPA 4B5NA 2V5LA 5LNVA 3FFSA 3GAYA 3TJXA 1UUOA 5J5RA 3UWUA 1RVGA 1S3HA 3L0NA 1QO5A 4RK8A 3HG3A 1FCQA 3P84A 1W5QA 5D32A 5DBTA 2F84A 4EVZA 1O94A 4I9AA 3HOJA 2GVGA 5CZSA 1XL9A 3UXDA 3M7WA 5G5IA 5KINA 1G4TA 4MZYA 2HTMA 5D33A 3L0GA 3S5YA 5CSSA 1X7FA 3NR0A 3W74A 1FUYA 5F2GA 3WK3A 3BPWA 4HNVA 1FXPA 3A23A 1KFEA 1PCKA 1LBFA 3NNTA 4M6QA 3ZWTA 5K4ZA 3GAKA 1XC4A 1N55A 3EXTA 3IVSA 2TSYA 3FJ6A 3QQ1A 3ZFHA 3EKZA 1W5NA 3QF0A 4MZ8A 3S42A 4X22A 1NFBA 4K38A 3WJXA 3W6YA 1TV7A 5FF4A 1DOSA 2A6NA 1TPVA 1EUNA 3STFA 2C15A 2ZYFA 1G4PA 4PCFA 3W7PA 4HSOA 1B57A 3PBWA 4XTDA 2ATSA 3QC3A 4Y8FA 3LRKA 1EPXA 5BRBA 5SWUA 2ISVA 3UPWA 5K9DA 2RFGA 5DY3A 5D05A 3LLDA 2BZNA 1LCOA 5K9CA 3VKJA 4IPIA 4MKNA 5CPMA 5AC8A 3VI2A 3TKFA 4X3ZA 1ICSA 2EGZA 5AHEA 3KOFA 3WJZA 4LVBA 4FB7A 3KVJA 3QMRA 2V2CA 3TQKA 3WJWA 3NQ8A 5EMUA 4QIUA 1SQ7A 3DGRA 3S8HA 2W79A 1FWRA 3O63A 3S0CA 3SSJA 5D2WA 4FNRA 2Y89A 3W2LA 4AAJA 2ZA2A 5HR6A 4XKYB 1Q6OA 3NO5A 3M5YA 1X1ZA 4CCEA 3W75A 1EP2A 5DY2A 5AHMA 1GYLA 4JYEA 1ZCOA 1ZJIA 1OFOA 5TQLA 2GVJA 3EX1A 5AHLA 5E1QA 3KAOA 1DORA 4A3UA 1KM0A 2EF9A 3FIGA 3C61A 3HG5A 4O13A 3HG2A 1WOAA 1FWNA 4MLRA 5EKYA 4JR5A 1ZALA 1ZNNA 1QPOA 2ZRZA 3U6WA 2X30A 3LHYA 3S1UA 5CPNA 4FX6M 1UUMA 4ZVJA 4U4MA 3NA8A 3F4WA 3DZ1A 2C1HA 5D30A 2Y7DA 1TPEA 3QH2A 2JKAA 4XBSA 5FEPA 1LBLA 1KTBA 4KKXA 1OX4A 3GDRA 1GEQA 1GG1A 4N6FA 4OWGA 4Z1AA 1IIHA 3M16A 3DU0A 4TIMA 4JDYA 3H55A 5D02A 2BWGA 3P7YA 2ZTJA 3NQ6A 3QSTA 4A2RA 5GVJA 2ATMA 3I7QA 3WK0A 1UCWA 3E12A 3WK1A 4NNAA 2A7NA 5FEXA 2IQTA 4IGHA 3TUUA 5AB3A 2P10A 2V2DA 3W1LA 5HWNA 1SFLA 4LC8A 2O7QA 3BO9A 3W7DA 1MZHA 2JGQA 2PCQA 1E51A 4RJEA 2CU0A 3W2KA 1FDJA 2RHGA 1GVOA 3G0UA 3M43A 3W1MA 2OT1A 3MWAA 1GVFA 5AYZA 1PVNA 1TIMA 3NPWA 1XBVA 3LV6A 3NAVA 5AHNA 1FCUA 2CWNA 1IXQA 3IGUA 3QEZA 3QMTA 1ICPA 1XCFA 4ZQRA 3STCA 2B7OA 1TTQA 1SSGA 2VFDA 3I7SA 1H63A 1VYPX 2R8WA 4N2YA 1LOQA 4IX0A 1YLVA 4R7JA 4AWUA 1GTHA 1W8SA 1BWKA 3MHFA 2QCEA 4MUZA 3W1NA 1LRTA 3PSWA 3QJAA 3W1QA 3C2OA 4MJMA 3T78A 3HGSA 4KFOA 3W1UA 3FYPA 4WZHA 1KM4A 3TMLA 2QEZA 1TRIA 3IIPA 1KA9F 3W07A 1OYAA 3W86A 1J2WA 2YW3A 3STEA 2O7SA 3BW2A 4AVFA 4JGDA 3B04A 3W87A 3DFQA 3O8AA 3MP3A 3E9AA 3TDFA 3MJYA 4AF0B 5DELA 4FNTA 1AL8A 4QM1A 3W83A 4GRSA 1X1OA 1JQXA 4AEOA 1KM2A 1P5BA 2JK2A 3L5AA 3L66A 3EXSA 1IF2A 1DQWA 1WBJA 4O17A 4I7WA 3IIZA 2QUVA 3Q94A 1OHLA 1VLWA 4H6KA 4N9EA 3SJ3A 1W3NA 3N2MA 4TO8A 1RV8A 3G8EA 3W76A 2VEKA 3IV3A 1QMLA 4E2BA 3GZ3A 4FNQA 3BLIA 4JTJA 3L65A 3FS2A 1DVJA 3NZRA 4N6EA 2KZHA 1GJPA 3LBMA 3QZEA 1FY6A 2QCLA 4LRTA 4WJEA 4OV4A 4FIQA 4MYXA 4CCDA 3HB9A 1SO6A 2GQ9A 4HKPA 4O1CA 3O6DA 1V7YA 4K6AA 3TSBA 1DBTA 1AG1O 4JX4A 3UWQA 1BTMA 3STGA 3OHIA 2Q8LA 3W7IA 4N02A 4RV8A 4XWUA 2CLMA 3TSDA 1VC4A 2E09A 2EKCA 4OQVA 3LX9A 3W7MA 5CZ0A 3PBYA 3LCHA 1I2RA 4CNPA 2W6RA 3MI3A 5HJLA 3LTYA 2DZSA 5LNWA 1J5TA 2YW4A 2QCCA 3M5ZA 3G3DA 1WOBA 4DXVA 1K7XA 4EF9A 4MFDA 5MHBA 4IMEA 5K2ZA 1PHQA 5H91A 1GVRA 1Q6LA 3W7EA 3W2MA 5HWMA 2BLEA 4PL2A 1HFBA 3HPXA 5LGZA 5H2ZA 4AF0A 1V5XA 4ICNA 2WV8A 1VS1A 2NLIA 3OG3A 4KWVA 3E49A 4FNPA 4IMFA 2A2IA 2QAFA 2FB2A 2GJLA 3HGJA 3KRUA 4UNLA 3NXFA 4JIPA 3NQEA 3W7GA 3L9CA 4LVGA 5G4EA 5D2YA 3FOKA 5HMSA 1K8YA 3LRLA 1QDSA 5CKSA 5T26A 1VJIA 4TMCA 4I7VA 4ZL1A 1KFJA 1DJQA 1P0KA 4L4LA 5DXYA 1B4KA 1WV2A 2NX3A 3BG9A 3B06A 5FF3A 3WFAA 1G4EA 1SSDA 2J88A 3M44A 4JTGA 4LV9A 3TX9A 4O57A 1P0NA 3DENA 3TXZA 3W3OA 1PV8A 2A21A 3C52A 3TV8A 5C6MA 2CZ5A 4KFPA 4GXMA 3NOEA 4JTFA 4JIQA 1EP1A 2YPIA 1OABA 4PFMA 4O8RA 1MEIA 3C2FA 5E93A 1FWSA 3C56A 4ADSA 1VQTA 3QW4B 1I2OA 4DELA 4K7VA 4MZ1A 4LVFA 2ZFAA 4JTIA 2FDSA 3PY2A 3QW3A 3UZJA 3NDOA 2NUWA 4Q4KA 1OG0A 3WJSA 2YZRA 4ZQCA 5I3KA 3NQCA 3CM4A 2P1FA 5EL1A 1GTEA 3MHUA 2YDAA 4XUGA 3IIXA 4ONVA 2YCEA 3N3MA 3C6CA 4NZJA 1TTJA 3QQ0A 5CGQA 1XXXA 3TFXA 4K8EA 1XDLA 1PS9A 4YMZA 2DU2A 2ZTKA 1NEYA 4O11A 1JR1A 4LS0A 4M6VA 3W2NA 3PUEA 2VFEA 4YCOA 1P1XA 2AGKA 3GK0A 3M6YA 2AAMA 2Y63A 3GKFA 3LI1A 1ICQA 2CLOA 3MBDA 3I7RA 3LBCA 2B7NA 3R12A 1IGSA 2XN2A 1MEHA 3PF3A 4MIMA 3CU2A 3CQ0A 4LS1A 4YXGA 1G69A 2WSQA 2OMAA 4C1LA 3KVLA 1A5BA 3BGGA 2OT0A 3CEPA 5LNRA 1RQEA 2ISWA 3NQ2A 3DFSA 1UASA 2I14A 2FPYA 1LLWA 1QFEA 3FA5A 3G1SA 2CZEA 4MJZA 1T8XA 2NUXA 1SW3A 4LWWA 3ZR4A 3PG9A 1BWLA 4H4IA 4AMAA 2QCDB 2C13A 4O1AA 3VCRA 1VYRA 4NJIA 4YLWA 5LZLA 1H7RA 4BI6A 1TV5A 1YDOA 1TPFA 1MXSA 4N9BA 4NX5A 1P4CA 3NL5A 3W7LA 1SU5A 4IOTA 1EWEA 4NXSA 3T40A 2NX9A 1G7UA 3VNDA 4ZQPA 5I3IA 3LB0A 4O14A 3GR7A 3HJZA 1QPRA 3W70A 3GXTA 1G7VA 2HS6A 4MPQA 1LRNA 2VOMA 2DZWA 4RX0A 1H7OA 3IIVA 5HULA 4DPPA 4Z1CA 4O12A 4NNCA 3RMJA 3O6CA 2Y6ZA 3G1YA 4ZMGA 5KITA 2ZZ7A 1J4EA 3DFNA 4ORMA 1RPXA 1H62A 4GC4A 3W7RA 1GT8A 4UTJA 3CWOX 4IMCA 2GQ8A 4O15A 3TROA 3IRDA 3TH6A 1EIXA 3A22A 3SECA 2NWSA 2WSYA 2QDGA 4Y96A 1W54A 2DP3A 1EP3A 3WK2A 2DZVA 2RDWA 4DBDA 3CHVA 5HR7A 3G0XA 2QJIA 1FCBA 1M6JA 4PA8A 5AFDA 1FCVA 1SZGA 3F03K 1ZHAA 3C8FA 4TX9A 1K3UA 2NX1A 5KZMA 1Q3NA 4AHOA 1SZFA 2Y7FA 1DV7A 4FO4A 4QQ3A 2AQWA 2WQPA 2VELA 1LBMA 2B0MA 1SUXA 3BLFA 1YXYA 4OE7A 3GYEA 1TV8A 3G1XA 3OVPA 3ZWSA 1XI3A 2QKFA 3SW6A 3LV5A 4GBUA 4WD0A 3HGRA 5FF0A 2P0OA 3TW7A 4ADTA 1W31A 1XFBA 1HO4A 5CPOA 1YDNA 2WJZA 3ELFA 1AMKA 1U5JA 3W9ZA 2H3DA 4K37A 4Y9AA 1GQNA 2B7QA 3A24A 4QNEA 4UTTC 1KTCA 4DO5A 1SO4A 3I6RA 4GE8A 2I9EA 3NEVA 4BWLC 3W1AA 4Z1DA 2WNNA 1Q6RA 2A7RA 5I3HA 2GPTA 2Z1BA 3W1XA 1KLZA 1PHWA 3W1PA 5I3JA 2CLLA 2H3BA 1VR6A 3S5ZA 1T99A 3GKAA 1RZMA 4NJJA 1DQXA 1H60A 3W22A 4BI7A 3ABOA 2PRLA 4R33A 3DHDA 5F2MA 2VC6A 2BX7A 2OX1A 1ZAIA 2EAWA 3NPUA 4JTTA 3PBVA 2X1TA 4J9JA 2QCMA 1ME9A 1VCFA 2VEMA 4EF8A 3MI2A 5EBUA 3NPVA 4IXXA 4RZ4A 1I2PA 3M47A 4PL1A 5LHEA 4Z08A 4E0CA 3LI0A 2C18A 3TE9A 5KZEA 2E1DA 5EYWA 5LKYA 4E2DA 2V0TA 2VFHA 5HUOA 3W7JA 3SGZA 5HQEA 1UB3A 2Q8ZA 3QM3A 1KBIA 2H90A 3QFEA 3UZ5A 3TXVA 2PURA 3G1AA 1CX9A 1W37A 1EB3A 2G5WA 4O16A 2VENA 2I1OA 4A22A 4XTIA 3DAQA 1EEPA 2J27A 4UTTA 1JULA 4JS3A 4MOZA 3UY8A 3PS7A 4BWLA 4UR7A 3GB6A 3N2XA 3C2EA 3LXCA 3P61A 3B0VC 1XBZA 3P5YA 5D09A 1JRBA 3E0IA 3FJLA 3LCFA 4QITA 5D04C 3O15A 1X6UA 3GXPA 3MMTA 2B7PA 1H61A 3EEGA 1IXNA 1VHNA 1WQ5A 3UWVA 1N8FA 2XN1A 3OVRA 1BKSA 2A5HA 2QCNA 1K7EA 2C14A 3BK0A 4XKYA 2A0NA 3JS3A 4W9TA 3OBKA 2ZZ6A 3A9IA 1OFPA 1VZWA 3E02A 2CLIA 4JTSA 3P5ZA 4M5PA 2ZRVA 1K7FA 2QF7A 1OK4A 3UWZA 3NQAA 3W7NA 4N9DA 4BR1A 3TAOA 1R30A 3HO8A 1G4SA 2E6DA 2ALDA 3W1RA 4HN4A 4PODA 1H7NA 5FI8A 5LNUA 4Q33A 4PC8A 4RLIA 1KM1A 3SR7A 3LHUA 3F1QA 4NXKA 2Y88A 1TQJA 3LHVA 2YX0A 3VE7A 2BXVA 3LTSA 1F74A 1PE1A 3NQVA 3U8GA 1KM5A 4JYDA 3NQFA 4K39A 1K03A 4RXFA 5F1VA 1H7XA 1Z42A 2G96A 2PRHA 3BG5A 4E38A 3C2RA 2NXIA 4NQ1A 3PWAA 1KBJA 3LHZA 3SZ8A 5I3GA 4U28A 4FXSA 4O4VA 3OEXA 5DCEA 3TK7A 1UJPA 1TTIA 4MY8A 2CLEA 5KTLA 5K4XA 3R89A 4IMGA 4LVAA 2ZRWA 1SFJA 2E5CA 1NVMA 2VFFA 2Z6IA 1WA3A 1HTIA 3R8RA 3B03A 4UFHA 3M9YA 1F05A 1NSJA 3NL3A 1SPQA 4A29A 4UTMA 3W7KA 1R47A 3NL2A 4ADUA 1VCGA 1O60A 4LY8A 3DXIA 4CQ9A 4LT9A 4OV9A 3OA3A 1XDMA 4LV4A 2Y7GA 3B8DA 1F6PA 4JYFA 1S5TA 3RK8A 3PAJA 4IUOA 4YCPA 4MLJA 4WXZA 4K7YA 1OJXA 5HINA 4UTLA 4G1KA 5U7SA 5ABTA 4UCGA 3BG3A 3GLCA 5LNSA 3HG4A 3RLUA 1YYAA 1MO0A 5G4WA 4IXHA 2XFWA 3EB2A 3W2JA 4MVAA 2Z0IA 1XBYA 1VGAA 1F2JA 3MHGA 2Y7EA 2TYSA 4NU7A 2A4AA 1H7PA 3G1FA 2NV2A 2FQIA 3DHFA 3L21A 2NZLA 3MBFA 3W71A 2X1RA 2H8ZA 4OU1A 5LHFA 4GNJA 1TPUA 2LLEA 3JR2A 3PSVA 4K8HA 4CQAA 1LP6A 4QISA 1TQXA 4UFKA 4O54A 1Z41A 5AYXA 4UFIA 1A53A 2YYUA 2PC4A 4ALDA 5KMYA 3S6DA 2DJLA 5FEWA 3HQ1A 2C3ZA 3ZS4A 5C5YA 4LTSA 3LCIA 1MSSA 4UNKA 1SW0A 5HUPA 1A5CA 3TW6A 1PL9A 3CB8A 4IX2A 4IMDA 1WDWA 2OZ0A 2VFIA 3BARA 8TIMA 3O06A 2WKJA 5BNKA 1H51A 2HMCA 4FX8A 4FHAA 2H6RA 3HF3A 3C2VA 3N34A 2ZQ0A 3A5FA 4UTIA 5TBOA 1FBAA 4LW7A 1YTDA 1WX0A 2DZPA 3N9SA 2FLIA 3L68A 3R13A 3CEUA 4RXGA 1YXDA 3T4CA 3HPZA 4ZQOA 3V75A 1G67A 3RU6A 3BGJA 1OFAA 3NVTA 2NXHA 4DPQA 4UIOA 1TJRA 4O19A 3QSRA 3HBLA 1M7PA 2GVLA 3P80A 3UNDA 3CT7A 3MI6A 2EPHA 1T96A 2QCFA 1M5WA 2ABAA 2RH9A 4S2BA 1OYCA 1OF8A 3KXQA 4MYAA 2FPTA 5BMXA 3LOTA 2R94A 1QNVA 5F2LA 1WYIA 4CCCA 5K7JA 1TPB1 1KFBA 4S2CA 3P82A 4WY0F 1AK5A 1FX6A 1FWTA 1L2UA 4P61A 4O10A 2WNZA 2X2GA 2PRMA 3G1DA 1EA0A 3HIJA 4JX6A 2X16A 2YXGA 3TAKA 3M5VA 3CIWA 5G2HA 4POCA 3FYOA 4LUIA 1NF7A 3R2GA 2OCZA 2QR6A 3LCGA 3BVJA 3IEBA 4PH6A 3FLUA 3EX2A 3LHTA 1QR7A 4K36A 2YFOA 2Y85A 1TCDA 4QAIA 2ZDRA 4AWSA 1FXQA 1LRQA 1W5PA 7TIMA 1I4NA 1C8VA 2ZA1A 2Y62A 2YGYA 4I7UA 3O1NA 1YPFA 3T7VA 1VHCA 2VXNA 4DEFA 2FB3A 2VEIA 3AJXA 3LXAA 5FF7A 3PB2A 1ALDA 2WPBA 5FEZA 2QJGA 3NYZA 2ZRXA 5G2IA 4XQ6A 4N9CA 1HG3A 3Q37A 3G18A 1GVQA 4Z0SA 3EWYA 3PG8A 3NGJA 3B0UX 1TMHA 1LLZA 4OGZA 5HNRA 3P60A 3UY7A 3USBA 1O5KA 1SO3A 2WSRA 2YYTA 3INPA 4X9SA 1I8JA 3LLFA 4R53A 2J6XA 3TCEA 1B4EA 5KSWA 2RDUA 3W2UA 1W0MA 2ZZ4A 1LZOA 1RD5A 3CIXA 2Q3RA 4DQWA 1SZEA 2FFCA 3CTLA 3I68A 1GPWA 3QYQA 3QMSA 2JGYA 4FX7A 3C4UA 2CZFA 5D03A 1W5MA 1FQ0A 3HPSA 1LOSA 3LCLA 5CZJA 4LNYA 3DBPA 1ME8A 3DI0A 4KFNA 1KW1A 1TPWA 4FEZA 5I3FA 1TJPA 1VRDA 1VYSX 1LOLA 2D73A 3TQVA 3EWUA 1C9DA 4JNMA 2QUUA 5F2IA 5F4XA 3N9RA 3W88A 5DBUA 1OF6A 2RDTA 3M5XA 2CLKA 1YDVA 4NZFA 3THQA 1OK6A 2V81A 1L6SA 3LDVA 4HSNA 3D0CA 3R5EA 2C6QA 4HNUA 4C1KA 5K3VA 1AW5A 4OT7A 1OFRA 3MUXA 3IGXA 3H53A 1Q45A 3S5NA 4UFMA 3T55A 3S5OA 5L6UA 2NUYA 2ZA3A 5C54A 1OX6A 1OFQA 2GOUA 2NXGA 1UBSA 3EKLA 1XUUA 2X1UA 3GIYA 1L9WA 4DF1A 4AWTA 2NWRA 2VKZG 3GXNA 3MYOA 4UUIA 1OFEA 1LTDA 4O50A 1OX4B 1QPNA 3EX4A 1F5ZA 3CWNA 4CNOA 1F76A 4RR4A 1Y0EA 5KZDA 1LROA 4M7TA 6TIMA 3B05A 4UMCA 5EPDA 4BI5A 3M1ZA 2E5DA 4UTHA 3ATYA 1KM6A 1XUZA 1NAL1 1THFD 3RLVA 1R2TA 3GNNA 2FPVA 1DHPA 2DZTA 3UQNA 4A2SA 2TPSA 1EWDA 3PUOA 4UR8A 3PBUA 3EWXA 1JQVA 2J24A 4NT0A 3NQDA 1ZENA 2QCDA 3NQ7A 1ML1A 2CLFA 2DORA 3LCWA 4N4QA 3L2IA 1L6WA 4R34A 2JBMA 3IVUA 3C0JA 4HIBA 3SFKA 3SI9A 4GJ1A 3P81A 1QOQA 1SR9A 4LOCA 1QWGA 3DH7A 1TTPA 1JCXA 3W7CA 2ZCGA 3G0SA 3M41A 1HO1A 4IQLA 3NQGA 5AN7A 1GWJA 2YFNA 4PTNA 1Z44A 4QNWA 3KFTA 3CLMA 3M0ZA 1EUAA 4KWWA 4BF9A 1JUBA 1DL3A 4GUHA 4H3DA 5CPLA 1H1YA 3H54A 3PM6A 2YSWA 2E6YA 1JRCA 4EWND 5F1UA 3W7OA 1FWWA 2V8ZA 4OBTA 4JN6A 5BMWA 2BSLA 2ZZ5A 1KV8A 1GZGA 1MEWA 3U2OA 2NV1A 3K30A 1IXPA 3P8IA 1IXOA 2GQAA 4WOQA 2A85A 4ZZ9A 2ZZ3A 1TO3A 2ZRYA 5DXXA 3ABSA 4TR9A 1QPQA 3BLEA 4DO6A 4UTWC 2QCHA 1IIGA 1H5YA 4O1BA 4WOZA 5AHFA 5BOOA 2B4GA 4JY9A 5D2TA 4AH7A 1TB3A 4RZ6A 3V1PA 1RQBA 1YADA 3G8RA 1W56A 3GNDA 1S5VA 2A1YA 3NQMA 4WQ6A 1GYNA 2QUTA 1O5XA 5A5WA 4GFSA 4WUIA 1JCMP 2V2HA 4JEQA 4TMBA 4BK9A 1W3IA 2QCGA 3G22A 3HMJG 4LS2A 3UPBA 2G95A 1WXJA 4IJBA 3W23A 4Y90A 5G2WA 2Z2UA 4WX2A 3E96A 4O52A 4BFAA 5FESA 4GUFA 3DI1A 3Q2DA 4QSHA 3Q58A 4WY0B 3GDTA 3W73A 2V5BA 5C2XA 1WBHA 5DCDA 1D3HA 1QO2A 1R2SA 3LGEA 2WOQA 4ZQMA 1SZNA 1F73A 5EY5A 2C19A 1ADOA 4CQ8A 1R46A 4L4MA 3FKKA 3GDKA 3KVKA 4ZQNA 1ZY9A 4HHPA 1SO5A 4M19A 3C3NA 3G1VA 3B0PA 4UTWA 3TSMA 5CZTA 4UTKA 1FDYA 3S1WA 1TYGA 1AL7A 2ZBTA 4QJ1A 2E5BA 4O1DA 1W3TA 1F7BA 4Z0JA 1LM1A
chains in the Genus database with same CATH superfamily
2HSAA 4XZHA 1BF2A 1M53A 4KCWA 4W8LA 3MUY1 3REQB 1XLFA 1VJZA 2P3EA 2XH2A 4NKCA 2C0AA 3PB0A 1VBJA 3GW3A 4GUGA 2VFGA 3UG8A 1OZQA 1ZCCA 5U4NA 3EWZA 4W84A 1TWIA 4UMBA 4LANA 5I5RA 3C3UA 3WUEA 4PRWA 2VWSA 5D2XA 3UWWA 2BP1A 1TREA 4JTHA 3WZ0E 1HIZA 2X0SA 1A47A 4F0KA 4LRSA 1R7AA 1EPVA 3JRKA 4GVIA 2CFFA 1ONRA 1M7OA 1UQZA 2J9YA 2OOGA 2WJEA 3N9KA 2D3LA 5BXPA 3WBAA 3MZ2A 1BXBA 5A3HA 3I10A 5C55A 3N73A 3GUGA 3A5VA 3ZSTA 2OG9A 3HURA 4ORIA 3LCXA 1Z48A 4O28A 3GZAA 1S5WA 4I6KA 4IM4A 4XV0A 1LUCA 1VD6A 4MY9A 1QOPA 3SY5A 1GK8A 2ZZ1A 4WY0A 2V82A 3BCFA 4GBDA 4KQNA 4UR9A 5M17A 3LXBA 4G56A 4B9YA 1BVNP 3WKZA 3LGDA 4JKKA 3KRSA 3BLLA 4O1FA 1I2QA 3WEMA 1RY8A 3TTSA 3W6LA 3CUXA 1Z9AA 1ITQA 3K46A 1YPIA 2WWDA 1D3GA 3O6YX 4GX8A 2X41A 5GJNA 1OFBA 1FWDC 2BOEX 4D6JA 4WSHA 2AL1A 1UWQA 1HKWA 4FXRA 1EDQA 3ANYA 4QE1A 3WH5A 2BBFA 1D7FA 2WNQA 3N11A 3NG3A 4OECA 2DIJA 2WVTA 4UQAA 4AB4A 3DECA 2IPWA 4IISA 3NPXA 3B8SA 3SY8A 1QCWA 2V30A 1DE5A 1JZ4A 4IPJA 4MFEA 4O0ZA 2BHUA 4ML9A 3L67A 3BW4A 2VEFA 3MO4A 4E5TA 1KQZA 1K70A 1O5RA 4OUEA 4EIVA 2HQAA 3EX6A 5CC5A 3C0SA 3KCLA 1VH7A 3RNDA 3GNPA 4M0XA 1AFSA 1JJKA 3NL6A 4Z1BA 1FWJC 5T9BG 2OGYA 4C6JA 4JICA 2EHHA 4CU6A 2QUMA 3S46A 1GQKA 4ZOAA 1ADDA 1HL9A 4QHRA 1QRQA 1NWSA 4NNBA 3VGFA 1XJBA 4H8VA 4L9YA 1VFOA 1KWGA 1JCYA 2PDFA 3VIGA 2E6AA 3AQUA 3RF9A 1OB0A 4H19A 2NSXA 3ATZA 1VEOA 3UCCA 3VCCA 3AMDA 1QXLA 2WMJA 1U33A 2R91A 2PTWA 3P74A 4FAMA 2HS8A 4IFKB 1JNEA 1G6CA 1K6AA 4LU0A 4D8AA 1SGJA 4A8RA 1GG0A 3FKRA 3TC6A 2ACSA 2GJNA 2EEXA 4LAZA 4Q7IA 2XFFA 1TV2A 5AY7A 1CBGA 1L2QA 1FWCC 2XIIA 1GKPA 4N4PA 5FJTA 1T0OA 4NJGA 5CCZA 5F7UA 1RCQA 2VUNA 5DLCA 3SBFA 1HL2A 1BRLB 4OKDA 1O4UA 3R8HA 4YVVA 1XLAA 1JUKA 4K2SA 3V7PA 2Y4SA 4ACZB 2NQZA 3QV6A 4Z2HA 4GXPA 4IG2A 4NL1A 3PC0A 1E40A 5I06A 3S1XA 1XYLA 4LC6A 1SMAA 4DUOA 1KCKA 4HPXA 4LBSA 3TOPA 5TIMA 3ARVA 4HCHA 4ICCX 1ISZA 2Z6JA 4K8GA 3VD4A 4JL2A 1F4HA 2INZA 3SADA 1MMFA 2BMBA 4W5UA 4NX0A 3GXIA 3T44A 2JKEA 1W3KA 4JFSA 4M51A 4Z2IA 4Y6GA 4PMVA 2XN0A 4QGCA 1UROA 4DYJA 4WXYA 3S4TA 1R9ZA 3UWUA 3L0NA 2PF0A 3P84A 3BQ5A 3UA4A 4DXKA 4UOQA 2F84A 1GEHA 3VAVA 1EDTA 2BFGA 2EG7A 5ECUA 1XLEA 3WN6A 4X0NA 3WQFA 3PTDA 3HPFA 3M7WA 1GKQA 4GKTA 5D33A 3N04A 3E38A 1X7FA 3NR0A 5CXPA 1FUYA 3WK3A 3BPWA 3MSYA 2OZ8A 4S3JA 3ZWTA 5K4ZA 3GAKA 3EXTA 3IVSA 2TSYA 3FJ6A 3ZFHA 3OVGA 3LMYA 3LQLA 2XHYA 5A2CA 1NFBA 4K38A 4ZBCA 2F61A 2QPUA 3RPMA 4AWEA 2XWEA 5AVHA 3PFRA 2PDYA 1CGYA 1F07A 1DWHM 3UNTA 1B57A 1EGMA 3PBWA 1YNQA 2ZX9A 5LA0A 5BRBA 5K9DA 2F8QA 4G8TA 4H00A 3VYLA 3OOQA 2BZNA 1LCOA 2VL4A 5K9CA 3TTOA 4JEJA 4MKNA 5AC8A 4FOUA 2XIBA 1JPMA 2QMJA 3KOFA 4QG9A 3R79A 2GDVA 4GIAA 4YIWA 5EMUA 4HZ6A 2BV9A 1ONEA 2W79A 3KBSA 4A8LA 3O63A 3W29A 3H4WA 2GK1B 1O6IA 3S0CA 1Z32X 3SSJA 3KRBA 3MUAA 1RPKA 2BNJA 1Y5VA 1UPMB 1EFZA 4NYYA 3GUWA 3M5YA 1CDGA 1VAHA 1ZCOA 3WF2A 1KNWA 3EX1A 5E1QA 1DORA 3BZGA 3LM3A 5I78A 4A3UA 5E6YA 1IV8A 3VDHA 1WOAA 1FWNA 2PLMA 2VZTA 2NQLA 4MB5A 2WJDA 4JR5A 4TV6A 1ZALA 1ZNNA 4A3YA 2ZRZA 3U6WA 2Y24A 1WP6A 2VURA 3G6MA 4FX6M 3VUSA 3S9IA 1WO2A 1R3VA 3NA8A 4F2TA 5FEPA 1LBLA 3GDRA 1GEQA 3KP1A 1GG1A 4PEEA 1IIHA 3DU0A 1OIFA 1W9PA 2UBPC 3BAKA 3P7YA 5HNTA 3UZWA 3WD2A 3EYPA 2PDNA 5DT5A 2ZXQA 3WK1A 3T0TA 1EZWA 2IQTA 3BAYA 4OTKA 3TUUA 1HXJA 4PUMA 2V2DA 2BB0A 2ZVIA 1B3XA 3ARXA 3IV8A 2ZOXA 2YL9A 1MZHA 2PCQA 3WQVA 4HTBA 5C9ZA 4H04A 1EXPA 3EBVA 4PUEA 2L5HA 4IF2A 1GVOA 1X1NA 3TOYA 1O7AA 2FGLA 3LK6A 4X63A 1X97A 1FCUA 4S3CA 1Z69A 1E6RA 2H9AA 4GZEA 1UQYA 4ZQRA 1XCFA 3W00A 4M8UA 1ODZA 1JL8A 3LPFA 3IUDA 4EACA 3DOPA 1VYPX 3VK5A 5C2CA 2R8WA 1D8WA 4N2YA 1FP9A 3UCQA 2IXVA 2HE5A 1JPHA 3R94A 4GO8A 3VIHA 4J3VA 3SAZA 1W8SA 2BGNE 1VIZA 4I90A 4U10A 1U22A 2DW7A 2W92A 3MHFA 2QCEA 3W1QA 3CYJA 1PKNA 2WBKA 1K6WA 3SO7A 3CH0A 4PUJA 3V0SA 3NQBA 4WZHA 4FLSA 3OZPA 4FLOA 2FMNA 2QEZA 3BL3A 3NVDA 3W07A 3W86A 1NIUA 3STEA 4F0HA 6XIAA 3BW2A 1QVBA 2O9OA 4TTGA 3TJ4A 4ACYA 5HPCA 3EMZA 2REQA 3E9AA 3TDFA 4F0RA 4TUFA 4WF7A 4NZ3A 5HNUA 4FNTA 5C2GA 1AL8A 4QM1A 1WDPA 3V3WA 5M03A 3FDGA 2Z25A 2J7FA 1P5BA 2NW0A 2G3NA 1X39A 3L66A 3EXSA 2YCLB 1RJPA 3MS8A 4B16A 2AKMA 3IANA 3IIZA 3VD7A 4PGLA 3RJXA 4H6KA 3N4EA 3KZSA 4ZSTA 1CGTA 3FVMA 1NOUA 2VEKA 1TR1A 1QMLA 4E2BA 2VX4A 4FNQA 3SRHA 3KLLA 1UUQA 1ITCA 3HZ3A 3FS2A 4KS0A 3A64A 2ZUNA 4JHOA 3W82A 1V3LA 2VP8A 1GJPA 5IHRA 5EGRA 3BMVA 1P0BA 2RJHA 1FY6A 4LRTA 1PWMA 4KGLA 3WF1A 4HCDA 4HK6A 4RW3A 4O1CA 8XIMA 3O6DA 4K6AA 4M80A 3TSBA 1VRXA 1AG1O 1R3WA 1Y5WA 3STGA 3OHIA 3KOYA 3TW9A 2VVNA 4H9VA 4RV8A 4XWUA 2CLMA 3LNPA 2E09A 3K4WA 3WDQA 2VR5A 4F66A 3VOIA 3W26A 5HJLA 4CNSA 3FJ4A 5LNWA 1J5TA 3AWOA 3SN0A 2ZE0A 1RA5A 2YW4A 5FAJA 3T0DA 1UWTA 2QCCA 3L4TA 2FTYA 1M03A 3B97A 4K68A 3NXLA 4KIRA 4DXVA 1K7XA 5K2ZA 1PHQA 5H91A 1GVRA 1XC6A 3W7EA 3W2MA 1F3TA 1MW0A 3LMZA 2GDUA 3C0LA 1S2WA 4AF0A 1V5XA 2W4XA 1V02A 4W8BA 3H4GA 2WV8A 2XIJA 2XJ7A 4BCEA 3E49A 2OPJA 5FACA 4C1NA 2E1WA 2DUZA 3W7GA 4JIPA 3N2TA 5D2YA 3NTYA 5HMSA 3ZVHA 1K8YA 5CKSA 1QDSA 4KMQA 1H49A 1P0KA 2YCKX 4B3ZA 3PJUA 3B06A 3F5LA 4OUIA 4P8UA 3WFAA 2KX9A 1SSDA 1CTNA 4LV9A 1P0NA 3DENA 3NEHA 1A5OC 2HE8A 2G3MA 4GXMA 3NOEA 4JTFA 1OABA 2CETA 3H2OA 4O8RA 1MUWA 4RNIA 1XYAA 4LVFA 4JTIA 2FDSA 5A8QA 5ECVA 1V03A 3H26A 3NQCA 3S2LA 2P1FA 1E4IA 4CVWA 3QXBA 4Z2LA 2YDAA 1XG4A 4PMYA 4QE4A 4GGBA 2ISFA 2YCEA 3N3MA 4YU1A 2CEQA 4NZJA 3MUZ1 5CGQA 3TFXA 1XDLA 3TYCA 2DU2A 3SSZA 2ZUMA 1JR1A 1TA3A 2O9TA 1KBLA 4NZ1A 4JFVA 4YCOA 1OGBA 4E8GA 5CH9A 3NDZA 4XD4A 2OLSA 2Y63A 3IJDA 3I7RA 3LBCA 4NP7A 1EJUC 2XN2A 1MEHA 4Y9PA 1W1YA 3CQ0A 1IT0A 3BLKA 4Q22A 3ZJKA 3WLJA 1V3MA 2OMAA 3KOZA 1A5BA 2ON3A 3BGGA 2FKPA 1NQ6A 3CEPA 5LNRA 4XSMA 1AH3A 3DFSA 3E6EA 4U3AA 5T8GA 4DWSC 4CD5A 4L4OA 4IPPA 1RA0A 5EMKA 2DPEA 2ZWZA 3RM9A 1BWLA 1MQRA 4F48A 4H4IA 4H2HA 3GHRA 3VCRA 4XIMA 4YLWA 1H7RA 2XSBA 4N9BA 2QW5A 4NX5A 4AZGA 4IHCA 2YB4A 4IOTA 3N15A 3GXFA 4IUGA 4ZB5A 3SCSA 3T40A 2NX9A 3PJTA 5DRCA 2Z29A 4M29A 5I3IA 4GI4A 1D2KA 4O14A 3GR7A 3GXTA 1G7VA 1XLIA 2HS6A 4MPQA 3WBXA 3N6QA 4B5SA 1XV8A 3NURA 3ARSA 5DMLA 4Z1CA 1XYZA 2Y6ZA 1W9UA 4ML4A 5KITA 4ORMA 3QC0A 1H62A 3OLEA 3GR4A 3VABA 3W7RA 1I1XA 3B9AA 5BWFA 2PDWA 3CWOX 4BF5A 4DLMA 2XZ7A 4RPPA 4Q4OA 2QDGA 1W54A 3GIQA 2J8FA 3WK2A 5DMYA 1BG4A 1E70M 3S2NA 2ICSA 1M6JA 4NI3A 1K3UA 3VCNA 5GNYA 5A6TC 1JFHA 1RD6A 2WVSA 3WD3A 2YBVA 2B0MA 1YMYA 2EO7A 2VZOA 3GYEA 3JU2A 3LV5A 4DXXA 1X96A 1F4AA 1CGWA 3WQWA 2C7FA 1I75A 4GBUA 4XZWA 4YYCA 3HGRA 3TW7A 2YLLA 2RGLA 1HO4A 3ELFA 4H8NA 2INEA 3HJEA 4FLRA 2H3DA 3OODA 4JTQA 3AMCA 4UTTC 4DO5A 4XZMX 3M0HA 4MNMA 5CBBA 2D0FA 4LPCA 3W1XA 4FR6A 1DWAM 1VR6A 2HVOA 1T99A 4TX6A 3MT1A 4BI7A 2IKJA 3BMWA 2BX7A 2X1TA 5H8PA 2QCMA 2DVUA 3KBMA 1G0CA 4DZHA 3BJSA 4ZXLA 3EDKA 5MF5A 2CERA 5HNNA 3OTRA 2C18A 2Q71A 3TA9A 5KZEA 2E1DA 5EYWA 3AIQA 2V0TA 1SJBA 5HQEA 2Q8ZA 1KBIA 2H90A 3TLLA 1EB3A 1VBUA 2I1OA 2IQDA 4A22A 5XIAA 4XTIA 4R3UA 4QDWA 5DQPA 2AMXA 3GB6A 3LXCA 3P61A 4OJYA 5BXSA 2MNRA 5A1AA 5D09A 1EJ7L 5D04C 4REQA 4F9DA 3CUFA 1QI0A 4YHEA 1E0XA 2VRKA 1BKSA 2ALRA 1E73M 2A5HA 5A94A 4XKYA 3CJPA 3A9IA 9XIAA 2ZRVA 4MKSA 4BR1A 3CH9A 3HO8A 1G4SA 2E6DA 2ALDA 1HL8A 1A0CA 2VC7A 3WQOA 3R8GA 2PWEA 5A95A 2OU4A 4ZB2A 4LYPA 2DGAA 2WMFA 3CO4A 3UERA 4H9TA 5CBJA 3WDRA 3U48A 4B90A 2HISA 2YX0A 4GIEA 3SUTA 5KZ6A 3LTSA 4FZIA 2OOFA 3LA4A 3LPGA 1B5TA 3F2BA 2KAUC 3U8GA 4K39A 3IAPA 3VMOA 2OLHA 3EDFA 2CKRA 4XZIA 2I57A 4NQ1A 3PWAA 3E5BA 5EBAA 1XIBA 3OEXA 4MKVA 1NELA 2BOGX 4MY8A 2CLEA 2QVNA 1JAEA 4GYFA 1PTDA 4AD0A 5K4XA 3RPTA 3WNPA 4LVAA 1NVMA 1XQKA 1ZLPA 2VFFA 3C8NA 4JTRA 4Q8QA 4KEMA 1F05A 1V6YA 1XSKA 1VCGA 1O60A 1T40A 3TN3A 3F5JA 3VNMA 4CQ9A 4U5IA 3OA3A 4LV4A 2Y7GA 2DFAA 3B8DA 1N2VA 4MLJA 1OJXA 5HINA 2O0TA 5U7SA 4G1KA 3GFXA 4JHZA 4UCGA 2DIEA 1UD5A 3WY1A 5LNSA 3H7RA 3LNMA 3FGCA 4MVAA 1B1YA 4IIDA 2PFHA 2YJQA 1H7PA 2GJRA 2FQIA 1TX0A 1UW9A 4EX4A 4I9TA 2X1RA 2H8ZA 2I56A 1QJWA 4S38A 4X0VA 1X6NA 4GNJA 3JR2A 3VX0A 1UD8A 2ZXDA 1QU4A 4KWOA 4CQAA 2PF8A 1TQXA 1E9LA 2G37A 2CLPA 2Z26A 4WR3A 3MKVA 4U2YA 1TUFA 3GBEA 3UYIA 4ALDA 3EPNA 5I02A 2MUCA 4W4QA 3RR1A 2BASA 2P8CA 5JIPA 2HJPA 2C3ZA 2G3FA 3VNZA 4Q8OA 2D24A 2IPGA 3S83A 1ZTVA 3CAWA 3TW6A 2OR2A 4CN4A 2OZ0A 2ZX6A 5LIUX 3C2VA 2ZQ0A 3A5FA 3W28A 3N4FA 4IMAA 2A3CA 1S3TC 5TBOA 1FBAA 1YTDA 1YIXA 3N9SA 2FLIA 3B0XA 5HMDA 3L68A 3UA3A 3R13A 3R43A 3CEUA 4RXGA 3HPZA 4PBEA 3LSCA 1G67A 3NVTA 2NXHA 3AI0A 4PZVA 1A0DA 1IWBA 3QSRA 4D6HA 2GVLA 1TJ2A 3RCYA 3CT7A 3UNDA 3WDJA 1QPKA 2WVVB 1NFPA 4Y9OA 4WJ8A 1S2UA 4Q8NA 3HV8A 1OF8A 2R1LA 3KXQA 5EMMA 1XLJA 2GGIA 4DJFA 5F2LA 1WYIA 3LS9A 4AD3A 1TPB1 2Z7GA 4ROPA 3UR5A 1B3VA 4O10A 4HPGA 1QNSA 4C7FA 1BXCA 1KXTA 3HIJA 5C9UA 2X16A 3M0VA 5JBEA 1V0NA 3CIWA 3H8AA 5KETA 3EA3A 3JVAA 1QHPA 3FYOA 3S2JA 4AZ7A 3LCGA 1KKRA 1KXHA 1XRFA 4LH8A 4PH6A 3EX2A 4Y9MA 3FXGA 1FHVA 2J7GA 4AG0A 1RK5A 4NAEB 4LAMA 3LY0A 1FXQA 3G77A 1UH4A 7TIMA 1XISA 3VILA 2EG8A 1H3GA 4I7UA 3O1NA 2Y5SA 1FP8A 5M1TA 3AJXA 3CQIA 3XISA 1UZ1A 1ZJHA 4J3XA 2JIEA 4JCLA 3Q37A 4QJ4B 1KO0A 3QTPA 3UT0A 3NGJA 2JQXA 1TMHA 1LLZA 1DHKA 4YYFA 5HNRA 3USBA 3WLMA 4B92A 2R9RA 2I5IA 4LAKA 4X9SA 2XIOA 4EXAA 4ZFCA 1DJHA 2PLCA 3GSMA 2F9RA 2O9RA 3DCPA 4Q4QA 1AQMA 3B9NA 3U3HA 3QZ6A 5FJPA 1FRBA 3CTLA 1GPWA 3SCVA 3CL6A 1P7TA 1GHRA 3UWEA 1W5MA 2PZ0A 2ZADA 3HPSA 5AZ1A 1E15A 4Q4SA 3DBPA 1KW1A 3W38A 4FEZA 1VYSX 4GC3A 4GNKB 1HZYA 2UWFA 1C9WA 3EWUA 4BJHA 4L6OA 4GI6A 4CGTA 3GFYA 2SFPA 3Q65A 1YDVA 4E8CA 2V81A 1L6SA 3LDVA 4HSNA 2C6QA 4OT7A 4G7FA 1Q2SA 3H53A 1QT1A 4UFMA 4O1EA 2GJPA 4H6RA 2X1UA 1L9WA 1ZBVA 3DYPA 1KKOA 4DF1A 4L7ZA 4MB4A 3MYOA 1OFEA 4O50A 2CC0A 3CWNA 2VDGA 3BCDA 4CNOA 4KGJA 1DJYA 3V18A 1UPPA 3M1ZA 4EXQA 2Y0FA 5LIKX 1UR2A 1ITUA 1KM6A 1KBKA 3Q4DA 1M7JA 2Y1HA 3GNNA 2DZTA 3UQNA 2P8BA 2TPSA 1EWDA 1ZJAA 3ZVIA 1KCXA 3EWXA 1EIBA 3NQDA 2VGIA 4HMEA 2QCDA 4LB3A 2CZVA 1GOMA 4J4KA 3FSTA 3F2DA 4M1BA 4HA1A 1ML1A 3MTWA 3L2IA 4N4QA 4I5RA 4R34A 4PRTA 3C0JA 2PMQA 3GVRA 1E0TA 3BICA 1E0VA 3AMGA 1W3JA 2EPMX 2OQLA 1GJWA 4CCZA 3P14A 3AMKA 5HBFA 2PDMA 1R3RA 3G0SA 4TVDA 3NZPA 5TAOA 3VM5A 4FXFA 4KWWA 4EPEC 4H3DA 1H1YA 2YSWA 4PN2A 2I17A 2E6YA 4BZYA 5F1UA 4CU8A 3BH4A 4KBXA 2W67A 4JTCA 3VOGA 4KW2A 2NV1A 1IXPA 4J1OA 3LPOA 4RUBA 5HXMA 1S5MA 1GQIA 4P8XA 1TCMA 4UTWC 1O66A 3ZXWA 3OHMB 1PAMA 2PDJA 4O1BA 5AHFA 5BOOA 5GNZA 4JY9A 3WH6A 1TB3A 4X61A 3CS2A 1F8MA 4RDVA 5JIWA 1YADA 4HGXA 4FXJA 3GNDA 4G9PA 1GYNA 1BSLA 1TUXA 4YJ5A 3GE7A 5A5WA 3TN4A 3O7UA 4WUIA 3RHGA 6ENLA 4YTUA 3G22A 3KTCA 2WCGA 3CQJA 3U5YA 2X1IA 1OC7A 2REQB 4IJBA 2D69A 4MSSA 2DZBA 3QBUA 5CEWA 1FWFC 5FESA 3ARWA 2GGHA 4BQ5A 1UP2A 1Y7VA 1E4MM 4QDMA 3GDTA 3SURA 4ERIA 2YDQA 2GL5A 1J79A 3GTIA 4AD4A 3WQ4A 1SZNA 3WD4A 3VGBA 8A3HA 2CIPA 2C19A 1ADOA 3KDOA 1MDLA 3GDKA 3BGAA 4HHPA 4OBSA 3KDNA 2OEJA 3CZKA 2DVXA 3UVIA 3QPEA 3IJQA 1HGWA 3GFZA 4DN1A 2PI6A 1HVQA 4MWAA 3S1WA 5IRPA 1AL7A 5CQ1A 2O56A 2J4GA 3H7UA 1PYFA 1S39A 2EG6A 5E0CA 4Z0JA 4GVHA 3RM8A 4F8XA 1KTNA 1UR4A 2DW6A 2VOTA 1R0MA 7ODCA 4JQ4A 5D38A 3E2QA 4JQ2A 3DFOA 3WQDA 1AJZA 1HJVA 1CEOA 4JXCA 1RCXB 2DJXA 1I6NA 2DT3A 1YTEA 5CC3A 2XDFA 1WE5A 3GDMA 4XBKA 1XLLA 3KX6A 2QIWA 3P62A 4JD4A 4LALA 2ZX8A 1XIGA 1W5OA 2NQJA 2PP1A 1TMQA 1I45A 2ANUA 3BAJA 3ZSSA 3GTHA 2WC3A 3W84A 4LNCA 3E1F1 3YPIA 1KFLA 4EAMA 4G7EA 4OOUA 5H1WA 3PTQA 1NF0A 5REQA 4JAWA 4E4PA 1R2RA 4LYKA 2BTMA 4LUSB 4C1NB 2XINA 4JTLA 1PIGA 4HJFA 5HWJA 4AW7A 1ZAJA 1GKRA 3JZUA 4JTKA 2ZRUA 1XGDA 4KERA 3MV01 4TVUA 2QNEA 5G1TA 4LEQA 1UP0A 1ENUA 3W85A 1EQCA 3T6CA 5JQ9A 1CW2A 5IBXA 1T7LA 5EFFA 1S1RA 1VCVA 3MO7A 4S3EA 3GDLA 3GHSA 3A3WA 2V3DA 3ABRA 4FIRA 4GWEA 2PPGA 5GPRA 3S2MA 4Q8VA 1XLKA 1X8FA 1OFDA 3P93A 3ARRA 4MNKA 1UD6A 4MY1A 3S9YA 4A21A 1GOXA 3REQA 2QMKA 4BKNA 4YWIA 1PIIA 4O0KA 4FK9A 4DJFC 1BTCA 2OQHA 4MNLA 4C6MA 2RKXA 2X7VA 3EA1A 3PNUA 4HNTA 5L9FA 3TNOA 4RCXA 2Q09A 2V9DA 4UMAA 3N4AA 3AHXA 1BXNA 1H1ZA 4HJWA 1KWKA 1ZB5A 3DKLA 2ABBA 1TA3B 4XBJA 8CGTA 4C6OA 1F9CA 4MM1A 2JF6A 4XK2A 3FA3A 4JIEA 4V2XA 3ORWA 3CUZA 5FF2A 4B15A 4GLEA 5HQMA 3TIMA 2YDSA 1LDCA 5AKQA 1JCJA 3AS1A 4KRTA 4DO7A 4UFLA 5I77A 4UXDA 4PTWA 3UFYA 1OM0A 4YPJA 4O18A 4G1NA 4QCFA 4C90A 3PAOA 4BEUA 4WDXA 3CZLA 1DJXA 2FJKA 3PUDA 2DV0A 4FF7A 3LERA 4DWSD 4WSKA 3P67A 3M0LA 4AHPA 1OYBA 1XYCA 3N19B 1I2NA 4QX4A 1RXOB 4WHBA 5F4WA 2V67A 4GZ7A 4D2JA 3MVIA 3GC5A 3G3MA 3L4ZA 3KW3A 1B9BA 4KRZA 4XG1A 3W7QA 3AO0A 4EOUA 1NOWA 1P0DA 1TX2A 3BJTA 3VOJA 2BHYA 1EC8A 2QGYA 3G24A 3CLWA 4G6CA 1W1A1 4S1FA 5D4YA 4JDBA 4IWWA 1JZ3A 3UWYA 4DJDC 2PDKA 1TRDA 3V1HA 1C29A 3UYCA 2WO5A 3IACA 1EDGA 1XIDA 1XGZA 1IQ8A 3N17A 3P8JA 4NHVA 1J10A 1CZ1A 1Q5MA 4E8DA 4UFJA 5AC5A 3FYYA 4GO9A 2J9ZA 1AQ0A 1EYEA 2J75A 1J12A 1JEZA 2X7WA 1S2TA 2DZXA 3M07A 1XM3A 1Q7MA 2A7PA 3BAXA 3TMQA 4Z42C 1KRCC 5D9MA 3H22A 2QVHA 1QNPA 3WNMA 3LTPA 3RFAA 2JE8A 1WPCA 2VC9A 3QQWA 3TA6A 1UD3A 4GI8A 5K9XA 3MZNA 3FEMA 5BXRA 4W7WA 1F3EA 4NJKA 4XZBA 2XIMA 4AY8A 3L5LA 1AW2A 4GUIA 1KFCA 2F7FA 1XKYA 3OBAA 5JBDA 4LYRA 1XLMA 1WB0A 2YZ5A 3SCOA 3A21A 1GGOA 1GVSA 3DERA 3MCMA 3VDAA 3N6HA 4H01A 3UR8A 4O4WA 4IH3A 4CLMA 4PYSA 1UBPC 2G97A 3O07A 3SCNA 2VEPA 3FFSA 2XVNA 4J3TA 1A5NC 1RVGA 1QO5A 3R0UA 3CMJA 2OO6A 4XKMA 2FVLA 5CZSA 2GSEA 2VR2A 3IK4A 1UOKA 5G5IA 1A5LC 3RAOA 4MZYA 2O9PA 2HRWA 3FK4A 5F2GA 2HNEA 4HNVA 1FXPA 3A23A 5H8MA 3DC8A 3ITLA 4RE4A 4PTMA 3E0VA 1LWHA 4KEUA 1NP0A 2WXDM 3KL5A 2R1MA 2F2KA 3EKZA 3QF0A 2C71A 3QY7A 1H11A 2GWGA 3RLHA 2WSKA 3S42A 4X22A 3W6YA 5FF4A 2A6NA 1YNYA 2FZDA 1EUNA 1I0BA 1LT8A 2ZYFA 3CYVA 2VGFA 3BAWA 3PPHA 4KH2A 4HSOA 1X8CA 1U5HA 1U5VA 1WKDA 1MRAA 2EXOA 2ATSA 4ACZA 4GYJA 3IRSA 5SWUA 2QULA 1MFVA 1O1HA 5D05A 3NYDA 7XIMA 5CPMA 2UY2A 3VI2A 3TKFA 1C92A 4X3ZA 4DBUA 5BYWA 1RBOB 3TN6A 4LVBA 1M9HA 3QMRA 3H70A 3GG1A 4NRRA 5A8MA 2PLJA 4ATDA 2ZUSA 2Z2AA 1EGVA 1NQKA 4HYRA 4QP0A 2WHJA 3TTEA 4H6QA 1XIIA 4GG9A 1RJQA 4AAJA 4XKYB 2WKGA 3CV7A 4F4RA 1YE6A 3NO5A 1EQPA 2G4FA 5DY2A 5FJIA 3CUHA 2JFEX 1I1WA 1ZJIA 3LU2A 1MW1A 5AHLA 2OEKA 1MNZA 1J6PA 5FOOA 1KM0A 2EF9A 3GU1A 3C61A 3HG5A 1M1BA 4XD6A 1OWQA 3HG2A 1XIEA 5EKYA 5KEZA 1PEZA 4GIYA 2BVTA 1ZP4A 1WXZA 1S38A 1Q4WA 5CPNA 4TTUA 2XFYA 4W88A 4ZVJA 3WL0A 4D6IA 3EOSA 1IEQA 3GVQA 4DLFA 4XBSA 1PUDA 2WZIA 5I03A 1O68A 4N6FA 4Z1AA 9XIMA 3M16A 3DYMA 1EJRC 4IPLA 3H55A 1W9VA 4F2BA 5BWAA 5FA5A 3NQ6A 1EHAA 1SFTA 3V5FA 2V5JA 2ATMA 4MGGA 2WQDA 3CT2A 3WD1A 2A7NA 3FHQA 4S3FA 4LB4A 2ONEA 5HWNA 1SFLA 4LC8A 2XPKA 4ZOBA 4AUBA 3KZPA 2UY4A 4V33A 2JGQA 4RJEA 2GK1A 1FDJA 1M01A 1Q8JA 3W1MA 3JUGA 3ZIZA 1GVFA 2MANA 1MZRA 1PXGA 4BQ2A 1TIMA 2WYSA 1V6TA 4H9YA 5AHNA 1UKSA 4N42A 1EO7A 1ICPA 2ZX7A 2B7OA 4US5A 4H9XA 2ISDA 2OX4A 1QI5A 3CB3A 4IX0A 3RXZA 1PKYA 4R7JA 4AWUA 1GTHA 4AZHA 2C91A 2E8ZA 4MUZA 3SY1A 1R6WA 3W81A 3CZJA 3E2VA 4ATWA 1IWAA 3T78A 2E28A 2IKGA 4KFOA 1BSIA 1NDZA 3UJ2A 3KP0A 2FZBA 1KM4A 5CJ5A 1R3SA 1E4LA 1ZPTA 3AYVA 3IIPA 4ROQA 1LJYA 3VNIA 5CAHA 1OYAA 5DT7A 1GVIA 2YIHA 4AVFA 4HPHA 3F4CA 3W87A 1XPYA 1RY0A 1S2AA 3BWWA 3O8AA 4YWSA 4MTVA 2O92A 1VEMA 3MJYA 1W32A 3CZGA 2FZNA 3SCUA 5D8ZA 1WDSA 3B9OA 3W83A 4GRSA 3EDDA 1X1OA 3U7VA 1JQXA 5TF0A 4L80A 2P0IA 1KM2A 3SN1A 1DQWA 1WBJA 4O17A 3WQCA 4I7WA 3Q94A 1VLWA 3R7MA 1V51A 1W3NA 1XIJA 3RMEA 5FSEC 1FKWA 4QG8A 2R82A 4QLLA 1ISWA 3PK7A 3R4IA 1DVJA 4HD5A 4N6EA 3KUMA 6A3HA 2KZHA 4LF1A 2QJNA 2VYOA 4H9ZA 3BLPX 3LBMA 4GH1A 2I16A 3QZEA 2QPXA 2QCLA 4R9OA 4FIQA 3AU2A 3VIOA 3HB9A 3NZGA 6CGTA 2WZMA 4UQCA 2ZICA 3N13A 1ODUA 4AIUA 2HZGA 3TVAA 4ZODA 3TSDA 2OLAA 2G3JA 2EKCA 4OQVA 3PZGA 5CZ0A 3HFYA 2W6RA 3GO2A 4B4HA 4P7RA 3WDHA 2GLKA 4RDWA 1XS2A 4UZUA 3WL1A 3R25A 1FA2A 3G3DA 1K4HA 4EF9A 4QS5A 5MHBA 4IMEA 5HWMA 1JNDA 4MHBA 1W9XA 4AZ6A 2BLEA 1G5AA 2CBIA 3GM8A 3W25A 1QNRA 4IP5A 1VF8A 1ELSA 1QNOA 4KWVA 2PWGA 2GJLA 3KRUA 4CQCA 1QASA 3QV7A 3L9CA 3PBMA 3AYSA 5E5CA 4TMCA 1VJIA 4I7VA 2PDXA 2NX3A 2G8ZA 1G4EA 2NLYA 5C7VA 1VBRA 3QGVA 3RO6A 3M44A 4O57A 1FH9A 1PV8A 2A21A 2CZ5A 1X98A 1WDQA 5G1MA 3ID7A 1F3WA 3SQMA 1POJA 1EA9C 4S39A 2WC7A 4DJEC 4L9XA 3CBWA 4V15A 3F2CA 4DZIA 4H9MA 2ZC1A 3SFWA 4MZ1A 1UWSA 3SN4A 2ZFAA 3PY2A 3UZJA 3NDOA 4Q4KA 1BPLB 1OG0A 2PGWA 1UMLA 3PTMA 4ZQCA 4AIBA 4E4UA 4HNCA 1TG7A 2VZSA 1JAKA 1N8IA 3WD0A 3M0IA 3IIXA 1BD0A 1J0KA 1J8VA 3UR2A 2V5DA 1WDDA 4HNLA 1XXXA 4PR4A 4K8EA 3S9ZA 3M0JA 4DWSB 1NEYA 1TKKA 2WWCA 2A79A 3WH7A 1GOQA 1JZ2A 4CEUC 3GKFA 2CLOA 3PZNA 4C7DA 2HDJA 1JZ8A 3BOLA 4XUYA 4YXGA 2QT3A 1DE6A 2OT0A 3FCPA 1RQEA 1XIFA 2FPYA 1PX4A 1KCZA 1QFEA 3G1SA 4LQ1A 2CZEA 3H2FA 4MJZA 3ALGA 4LWWA 4Q6XA 3PG9A 5DRIA 3AZSA 1Y5XA 4AMAA 2QCDB 1VYRA 2BY0A 4BI6A 1TV5A 2GUYA 4DNMA 1TPFA 3BMXA 1B90A 1PX3A 3W7LA 3ENLA 4QFUA 2YXXA 1A4LA 4NXSA 3O6AA 3W70A 3I3BA 2XWDA 1R7OA 3N12A 5TD4A 2FZ9A 2POZA 2VRQA 4ZMGA 4FOKA 1RPXA 3I4EA 5C71A 4AIOA 2ZKMX 1GT8A 3OIHA 4IFOA 2JIWA 1VP5A 1XCXA 3HU7A 4CN6A 4E4FA 1TFVA 2EJ1A 4MMWA 3A22A 3SECA 3CUIA 3SCQA 1PDYA 1EP3A 2GVEA 2GQ3A 1F6YA 2CHNA 4DBDA 1KFWA 4QE5A 1R87A 3T2PA 3ALFA 1SR0A 3G0XA 3VKKA 5CC7A 4HB7A 2QJIA 3IWPA 3PZTA 1YRRA 5AFDA 2OZ3A 1Z89A 4C6LA 4C6KA 4AHOA 4XX6A 1W91A 4FO4A 4QQ3A 4Q4PA 4GCXA 4FF5A 1LBMA 1XF0A 2PDPA 1YXYA 4AMCA 4OE7A 4AEEA 1TV8A 1ZBCA 1XI3A 3LBOA 4LAOA 2UY5A 3OLIA 2NT0A 1XH2A 4JQ1A 2XH7A 4D6DA 3WNKA 1WUFA 1T6MA 4U33A 1Q6DA 3SJNA 3TYDA 1W31A 5CPOA 2FGBA 1AMKA 2OEMA 3W9ZA 2FJUB 4K37A 4Y9AA 3FSUA 1BQGA 2B7QA 2D1ZA 4QNEA 2G50A 4INFA 3BTNA 3RJYA 2VR4A 4GE8A 2I9EA 4BWLC 3W1AA 2OWWA 1YQ2A 2OYKA 1Q6RA 4IIGA 4L9ZA 5LXEA 4GYKA 4PTXA 5CC6A 4HTYA 2F2HA 4MWAB 5A6BD 1KLZA 2OELA 1OSEA 5A2BA 5I3JA 2CLLA 4N7QA 3S5ZA 3GKAA 3GDBA 2E9LA 3AXIA 3W22A 4HK7A 3NPUA 4JTTA 4KRUA 5FSDC 2VEMA 1RK6A 5EBUA 4I3GA 4PL1A 5LHEA 4Z08A 4E0CA 3CK5A 3QVQA 3TE9A 4W8AA 2D3NA 5LKYA 2VFHA 5HUOA 3W7JA 3VIFA 5A6AA 3BURA 2VRJA 2PURA 4UQ9A 3ZZ1A 1XRTA 2G5WA 2VENA 3IPWA 4WSJA 3PHAA 6REQB 3WMSA 4DZAA 3ZT7A 3DAQA 1NFGA 2J27A 4IQDA 3R10A 1JULA 2HWGA 3PS7A 3C2EA 1IZKA 1REQB 2F38A 1XBZA 2PODA 3WUBA 3URBA 2YLAA 1VFSA 2IKHA 4QEEA 2PU1A 2B7PA 1H61A 4P7NA 3CHFA 3FJNA 1ZBKA 4GACA 4NG3A 1IWPA 3AHYA 2FVMA 3NSNA 3QKEA 4ZB0A 3ABXA 4DWDA 3I6TA 4W9TA 4J3UA 2ASHA 3NZQA 1OFPA 1VZWA 1HP5A 3OBKA 3P5ZA 1OCQA 1RBLA 1K7FA 2QF7A 1OK4A 3UWZA 3W7NA 1R30A 3NGFA 1IHIA 3ARZA 1E9ZB 4Y2WA 3IS4A 1H7NA 5FI8A 3FXYA 4Q33A 4RLIA 3SR7A 3WQPA 2VT0A 4NXKA 4DNHA 1TQJA 3LHVA 2BXVA 3TYUA 3NJ3A 3NQVA 3QY8A 3VA8A 1KM5A 4JYDA 1CGXA 1K03A 4E38A 1UWIA 3DG3A 4DJFD 5A69A 5A6MA 4IIHA 4H41A 1KBJA 1O1ZA 2YA0A 3GH5A 3SZ8A 4U28A 3QZAA 4FXSA 1JD9A 1V08A 1XLDA 3TK7A 1EJSC 3WF3A 4J5NA 1UJPA 4DUXA 5KTLA 4IMGA 4R9XA 3H23A 4MB1A 1E56A 2E5CA 1W2VA 2EPNA 5I2UA 1IE7C 2QQ6A 1HTIA 1ZSXA 2PDIA 3M9YA 1NSJA 4XAZA 5C0QA 4A29A 3KBJA 4UTMA 1YDYA 3RPDA 5T91A 1K9TA 3ZLGA 1U1HA 2FH6A 4YTTA 5CZKA 3EA2A 1F6PA 2Z1KA 3RK8A 2PTZA 1QK0A 1TJ1A 3PAJA 2GJXB 4P7QA 2QF8A 4WXZA 5CJMA 2E25A 3EDEA 1XD1A 4UTLA 5ABTA 1A49A 4F3HA 3HG4A 3AROA 1MO0A 5G4WA 4IXHA 3W2JA 5IXEA 2Y7EA 4DYEA 4NU7A 2A4AA 4D8LA 1HKJA 3L21A 1QW7A 5CLTA 3W71A 3K8MA 1VFMA 3RILA 1F8IA 3HV9A 2ZXBA 2EPLX 1TPUA 2LLEA 1ISYA 5TNVA 2G4JA 4K8HA 2VCAA 3D5HA 4QISA 4UFKA 3U0HA 4WGHA 1Q66A 5CG0A 4CD4A 5HAOA 1Q65A 2PC4A 4MDOA 4XO6A 4AVOA 1AUSL 4B2DD 3OPSA 4D71A 1XLGA 5GQBA 1MXDA 5FEWA 4DJDD 1HJXA 4HA4A 3ZS4A 1CECA 3A4AA 1W1IE 1NWRA 3VTRA 3P6LA 3NIYA 3UEQA 1A5CA 1PL9A 3CB8A 3D3FA 4MJ2A 4BEQA 4NY2A 5FCZA 2VFIA 5FJRA 2QZRA 1PYMA 2WKJA 1H51A 4FX8A 4IQJA 3QKZA 2H6RA 4L61A 4PUKA 2J7CA 1WX0A 1HQTA 2WNWA 3T4CA 1YXDA 4XAYA 3V75A 2AQOA 3PZMA 1AA1B 3MWCA 1UZDA 4Q4RA 1XLHA 4DPQA 4UIOA 1U30A 4Z2KA 1J93A 3HBLA 3P80A 4ZO7A 2NQHA 1T96A 1M5WA 2ABAA 2RH9A 4S2BA 1L6GA 4MYAA 2PCEA 5BMXA 3WLTA 3V0UA 3AHZA 1NDWA 4P5UA 4S2CA 3P82A 5LXXA 1BYAA 2NQ5A 1AK5A 1FX6A 1IEXA 4P61A 4L1GA 2AL2B 4JCMA 1EA0A 4B5VA 3OB8A 1KRBC 1MXGA 3C5QA 1E6ZA 5G2HA 4GQRA 4POCA 1NF7A 1EF3A 2PBGA 3R2GA 2QR6A 4S3KA 4QLJA 1UZ4A 3IEBA 3J7HA 4Y9NA 3FLUA 4K36A 4NF7A 1V93A 2E67A 4MJ4A 2PU0A 4QAIA 2ZDRA 4AWSA 3AXMA 1W17A 1YPFA 2WK2A 4DEFA 5XIMA 2WB5A 3BSGA 3A4JA 3BC9A 4XAPA 5FF7A 2P3ZA 2WPBA 3GTXA 3IJ9A 5FEZA 1UG6A 3NYZA 3PUGA 3MVTA 1JDAA 3EWYA 1M68A 1VEPA 3PG8A 2WMKA 1AQHA 4OGZA 4AC7C 4Z2JA 2J25A 1SO3A 2IS7A 3INPA 1OIMA 2QJMA 4R53A 4WDWA 3TCEA 3QHMA 2Y2WA 1B4EA 2V6AA 2WVVA 4XISA 4AVNA 1IGWA 1UH3A 5LA2A 3KCOA 1SZEA 4U3CA 1W3LA 2HPIA 3T0CA 3QMSA 1GYMA 2JGYA 1IEIA 3C4UA 3OZMA 4CKQA 2CZFA 4CNTA 1OT2A 3QGAC 3KBNA 1FQ0A 1LOSA 3KEHA 3DI0A 1SJDA 5DF0A 1W1B1 1TPWA 4WRHA 3M4HA 1TJPA 1VRDA 3CO8A 4QQUA 3TQVA 3GBDA 2ZUUA 3UG3A 3N6JA 1C9DA 1C7SA 3SRDA 5F4XA 3N9RA 2VD8A 3G1RA 4GJIA 1OF6A 4DUWA 2EKGA 1R3QA 3M5XA 4WGXA 5BXTA 1OADA 1MRQA 4L56A 2D2JA 4HNUA 4C1KA 3CL7A 5K3VA 2A3LA 4NAEA 1PZ1A 2WZTA 3AUJA 3MUXA 2FVKA 3S5NA 4F0SA 1MUCA 3AALA 1Z3NA 5C54A 1OX6A 4QR6A 3UESA 2NXGA 1UBSA 2Z1WA 1X6LA 4R88A 5C7HA 4AWTA 4JIRA 2VKZG 4UUIA 2HBXA 4HHHA 1F5ZA 3ABZA 1F76A 3U2ZA 1Y0EA 5KZDA 2ACRA 4M7TA 4B91A 6TIMA 3B05A 1MVYA 3K2GA 3BSMA 4AX6A 2E5DA 1Z7AA 4UTHA 1JZ7A 3RLVA 1R2TA 2FPVA 1DHPA 1VBGA 3SUUA 3UG4A 4A2SA 3PUOA 7REQB 3PBUA 3E74A 4OVXA 1BQCA 5A8NA 3SUVA 2VJXA 4N0RA 2IPFA 2RDXA 1A5MC 3LCWA 2HK0A 3WG6A 2JBMA 4HU0A 2Y8UA 3WMCA 1SR9A 1ZZMA 4LOCA 3OYXA 1J0YA 1W9BM 1JCXA 1RAKA 1DXFA 3POHA 1KGWA 2PWFA 3N29A 1PIFA 2OODA 1Z44A 4QNWA 1WCGA 3WEOA 1DL3A 2ODOA 1L0PA 1BVZA 1QI4A 2R1PA 2OTDA 3AU6A 4GQGA 3W7OA 2PEVA 1XFCA 3FDKA 2RGMA 2ZZ5A 3A47A 3TONA 1Q85A 1L8NA 1EBHA 3U2OA 3K30A 3P8IA 4DUVA 5C9XA 4WOQA 2A85A 4OZOA 3DHPA 4FA3A 4FI4A 3DGBA 2DIKA 2OWXA 3M6DA 1QPQA 1K9EA 3BLEA 3LGGA 2W66A 2ZDSA 3R6IA 3VNJA 1H5YA 1RUSA 3PJXA 5CPTA 5JXQA 3RYSA 3OA5A 1UIOA 1S1PA 3MKKA 4OIFA 4RZ6A 3V1PA 1RQBA 1S5VA 3D46A 4JIHA 2Z1SA 3VPLA 3T0BA 2WSPA 2QUTA 2DVTA 5GJPA 1JCMP 1W3IA 3W4RA 3HMJG 3OJGA 1A3XA 3HM7A 4DYKA 3AAMA 3ZLFA 4LUTB 3OZOA 4HZ8A 5AYBA 3VNKA 1FWGC 1JPIA 5G2WA 4O52A 4BFAA 4GUFA 3PBGA 1VB9A 1JI2A 3ITGA 2WCSA 1JXJA 1KXQA 3W73A 1B9ZA 4L64A 2WOQA 2FHBA 2XTKA 3LGEA 4ZQMA 1WUEA 3U4AA 5BOFA 3PANA 3N2OA 3FKKA 3KVKA 4L65A 3GG0A 3B0PA 4HA3A 3TSMA 1HN1A 4LXFA 4HP5A 1Q6CA 2VZVA 1W3TA 4IL2A 3A9BA 3VC5A 1LM1A 1CNVA 4WK9A 4XAFA 3TFCA 4NAFB 5AHIA 3A13A 2XM1A 1GJUA 3N14A 5LSMA 1AD1A 4WDUA 1OX5A 4HMNA 4MG4A 3L0KA 1NOFA 5AOUA 4GYPA 1DWFM 1Q6QA 4MPKA 1OD0A 3OIXA 1GOWA 3RO8A 2HXTA 1OGSA 1W8GA 2UY3A 4FNSA 2ISSA 3I65A 1JVNA 1TV3A 3MB9A 1OVDA 3H2AA 3A3XA 4PMRA 7A3HA 3TU9A 5A8GA 2E6FA 3PJWA 5DN1A 3EKGA 3W7HA 2FTPA 4NZCA 4NJHA 1P6WA 4U2ZA 2JKPA 3B4UA 4GUJA 4CNNA 4PUUA 3DC0A 2FYMA 1K8ZA 2WZEA 3RDKA 4AHQA 2NT1A 4B3LA 3B4YA 3FEQA 1HKIA 3D3AA 2DH3A 3TCSA 1TPH1 2PLKA 2ZUTA 4TU1A 1KCLA 1ZQ5A 4YL2A 5JU6A 3W24A 2DDXA 4HOZA 4HPJA 1HP4A 1J0IA 2DEPA 2J6VA 4AFYA 4M7SA 2I7GA 3DFPA 1C8YA 1F61A 2HBVA 3K5XA 5LA1A 2DZUA 4JTDA 3CZ8A 4RDZA 3URAA 1NARA 5BW6A 3AZTA 1PB0A 5HJXA 3UD6A 3UXAA 3GXMA 1QAPA 2E77A 3DYOA 3GR8A 4DJED 5A6JA 4DO4A 1DKWA 2TRSA 1LF1A 4JTUA 1H41A 5CLWA 4FLQA 4HNNA 1XBXA 5AC6A 3ME3A 2GDQA 3MW7A 3CC1A 3TQ0A 2TMDA 5E9XA 1H1NA 2PWDA 3PULA 3E5PA 4WKFA 2GGEA 4I5XA 4FR1A 1EOMA 2W91A 2CLHA 5LIWX 4ZA0A 2PDLA 2PTDA 2Y70A 1JD7A 2PE4A 4M6UA 2Q3OA 4P2VA 2VO5A 4HT3A 2V38A 2XISA 1US3A 3UBPC 2A6LA 3RRAA 3ZM8A 1VJSA 3LRMA 3HGOA 4M6PA 2IW0A 1ZAHA 4JTEA 4EP8C 1A4MA 3ZQ9A 5FJOA 2WHLA 1HF6A 3L5MA 3KVMA 4LUSA 4DF2A 2YDRA 3K8LA 5G1YA 5C70A 1TSIA 3M0YA 1UMYA 2Y61A 2X0YA 4NYUA 2E68A 1VPXA 3MP5A 1UWUA 4AZCB 5FIPA 2HVMA 3TTQA 4C6PA 3WJYA 1R86A 2VQUA 3LHWA 1L6YA 5MKGA 1JI1A 4MB3A 4DZ5A 4J2MA 4X2RA 4AU0A 3TC7A 3GTFA 2VX5A 5IDIA 1D9EA 3VD5A 1YXCA 5CSRA 2EPKX 5CGTA 1DIOA 1DWJM 3NM3A 1GONA 3IIOA 3GVVA 5D9OA 1Z6KA 3SIZA 2NV9A 4GY7A 3B8VA 3ABQA 3OBEA 1E55A 3EWWA 3M64A 2J9XA 3QPZA 5AYYA 2DSZA 3LQGA 3N25A 1MDRA 2PDBA 5IM51 4O53A 4C7GA 4OHQA 4R27A 1KFKA 3VKAA 4B9ZA 1KM3A 2IPJA 4IGSA 1PKLA 1ZFJA 1K4GA 4J27A 5FKYA 2QAPA 4GH3A 4C6QA 1TPDA 3GG8A 3RM4A 2CCRA 1JUEA 4LVDA 1DJNA 1SJCA 4RNJA 2W0UA 3TTYA 1BEUA 3F5KA 3O16A 3AC0A 3QPYA 1A5AA 4DM2A 5D2VA 4HQVA 2CW6A 4MAZA 3V35A 4FNUA 4Q32A 3T07A 4LUJA 1QK2A 3B9EA 4ATLA 1WZLA 3WF4A 3LENA 1R8LA 1F6KA 4NUWA 5FL1A 2VEGA 3IVTA 5FJUA 4L5ZA 3N1AA 3VFLA 2CXEA 1VFLA 3T2OA 1W6TA 5ENLA 2XGZA 1JCLA 2DT1A 1CGVA 1V0MA 3VIPA 3O0FA 1A5SA 1DXEA 3EZ4A 3RX3A 3PR2A 5E09A 2XUCA 1E1CA 1AW1A 6XIMA 3B40A 5BU6A 3TJXA 1UUOA 5J5RA 1S3HA 1FCQA 3KHDA 1NU5A 5D32A 4EVZA 2QJJA 3ANUA 2GVGA 1GOOA 3UXDA 1VPYA 3I6EA 1JYXA 4QAWA 3L0GA 2R1NA 4H7CA 4BQ4A 4S23A 2B81A 2OQYA 4GFIA 3L2LA 2DSKA 1LBFA 2QS8A 1XC4A 3T2QA 4KT2A 3ZLHA 1TVNA 3S6OA 4MZ8A 4BQ3A 1LL6A 1KC7A 2PTYA 3GC2A 3WJXA 1TV7A 1DOSA 1TPVA 2C15A 2P53A 5AECA 4US5D 4PCFA 5A6LA 2XSXA 3MC5A 1KB3A 4XTDA 4HN8A 2DT2A 4Y8FA 3LRKA 1AD4A 3VMPA 1NM9A 3UPWA 2ZC8A 5E6ZA 5DY3A 3LLDA 1X38A 1ZL1A 3VKJA 4ZGYA 3G6LA 4IICA 3CV1A 3TNBA 4AD1A 1ICSA 2EGZA 3WJZA 3PZIA 1KGXA 3NQ8A 4QIUA 1SQ7A 2O4QA 3DGRA 4IL0A 2VQTA 3IJLA 5AC4A 5D2WA 3DHUA 1V7AA 4HK5A 2Y89A 2CWXA 3DEQA 3AYTA 5B7ZA 1Q6OA 1UC5A 4BHYA 3U5UA 1X1ZA 3KTXA 3WNNA 1ZBWA 2OFJA 3W75A 1OG6A 1EP2A 1GYLA 3AIRA 4H8UA 2FFIA 1JXKA 1OFOA 3QN3A 5TQLA 5E9AA 2GVJA 4PCPA 1YW1A 3L4UA 4GINA 3KAOA 4MADA 5I79A 3HMCA 4O13A 3WQ6A 1V3IA 4GKLA 1YE4A 3RITA 3VIIA 4V27A 4MLRA 2ACUA 3TEVA 1BKHA 3CPGA 1EXBA 2X30A 2CBUA 1B2YA 3SCWA 3MANA 3BCJA 4XB3A 3S1UA 1CGUA 1UIPA 3STPA 3JW7A 4U4MA 3DZ1A 4YTRA 2C1HA 4G2DA 4B3KA 3QH2A 1E72M 3CHEA 3UVAA 3WQEA 2WHKA 1E6QM 3TZFA 4OWGA 4C6CA 3MDWA 2V5CA 4GYPC 4ZOEA 1J0ZA 4JDYA 5I3DA 3UPMA 3GD6A 4ZENA 5D02A 2BWGA 4EKJA 3VGGA 3TLQA 3QSTA 4A2RA 2VWTA 5JH1A 1Q4NX 5T9CE 1YKWA 3MA8A 3L2MA 2J66A 3T81A 2WZHA 2O7QA 8XIAA 3BO9A 4HU8A 3CUJA 3O2LA 3W2KA 2WJFA 1O5QA 3M43A 3AYRA 1LL7A 4ZO8A 5AYZA 4GJJA 1XBVA 3A4WA 3WYZA 3SRKA 3NAVA 1AVAA 1CPUA 1IXQA 3IGUA 4PSPA 3PWGA 3STCA 4WLCA 5CJNA 2VFDA 3I7SA 1EKOA 4XAGA 2YBTA 1GOKA 2TAAA 5HDRA 1YLVA 3WDPP 4JNYA 2DY3A 1ZRQA 5A6SA 1D8CA 3W1NA 1LRTA 3PSWA 3VDBA 3E0FA 1R85A 4C65A 4MJMA 1BFNA 3W1UA 3DFHA 4DAIA 1Q13A 1CLXA 3ARTA 2CBJA 1TRIA 2PDQA 2W9MA 1J2WA 2YW3A 4AEFA 2O7SA 3UGRA 7PTDA 1FFRA 2EPOA 1LQAA 3PPGA 2Z00A 4S3BA 1UHVA 3MP3A 5DELA 4P8VA 2VDHA 3S2CA 3OW1A 4J3ZA 2I5QA 3G5EA 4PMQA 2JK2A 1HVXA 1K1DA 4IGMA 1H5VA 3WO8A 4LAUA 2PDUA 1OHLA 1NH6A 4GNVA 3N2MA 3EB3A 4TO8A 1RV8A 3G8EA 3W76A 4WDTA 4GPNA 3IV3A 3FNDA 3DFYA 3BLIA 1PZ3A 2NVDA 4JTJA 3L65A 2RUSA 4KESA 3WCZA 2YL8A 3R1ZA 4WIWA 4CQBA 1PZ2A 3LLXA 4WJEA 3O3RA 4OV4A 1R9XA 3GIPA 1TVLA 1AJ2A 3EAUA 4MYXA 4R5EA 4HKPA 1JIBA 3AS0A 4ZEPA 3NSMA 3RLGA 3UWQA 3FY1A 3W7IA 2Q8LA 2WKLA 3ZR5A 4N02A 4QBXA 1UR0A 1G94A 2JEQA 4KCTA 4QDPA 2HV5A 3LX9A 4W85A 2QDEA 5A8OA 3LCHA 4CNPA 3MCOA 3MI3A 3LTYA 1ONXA 1ISVA 2VUYA 1JGIA 2VCCA 1JGMA 3VGEA 3M5ZA 3VNYA 2VD9A 1FHLA 1Q6LA 1SM9A 3CASA 3IUIA 1WKFA 1XHGA 1FHDA 3HPXA 5LGZA 5H2ZA 4ICNA 2CITA 3MV11 2HXUA 1MI3A 4IMFA 2A2IA 2W27A 3GY1A 2FB2A 3CL8A 1BAGA 3NQEA 5G4EA 4H8HA 3LRLA 4QLKA 3OQ8A 1KFJA 1DJQA 2J47A 5DXYA 1WV2A 3OLGA 5FF3A 5I0DA 2OYLA 2WPGA 1DYSA 3QR1A 4JTGA 1VFUA 3TXZA 3W3OA 3KOXA 3C52A 1J18A 3TV8A 3FAXA 1CWYA 3G2GA 4D6EA 3UXIA 3ITCA 1E71M 3OLDA 4JIQA 4PFMA 1GQLA 1MEIA 1ESWA 3KCJA 5E93A 4ADSA 1N82A 1VQTA 1GNXA 1I2OA 4DELA 2XIQA 4K7VA 1V02E 4GIRA 4BY3A 2OXNA 1U1JA 1XSIA 2HROA 2BVDA 3WJSA 2YZRA 3FV9A 3H2EA 4HBKA 4W7UA