3G1FA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydroorotidine 5'-monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
220
Chain Sequence
VDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 77
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1fA00
4ML9A 3PB2A 1FWTA 2ZRWA 1TPC1 1ICPA 2B7PA 3W1LA 1WQ5A 2NXIA 2VKZG 1GOXA 1KM3A 4E2BA 2PURA 4N2YA 1YDNA 3ATYA 4LW7A 3WFAA 4LS1A 1EB3A 1GEQA 2YZRA 3USBA 2NWRA 1TJPA 3U8GA 2DU2A 3BW4A 1A5CA 5CGQA 2C16A 3E0IA 2A85A 4M7TA 4EF9A 1KFKA 1KV5A 3NQ7A 5I3GA 4MY8A 3NPUA 4CNOA 5HNRA 1FXPA 5T26A 1GQNA 3GX9A 1EWDA 4IOTA 1JUKA 3CU2A 4AB4A 3S9YA 4N02A 4I7WA 1LOQA 3L66A 5AYYA 1XBVA 4WY0F 5TIMA 4Z1CA 3KXQA 5BMXA 4U28A 2C19A 3W1PA 5HWNA 4MLRA 1WV2A 4ZQMA 1A5AA 3W7CA 1NEYA 1QR7A 1F7BA 3C0JA 2ABBA 4O52A 2NUYA 4GFSA 4NXKA 1TV8A 2CLIA 2FDSA 3UYCA 1SO5A 4O15A 3DFNA 1H1ZA 3KVMA 4RXGA 2VFFA 1JCLA 1GVFA 5F1UA 2YFOA 4HNTA 4JTEA 2CLFA 1W5NA 3PBUA 4M6QA 4NJGA 4AF0B 2C13A 4XKYA 5LNUA 3DFOA 4S2CA 4IUOA 4UTKA 1Z41A 4DXVA 3DKLA 1RV8A 4MVAA 3H54A 4Z1DA 1XCFA 1FCQA 3G1VA 1LBFA 1K7XA 2CZDA 3N9RA 3O6YX 3M43A 1JUEA 1B57A 4IXHA 5H2ZA 2DJXA 4AHQA 4AH7A 2AGKA 2ALDA 2V0TA 2V30A 3M41A 2VENA 5C5YA 1R47A 1W5MA 3TU9A 4MUZA 1JRCA 3MUXA 4FNUA 1SW3A 5L6UA 5K9CA 2HS6A 2A2IA 3P67A 4UUIA 3THAA 3STGA 4Y9AA 3TC6A 4ZVJA 3QJAA 3EWYA 2PCQA 2OJPA 2H6RA 3CEPA 3NPVA 4HT3A 5K2ZA 1ZAJA 4DF2A 1EA0A 3LCLA 4CQAA 1TO3A 3W7PA 1LLWA 1U83A 2Y7GA 1UB3A 2C18A 6TIMA 5FF2A 1KM1A 1SQ7A 3HG4A 1OFOA 2Z2UA 3L65A 4R53A 3JS3A 4TO8A 4MZ8A 2ZZ4A 5FESA 4N9BA 5E1QA 3DHDA 3NR0A 1XXXA 5FI8A 1PE1A 2GJNA 5G2HA 2BTMA 4UTTA 1TB3A 1DJQA 5MHBA 1EUNA 3DXIA 3SR7A 3I7QA 4ZQNA 4JTGA 1H7PA 3NEVA 1IIGA 4OWGA 1R2SA 5U4NA 4UTWA 3W2MA 3RLVA 2CLEA 1QFEA 3TW6A 1DOSA 3IIVA 4AWUA 5D33A 1LRQA 1WX0A 1SZFA 3KOFA 5C55A 1H51A 1XI3A 2X1UA 1C8VA 2QCHA 1VYRA 3TUUA 3HOJA 4ZQOA 4GUGA 1Q45A 5G1YA 5K9DA 5AHNA 4IPIA 4KFPA 4UR8A 2A6NA 5IBXA 1ICQA 1H62A 1TJRA 2JKPA 3R2GA 2ZRZA 4O14A 4JGDA 4WOQA 5AC7A 2V82A 5HWMA 3O63A 4IJBA 5D2XA 2WV8A 4UCGA 1TPUA 2QUVA 3W74A 4JIQA 4CLMA 4M7SA 2QEZA 1G6CA 3UZJA 3P74A 3PBWA 4ADSA 3C2EA 2YW4A 2ZZ6A 3MP3A 2HMCA 3DBPA 3CLMA 3LGEA 4KFNA 1ML1A 3G0XA 3HGJA 2CW6A 1XBXA 4FF7A 4TU1A 5FF3A 2ZTJA 3LRMA 3IGUA 4JX4A 3R12A 4M5PA 4RJEA 5I3HA 3TQKA 3ABQA 1VPXA 3CWNA 5FF4A 4DO4A 3GKAA 2QCMA 1G7VA 4LWWA 4UMBA 1TTPA 4PEKA 5KZMA 3LHYA 4LRSA 1B9BA 3A9IA 2P10A 4D2JA 2Z0IA 1FDZA 4N4QA 1OYCA 4LC8A 3HBLA 3A24A 4MFEA 3W2NA 4LUIA 1EUAA 5HMSA 1X6UA 2J9YA 4IX0A 1EP1A 3MO7A 1KFJA 5HUOA 1I8JA 1LBLA 4WD0A 3TJLA 1W3TA 4AVFA 1K03A 3M5VA 3O8AA 4EVZA 2H8XA 1H7WA 3KVJA 1KLYA 3QH2A 2C15A 2Q8LA 1FDYA 4NQ1A 3OG3A 3O1NA 1EPXA 3BW2A 1G69A 3Q37A 1H5YA 5DXXA 4AAJA 4JX6A 1P5BA 4M19A 4ZQCA 3T78A 3F4NA 3IGSA 4JR5A 3UY7A 3GDTA 3BO9A 3GB6A 1KW1A 3IVUA 5KITA 1ICSA 5CZJA 3VI2A 1ZENA 3W84A 3NQ2A 4O1DA 4OT7A 4OGZA 2I14A 3G0SA 1ZFJA 3G0UA 1GT8A 4WZHA 3FS2A 5K4ZA 3BPWA 2VELA 3M44A 1TTIA 4P61A 4QIUA 3CQ0A 4NX5A 4CNNA 2RFGA 5HUPA 5LZLA 3MBFA 4JTJA 1KTNA 5K9XA 1VJIA 4TR9A 1X8FA 1F05A 3MMTA 1IXOA 3I7RA 4L4MA 1S5VA 3W1NA 3NL3A 1R46A 2ZZ7A 4XQ6A 1ZJIA 3PR2A 3TROA 3OVQA 2QUTA 3UWQA 3LOTA 1G4TA 4B5NA 3FA5A 3KRUA 1EP3A 1FXQA 1YLVA 2ZZ3A 2HS8A 1D3GA 3CEUA 3NQEA 4LVBA 3TE9A 1LM1A 1A53A 1JR1A 5LGXA 5FEWA 3UXDA 3HJZA 4KWWA 3QQ0A 4JTUA 1M6JA 3WJWA 4LY8A 3T4CA 2WNQA 3DZ1A 3DI1A 1JCYA 1P0NA 3FOKA 4Y90A 1OJXA 3SJ3A 1VCVA 2H8ZA 2Y61A 1JCJA 4ZQRA 3N2XA 1YTKA 2ZZ5A 3QZEA 4K37A 3LLDA 4U4MA 4LVAA 4EIVA 3G8RA 2G97A 3O6CA 4FIRA 1QPQA 1ZCOA 1OFRA 2G96A 2GVGA 3S1UA 3O07A 1CI1A 1DL3A 4O10A 3S42A 4LV9A 1ZNNA 3G1YA 4TMBA 3O05A 1SZEA 2C1HA 1K8XA 1WXJA 1OFPA 3P84A 5EL1A 1BKSA 1F2JA 1M5WA 3NOEA 3BG5A 2GVJA 4FO4A 4H3DA 1OFDA 2GQAA 2FB3A 1LP6A 5I3KA 3STCA 2OX1A 1ALDA 2V5BA 1LYXA 2ZBTA 3IGXA 3F1QA 1N55A 3ANYA 4OV4A 4BI5A 1TIMA 1F6PA 1VHNA 1UCWA 3C52A 2WSQA 1ZAHA 5D32A 5GVJA 2YR1A 4MJMA 4NJJA 3BLEA 3LCHA 4TIMA 3MI6A 4N9CA 3W73A 1H7NA 3LHZA 1GVSA 1K02A 3IEBA 4JYFA 5FF0A 4UC5A 1K7FA 2QJGA 1OFQA 3WJYA 3B0UX 1QDSA 1CX9A 2ZZ1A 3HGRA 4GUJA 1LRNA 3DH7A 3FLUA 4DPPA 4TMCA 4UMAA 3W1MA 1XUZA 4GC4A 4BR1A 3N9SA 3EKZA 1RR2A 5DY2A 4NNCA 4S2BA 1Q3NA 3CPRA 1N8FA 3T7VA 5F2GA 3UZ5A 1ZAIA 2VC6A 5I3JA 1W5PA 2B0MA 2BZNA 2V81A 1UBSA 2BX7A 4O17A 1KBIA 3Q2DA 5G4WA 4BF9A 4FHAA 3UWUA 4BK9A 4FIQA 2C14A 3GZ3A 3W3OA 5D2VA 3TFCA 1AW2A 2E5BA 4UNKA 1O4UA 3CIWA 4GJ1A 1L2UA 3MHGA 1IXQA 3S5YA 1XBYA 1AL7A 3B0PA 3G1DA 1IXNA 3P5YA 1XDMA 1SSGA 1MSSA 1OF6A 3B03A 2YPIA 1WA3A 3W71A 3LXBA 4MZ1A 3W23A 4UTMA 4EOUA 4RLIA 5I3IA 3L0NA 5L9FA 3L0KA 3SSJA 3RK8A 3P7YA 3BGJA 3DI0A 3S1XA 2V8ZA 2ZA3A 2A21A 2CLLA 3A23A 3S1VA 3NO5A 3W85A 1WOBA 3G3DA 5AHFA 2RDTA 4RX0A 4UIOA 2VFHA 1XC4A 3FEMA 1D3HA 5D05A 3W07A 3HQ1A 3UWWA 2JGQA 2WOQA 5DELA 3P62A 2PRHA 2QCNA 3LHUA 3VCRA 1MEIA 5BNKA 5F2LA 1JUBA 4QNWA 3C2RA 5EKYA 2WNZA 4JD4A 4UFMA 5BRBA 1T96A 3GDLA 2ZCGA 4JN6A 4GE8A 1SW7A 5AYXA 2OZ0A 1PVNA 3EWBX 1LTDA 5D04C 1C29A 2Q3RA 3MHUA 2VEIA 4LVDA 3W7GA 1X7FA 1AW5A 4UTJA 5KTLA 4UR7A 2B7QA 2QDHA 3NZ1A 1SFJA 2QF7A 4GXMA 1XUUA 4RR4A 5J5DA 2CLKA 1GVRA 2ZFAA 3P60A 2WSRA 3G8EA 2P1FA 3PG9A 4JY9A 5D37A 3ZWSA 1OVDA 3G1XA 4UMCA 4O53A 2QJHA 2YW3A 3KAOA 1F76A 3B04A 1JCMP 3ZR4A 1XL9A 3LCXA 4BI6A 4PL2A 3CB8A 2A7PA 1DBTA 1FX6A 2Y63A 4GNJA 4MIMA 3W2UA 1R2TA 4EF8A 1KTBA 3EXSA 2EF9A 4MYXA 3TKFA 1BTMA 3HIJA 3L21A 4K38A 2C3ZA 1GTEA 2HSAA 2J88A 4QQ3A 2YXGA 3M47A 3W1AA 5DLCA 5F4SA 4ZMGA 4Q4KA 2Z6IA 3M6YA 2QCDB 2A1YA 1A5SA 2PRLA 4JXCA 3LRLA 4IXXA 5DCBA 2P0OA 1FBAA 1DHPA 5BMWA 5D38A 2DZVA 1TPH1 4E38A 3UD6A 2YSWA 4RV8A 4K7VA 3HG5A 4WUIA 4BFAA 2R94A 4FX7A 1QWGA 4P2VA 5F2IA 2O7QA 3TA6A 5D02A 1GWJA 4MPQA 4JY8A 4XBSA 1Y0EA 1TQXA 3GR7A 1H7XA 7TIMA 4XUGA 3TFXA 2PC4A 3WK3A 1MO0A 4PFMA 3W83A 1JJKA 4YCOA 2JK2A 4QAIA 3W1UA 1J4EA 2R14A 3L67A 4JDYA 2J9ZA 4JTKA 1DVJA 2VFGA 3TCEA 3W7MA 3GDKA 3S5OA 5CZ0A 1EIXA 3R8RA 3GAYA 1LZOA 1TSIA 2X30A 5G1TA 1TPEA 3BLIA 2X1TA 2NX3A 3GIYA 3P82A 4PC8A 2NWSA 2FLIA 1SU5A 2CLOA 4XKYB 4YXGA 1KFBA 4UFIA 1GG0A 3L5MA 4QJ1A 1FWNA 3G1SA 3MBDA 5A5WA 1TPB1 3NZRA 1XKYA 3NL2A 5FEZA 5HJLA 4ADUA 3C56A 3W7NA 2YDAA 4AF0A 3W22A 4MJZA 3C6CA 1N7KA 1X1OA 1BWKA 4FEZA 2Y89A 3TXZA 4ZL1A 4GRSA 4LTSA 4N9DA 4X22A 3W2LA 3PF3A 4KFOA 4BWLA 5TBOA 1L6WA 4AEOA 4AWTA 2NXHA 4O19A 4RK8A 1W3IA 4O4VA 4NNBA 3QC3A 1QCWA 2WKJA 3QEZA 4GWEA 1ONRA 5CG7A 1GVOA 2GUUA 3TAOA 3B4UA 1FCUA 1M7PA 2ISVA 1FWSA 1LROA 2XN1A 3I7SA 3ELFA 1B4KA 1GPWA 4O4WA 5HINA 2X1RA 3LCFA 4WQ6A 8TIMA 2X16A 1VS1A 1NSJA 2DJLA 3OVRA 3PUDA 5K7JA 3P80A 2VEPA 4K36A 5DXYA 3A21A 4IPJA 2FPYA 2TYSA 1OX5A 1MXSA 1VR6A 5F2MA 5LSMA 3UWZA 5J5RA 3T44A 4Q32A 3K30A 1KM0A 4JYEA 3W7OA 3TJXA 3GR8A 1W1ZA 2V2DA 1KTCA 3GLCA 3KX6A 5EPDA 3N2MA 4JTLA 4YWIA 2VFIA 2X1SA 3MP4A 3EXRA 1V7YA 3HF3A 3TQVA 1W5OA 3QSRA 1DQXA 3MJYA 2YX0A 4XWUA 5EA9A 1KM4A 1FQ0A 1I2OA 4JTFA 3LHWA 4YLWA 4LVFA 2FB2A 3EX2A 1VCGA 3IV3A 5C54A 4MKNA 3PWAA 1O5XA 5D2TA 4FXRA 3UPWA 3VE9A 3QRHA 1DORA 2ZQ0A 4QISA 1SUXA 4I9AA 3F4WA 2DZPA 2AQWA 3L5LA 3PM6A 4K39A 1VCFA 1QAPA 3B8DA 3M5XA 2E6YA 2OT1A 3TK7A 3W7RA 3DGRA 1UJPA 3CM4A 1S5WA 3R5EA 4CQ9A 5HR7A 3NDOA 4GUIA 1P1XA 3A22A 1RQEA 4X2RA 1SO3A 4O16A 4HHPA 1EX5A 4UFKA 4A22A 1TTJA 1WDWA 3MI2A 1XM3A 6ALDA 4O54A 3ABOA 1RQHA 3UWVA 3ATZA 3TR2A 1PCKA 2W79A 1GJPA 3T55A 1FCVA 3RF9A 1VHCA 3YPIA 2OT0A 4H6KA 2FPVA 3QMRA 4UFHA 1YADA 3NM1A 3LCWA 1H50A 1OK4A 5D30A 2HTMA 1RPXA 2VFEA 1VYSX 2B7OA 3EX4A 1FY6A 1TCDA 3EWUA 1FWRA 1OX4A 1RQBA 1PHQA 3L2IA 4A2SA 2ZZ2A 1AL8A 2NZLA 4G1KA 1WAUA 5CPOA 3NQGA 4UNLA 1AK5A 2EPHA 5AFDA 3GK0A 3MYPA 4N4PA 4UTHA 3E49A 1ME7A 1C9DA 3TDFA 1TV5A 1MEWA 4YMZA 4ONVA 2DZUA 3AO0A 2GQ9A 3M0ZA 2FJKA 5LNVA 1F5ZA 3DFSA 5EYWA 3NYZA 4NNAA 5DBTA 3KVKA 1I2QA 3PUEA 2R91A 2E5DA 3PAJA 1QOQA 2XN2A 2JKEA 1DKWA 4FX6M 2DORA 3PVFA 4O50A 1G4SA 3LBMA 3TMLA 5LNRA 4WXYA 4NT0A 3TC7A 1XBZA 2CLMA 3QF0A 2CZEA 4JTHA 3FJ6A 2H3BA 1QMLA 3FIGA 3I6RA 4NXSA 3F03K 4HPJA 3FKRA 3GNNA 1SZGA 4UXDA 3UNDA 4RCXA 4RZ5A 1QPNA 2QCGA 4O57A 3GYEA 5U7SA 3IIOA 4CCEA 4O0ZA 4IMDA 1PV8A 1DV7A 1LLZA 1JVNA 4NUWA 4DQWA 4FNTA 3UWYA 2RDUA 1TRDA 3LXCA 2GPTA 4YCPA 3VFLA 3BK0A 3KRSA 1HL2A 1SZNA 3LHVA 2FQIA 4IMCA 1NF0A 3W9ZA 1L9WA 2A6LA 3I65A 3EWZA 1ME9A 4NJKA 1WBHA 2RKXA 4K8HA 1OABA 3H53A 4JTIA 5F1VA 1HG3A 3HPZA 2E68A 3BGGA 2DZTA 2QAFA 4FNRA 3SI9A 3LV5A 4OHQA 1IIHA 2BWGA 2NX9A 4XZ9A 1SPQA 1HO4A 2V2CA 4YL2A 1KLZA 2CU0A 1H1YA 3DAQA 5K4XA 2BSLA 1SW0A 4N6EA 2YGYA 3U2OA 1H61A 2Y7DA 4OQVA 1UUOA 3NXFA 1RD5A 5FEPA 5G5IA 2RH9A 2A5HA 3W87A 3W1TA 2E1DA 2Y88A 5AHIA 1W37A 3TSBA 4WY0B 3LRKA 3LX9A 3C2FA 4WOZA 1TPVA 3LHTA 3C3NA 4FX8A 3PBVA 3P5ZA 3QYQA 3ABSA 3H55A 3HPXA 4O8RA 2Y6ZA 1LCOA 3NA8A 5FF7A 3KRZA 1W0MA 1OHLA 5K3VA 3EX1A 3DKJA 3NPXA 3O16A 1LORA 1QO2A 1VRDA 3STFA 4MZYA 4PH6A 3U6WA 4O18A 3IIPA 3SIZA 4NZFA 3W1QA 3W2JA 1UASA 3OEXA 2GVLA 3B05A 5D03A 3DHFA 2KZHA 1OFBA 1TREA 3P61A 4LU0A 3IIXA 3W7EA 2LLEA 1Q6OA 1W56A 3PB0A 3W7IA 4FNPA 5EBUA 3EXTA 2YCEA 3MI3A 3CWOX 3SECA 3UY8A 3G1FA 1ADOA 1BEUA 1SO4A 2YFNA 4IX2A 2QJIA 1GZGA 2EHHA 1Q6RA 2D73A 3GVGA 3HO8A 4UTWC 2I1OA 4N6FA 3WK2A 2ISSA 3LTSA 1XDLA 4QITA 3R13A 3TQ0A 3PSWA 4LC6A 1FDJA 4WY0A 5A8GA 5SWUA 4MFDA 2B7NA 2ABAA 5KMYA 1S5TA 3LI1A 4MLJA 1TTQA 4W9TA 5LHEA 2JKAA 1VLWA 1U5JA 2DZWA 4XBKA 4RZ4A 2VOMA 5AYZA 4O1AA 1Z48A 1V5XA 4ICNA 3L0GA 3DFTA 2V9DA 2A7RA 3FJLA 3NQAA 2I9EA 3G3MA 2WSYA 3A5VA 4CNPA 4OE7A 3GDMA 4ORIA 4LVGA 4R33A 1G4PA 4X3ZA 3WJSA 3NAVA 3LB0A 3LCIA 1H63A 4TX9A 3AJXA 2RDWA 4UTTC 5G2IA 3TH6A 3NQVA 1GVQA 4BI7A 1OFAA 5G4EA 4JTTA 3ZS4A 3W1RA 4O13A 2JGYA 3EEGA 4HNNA 4Y96A 3LLFA 4Z0JA 3M5YA 1PIIA 1VC4A 3PC0A 3QPZA 4HSOA 3T40A 1L6SA 4E0CA 5TQLA 1YXCA 4POCA 4S1FA 2TMDA 3LCGA 5CPMA 2VEMA 2Y70A 4KWVA 3QPYA 1O5KA 2E6FA 2WQPA 1CW2A 3S5ZA 4IMFA 5CSRA 3W6YA 1NAL1 2QR6A 4AWSA 4XTDA 1PHWA 1SSDA 1ZY9A 2JBMA 3SZ8A 1KM2A 3ZWTA 3TIMA 4C1LA 3NQFA 2UV8G 4LRTA 2F84A 4OBTA 1OG0A 3SGUA 5EMUA 2QCDA 2QDGA 1O60A 1TPFA 2GOUA 5KINA 4GBUA 4L4LA 4J9JA 4O28A 1EWEA 1TPDA 1KBJA 2ATSA 4JS3A 4UFJA 3KVLA 5AHMA 3LM7A 2ZA1A 5AC8A 3M1ZA 1W31A 4JIPA 1KM6A 3MWAA 1VZWA 3TNOA 3NPWA 2W0UA 1F74A 1OX4B 4RZ6A 1YYAA 3M7WA 4JEQA 3SFKA 1G4EA 3WK1A 2J9XA 2DZXA 3C8FA 3W75A 1J2WA 5AHLA 5C6MA 2QKFA 4WX2A 2NUXA 5CSSA 1KFLA 2A4AA 2W6RA 2QCEA 1Q6LA 3S6DA 1RVGA 3SW6A 1RZMA 1Z44A 4OV9A 1A50A 3HGOA 1JULA 5E0KA 3QW3A 2ZYFA 4EWND 3DU0A 3PBYA 3SGZA 4NX0A 1FWWA 1S3HA 1YXYA 5AOUA 5KZEA 2EKCA 1JQXA 3BW3A 4A3UA 3C2OA 1TYGA 4IMEA 4X9SA 1SFLA 3CT7A 1Q6QA 4LS2A 4ALDA 5ABTA 4FB7A 1QNVA 1T99A 4OU1A 3SY5A 2PE4A 4AHOA 3BG9A 1KFEA 4A29A 2QCCA 1YDOA 5HULA 3P81A 4HN4A 1A5BA 2ZDRA 4UTUA 2WO5A 5D2YA 3C61A 1K8ZA 2Y62A 3PG8A 4NJHA 4WXZA 5HWJA 4R34A 4FNSA 1IF2A 4NZJA 1K7EA 3C4UA 4Y8FA 4DO6A 4N9EA 2TPSA 3HGSA 5IM51 2E5CA 4HIBA 4LS0A 1ZALA 3HB9A 3TX9A 5LKYA 3TMQA 2Y85A 3WJZA 4ZZ9A 3HMJG 1HUVA 5CZSA 3L68A 5KZDA 2FPTA 1PS9A 2H90A 2BLEA 2RHGA 4H4IA 3THQA 3MHFA 2OMAA 1TMHA 1PL9A 5HR6A 3G1AA 3W7QA 4NVTA 2YYUA 2QAPA 3P8JA 1XFBA 3EWWA 1T0OA 4Y6GA 2Q8ZA 4ADTA 5E93A 1QPRA 2X2GA 3I68A 5C2XA 3OBKA 3W7LA 2V2HA 2TRSA 3QMSA 3GNDA 3IVSA 3S8HA 3MYOA 4Q33A 3VNDA 5CKSA 3ABRA 3W2KA 3DFQA 3IRDA 3UQNA 3EX6A 2CZ5A 1G7UA 3L9CA 1SO6A 3NM3A 1DQWA 3W72A 1UUMA 3LBCA 5BOOA 2Z1BA 4IMGA 4NJIA 3W7JA 3NQDA 5FEXA 2B4GA 1O95A 1LOSA 1W54A 4FNQA 2ZA2A 3NGJA 3G22A 2PRMA 3N3MA 3NQCA 1I2NA 1TPWA 4O1CA 3WK0A 3GXPA 4RKAA 3FYOA 3S0CA 3EWXA 4PA8A 5DN1A 1LRTA 4HPXA 2GQ8A 2Z6JA 1FCBA 1W8SA 3QW4B 3PULA 3GXTA 3GAKA 3UXAA 2NXGA 4UTIA 1YPIA 3O15A 5DY3A 3JR2A 4PTNA 1WBJA 1OFEA 3LDVA 3NVTA 3W7HA 3HG2A 2NX1A 4FXSA 4LNYA 2BXVA 4KKXA 3W88A 3S5NA 1WOAA 2E6AA 2GJLA 2NV2A 1GYLA 2ZRXA 3JRKA 4LUJA 2OCZA 3L5AA 5CPNA 5G2WA 3Q94A 4JTSA 2C6QA 3V1PA 3NL6A 3NL5A 2NLIA 3VE7A 4GUFA 1JQVA 2VFDA 4M6PA 1TV7A 4O12A 3TXVA 2YYTA 5AC6A 4BWLC 1EEPA 1R2RA 4HNUA 3M9YA 1G67A 4A21A 3R89A 3CIXA 1OK6A 3BV4A 5D2WA 5H91A 4PL1A 4AMAA 1OF8A 2WNNA 3RLUA 4CCDA 1VH7A 3W7DA 1P0KA 4K7YA 1I2RA 2QUUA 1OX6A 1E51A 3NQ6A 1AW1A 2FIQA 3LI0A 1QOPA 1SR9A 3KFTA 1ZHAA 3Q58A 3E9AA 4UTLA 3DENA 2DP3A 2ATMA 5F4WA 3NNTA 4AHPA 1MZHA 3GXNA 5LHFA 2R8WA 3M16A 2J24A 3PY2A 3GDRA 3M5ZA 1TQJA 1L6YA 3N34A 3G24A 3S1WA 3DFPA 5HQEA 1I45A 3QSTA 2E09A 1DJNA 1D9EA 4AXKA 2IQTA 2ZRYA 3EKLA 4ORMA 1W3NA 2DZSA 1KV8A 4DEFA 2WPBA 1JCXA 3QMTA 4K8EA 3RFAA 1K3UA 5LGZA 4MYAA 1MEHA 3CC1A 1I4NA 2AAMA 1THFD 4Z08A 5AB3A 4GUHA 2XN0A 3CTLA 4MY1A 3QQ1A 4LV4A 4PCFA 1H60A 3PSVA 3W7KA 3OVPA 4JNMA 3E02A 1QPOA 1Z42A 4I7VA 4O0KA 4WJEA 3C2VA 2CFFA 3G18A 3UPBA 1LBMA 3E96A 3HG3A 3OA3A 2Q3OA 1VLIA 4DF1A 1PCWA 5DBUA 4QM1A 3B0VC 4HKPA 1T8XA 1HO1A 1I2PA 1KA9F 4XTIA 2FFCA 2ZRVA 4Z1AA 4RXFA 3V75A 4K6AA 3VKJA 2ZRUA 3IVTA 1HFBA 3BLFA 4IGHA 4DO5A 4JICA 3QM3A 1OYBA 3N19B 4MOZA 1B4EA 3RNDA 2A0NA 1GYNA 1GTHA 4LT9A 3STEA 3GKFA 1JCNA 2J27A 2E77A 2FTPA 4R7JA 5CZTA 3INPA 3D0CA 3LERA 1WYIA 1TRIA 4O1BA 3LXAA 2VEKA 2G95A 3N14A 5I3FA 4PODA 1LDCA 3A5FA 4Z0SA 1GG1A 3ZFHA 4M6VA 3RU6A 4DBEA 3N73A 3PS7A 1AG1O 3LTYA 1KFCA 3RMJA 4JX5A 1QO5A 3HPSA 2C0AA 2H3DA 4DBDA 3NQ8A 3TSDA 1VGAA 4NU7A 1F73A 4HNVA 5F4XA 1NF7A 1NFBA 3LTPA 4DPQA 2XFWA 2ISWA 2QCLA 4E2DA 3O06A 5EY5A 3G1HA 1H7RA 1HTIA 2WJZA 3EX3A 1OYAA 2NUWA 1LOLA 3QFEA 4DF0A 2ZTKA 4IQLA 4O11A 3W76A 1EP2A 3BG3A 3WJXA 5AN7A 1ME8A 2O7SA 3FKKA 4ZQPA 3P8IA 1KM5A 4IWWA 1J5TA 3FYPA 1NVMA 2TSYA 2J6XA 1B3OA 4MY9A 3B06A 5IBXC 3KHJA 4A2RA 1F6KA 4I7UA 3W86A 1P4CA 3TSMA 2V5LA 1H7OA 3TAKA 1YTDA 2EGZA 5LNSA 2CLHA 3TV8A 2NV1A 1VQTA 4CQ8A 5LNWA 2G5WA 1W5QA 2CZFA 1X1ZA 5KSWA 4JDBA 1O94A 5DCDA 3BARA 2E6DA 1YDVA 2Y7EA 5AHEA 5DCEA 3FFSA 2Y7FA 3MP5A 1JRBA 2F7FA 3NG3A 4DELA 1YTEA 3MW7A 2QCFA 4CCCA 2A7NA 3E12A 2CWNA 1YPFA 3CHVA 1BWLA 1YXDA 1R30A 4JYDA 1VYPX 2VXNA 4QNEA 1IGSA 3O6DA 3TW7A 1M7OA 4LOCA 4C1KA 3W70A 1K8YA 3BVJA 5CPLA 2EAWA 3OIXA 4UFLA 3IIZA 4HSNA 5D09A 1AMKA 3OHIA 3W1XA 3PUOA 3NQMA 4Z1BA 5BW6A 3EB2A 1FUYA 4QSHA 3LV6A 1IXPA
chains in the Genus database with same CATH superfamily
5GNYA 4ML9A 4DM1A 1IGWA 1FWTA 2V63A 3HQNA 2B7PA 3W1LA 2JQXA 4X63A 4A8IA 2VKZG 1TWDA 5LIUX 2VHLA 3GH7A 3V5FA 1W1IE 4MUPA 4MWAE 1GEQA 2YZRA 2QJNA 4V2XA 4IPLA 4PGLA 5IFPA 2YB1A 3E0IA 2Z1VA 3PTKA 4MY8A 3QR1A 1BVWA 3TTSA 1NDWA 3GY1A 3QOMA 3IANA 3T07A 1R86A 1ISXA 1W1PA 2HVNA 4TV5A 3CU2A 1A5UA 2WZMA 3S9YA 4N02A 3L66A 1TVNA 5AYYA 2X0YA 4WY0F 5TIMA 1UA3A 4Z1CA 1DTNA 3KTCA 3VNIA 3PTQA 2C19A 4U28A 3N2CA 3W1PA 4MLRA 3H7VA 1Q2SA 2WZTA 1NEYA 1QR7A 2W3ZA 4O52A 1V0MA 3R94A 4NXKA 1E6SM 2WHKA 2FDSA 5AKQA 2OQLA 1JCLA 1GVFA 5F1UA 3H22A 2OXNA 2WVVA 3PBUA 3CV2A 4M6QA 3I3DA 4AF0B 2C13A 3NURA 4XKYA 4S2CA 4L4PA 3WEMA 4DXVA 3DKLA 4MVAA 1CXEA 3H54A 3L2MA 1X39A 1FCQA 2YBTA 1K7XA 3N9RA 3O6YX 2VZOA 3VINA 4AHQA 2AGKA 1NARA 2V30A 3M41A 2VENA 4MUZA 1UWIA 4RV3A 1SW3A 3VD5A 2A2IA 2V68A 1CEOA 1B0IA 1F3TA 3AC0A 3TC6A 3QJAA 3EOSA 3BWWA 1DWGM 1RXOB 4HU4A 2XWEA 2NQ5A 3WUFA 5K2ZA 1ZAJA 4DF2A 1ZP4A 1AMYA 5RUBA 5IRPA 1FP8A 4CQAA 3W7PA 1U83A 4E4UA 6TIMA 5FF2A 3U7BA 1R3TA 2WJEA 2FH6A 3L65A 1FWEC 4RE2A 5FESA 5I23A 5LA2A 5E1QA 3DHDA 1XXXA 4AWEA 3NDYA 1B5TA 4KEZA 1WUEA 3UGRA 5MHBA 2PDNA 1N8WA 1Q85A 3ABXA 3FHAA 3NEVA 4B92A 1GZ1A 4OWGA 1R2SA 3T0AA 1V6YA 2WLYA 2P0IA 3W2MA 2CLEA 1BSLA 1U5HA 6REQA 3TW6A 3IJDA 4Q4MA 4AIEA 2HK0A 4AWUA 2QHAA 1FWHC 1LRQA 1WX0A 4FZIA 4EE9A 2PDBA 3KOFA 2CHNA 2X1UA 4CCZA 3GU1A 3SIMA 4QBXA 4DJEC 4GUGA 5I2UA 5K9DA 1ISYA 5AHNA 5CJMA 4KFPA 2A6NA 2ZRZA 4O14A 4ZB5A 1GQJA 3UZZA 3O63A 1Q7ZA 4X9YA 4A35A 5CPQA 4IJBA 3VX1A 4ZOEA 4YTTA 5D2XA 3DG6A 2QUVA 3W74A 4CLMA 4M7SA 4FOKA 3P74A 3ZOAA 3CUJA 3SUTA 2YW4A 3LPGA 3GSMA 2I5IA 1Q5MA 4OECA 3K1GA 3MP3A 2HMCA 4GX8A 1XBXA 3M64A 3UNTA 3IGUA 4JX4A 3R12A 2AGTA 3ABQA 2Z26A 4DO4A 2DT3A 2AL2B 1TTPA 3DERA 2XM1A 4LB3A 4D2JA 2Z0IA 1OYCA 2J6VA 2J62A 3OQEA 3HBLA 3A24A 4LUIA 5HMSA 2J9YA 1CB7B 1RD6A 5B7YA 2WCGA 1D7FA 1KFJA 5HUOA 2VCCA 1G94A 1I8JA 1TVPA 4MKVA 4Z2JA 1K8CA 1K03A 3HTWA 3O8AA 2H8XA 2D2HA 3KVJA 3TYBA 2GYIA 3VCCA 1UZHA 3WQPA 4NQ1A 2XHYA 1MRAA 1VP5A 3BW2A 3Q37A 1E1CA 1LF1A 1UHVA 1FTXA 1OGSA 4JR5A 4P5UA 4AC7C 1MXDA 3MMWA 5CEWA 3N4EA 4PTVA 4U2YA 1OEPA 3TTYA 3NQBA 5AZ1A 4OGZA 2I14A 3G0SA 1VBGA 2XVLA 3PJXA 4NZ5A 3CV6A 3G1RA 3BPWA 1TTIA 3W24A 3CQ0A 1VAHA 5BU6A 4CNNA 1CGXA 3MBFA 4JTJA 1VJIA 4GYJA 3MMTA 3SQLA 3I7RA 3VM5A 3NL3A 5IOBA 2ZZ7A 2XPKA 3S5SA 1ZJIA 3UCCA 3AYSA 4P7NA 2QUTA 4GI6A 1AJ2A 4BF5A 2BVYA 4GI9A 5EBAA 1YKWA 1YLVA 2HS8A 1N2VA 1D3GA 3NQEA 2BY0A 5LGXA 5FEWA 4GGBA 2I16A 4KCVA 1H3GA 3HM7A 3QQ0A 4JTUA 2WC7A 3WJWA 1O1ZA 4CU7A 2WNQA 3DI1A 1JCYA 1N82A 3ZT6A 1P0NA 1F9CA 4FLRA 3SJ3A 2DY3A 2QXWA 4GK8A 3W6LA 3LMYA 4EPBC 1K9TA 1I75A 3N2XA 2ZZ5A 3LLDA 4LVAA 5CCZA 4EIVA 1MXGA 3EA2A 4CEUC 1ZCOA 2GVGA 3O6CA 2YL6A 4K1WA 1QNPA 4TMBA 3T0CA 1SZEA 3QY7A 2I17A 1K8XA 2YDSA 3ENLA 4NRRA 2GVJA 3D47A 4H3DA 1DE5A 1JI1A 1G9HA 3TOPA 2OZTA 4H9ZA 2FB3A 5I3KA 3HV9A 1UOZA 2OX1A 2QVNA 1PYMA 4BHYA 1TIMA 2P3ZA 1UCWA 1XRFA 3VD7A 1TX0A 2EKGA 5AC5A 5D32A 5I06A 4LAUA 4TIMA 1QI5A 3VGEA 4LANA 3MQTA 1GVSA 2REQB 3RILA 4LF1A 3WNOA 4OTKA 3ZO9A 5FF0A 3B9AA 4PTDA 3B0UX 5JH1A 2R1PA 2ZZ1A 4NI8A 2O55A 1LRNA 2VRKA 3DH7A 4GNVA 3UEQA 3POCA 4UMAA 3CYVA 2PDIA 4GC4A 3F2BA 1MFVA 1W9PA 5DY2A 1YBQB 1JYNA 1DEDA 1O6IA 3SY8A 1KC7A 2VC6A 5I3JA 4QCEA 2BZNA 1UBSA 3BE7A 1KBIA 3NOYA 1GK8A 4W7WA 3VNLA 2C14A 3H70A 4QDWA 1AW2A 3CIWA 1XINA 1IXQA 3ONBA 1TZZA 2BNJA 3B0YA 1A3WA 3GHSA 1OF6A 4AUBA 2YPIA 4Z2IA 3W23A 5E9XA 1S5NA 3WDHA 1NOUA 3AMCA 3SSJA 3BGJA 2ZKMX 3PZIA 1WPCA 2ZA3A 3S1VA 4IL0A 3W85A 3LNMA 3THDA 3ITLA 4GYPA 1WOBA 4KESA 3G3DA 2PWHA 3WF1A 1M65A 2DSWA 2GK1B 1D3HA 3CWHA 1LG1A 3VZZA 1DHKA 4B90A 4OUEA 4KWSA 2XDFA 2XVNA 1JUBA 4H9YA 3IJLA 5BRQA 3UZYA 1QWKA 4PZVA 1EHAA 3GDLA 1GVYA 4JN6A 3WLMA 3U57A 4AX7A 1LTDA 3MSDA 1UKSA 2AQVA 4YPJA 4LVDA 2DSKA 1D3CA 1RHCA 4UTJA 2ASHA 4MTVA 2B7QA 3NZ1A 3GTIA 2QF7A 2R82A 3BOFA 1GVRA 3EOOA 3G8EA 3PG9A 4JY9A 3ZWSA 4YJ5A 4QG9A 5H8UA 3N9KA 3BOLA 1DJWA 1K9EA 4REQA 4D6JA 1GCYA 2YW3A 4S3GA 2V5CA 4BI6A 1VIZA 3TC3A 4PL2A 3U3HA 4A8RA 1CGTA 1W1A1 4AZ5A 1MUCA 2G3FA 4C7GA 4EF8A 3PPCA 1EJ7L 4TVDA 1BGAA 2Z2AA 2Z00A 5E0FA 3SDOA 1BTMA 4AYGA 3L21A 4AMCA 2ZXAA 2C3ZA 4WR3A 2HSAA 4QQ3A 2ZICA 1P0DA 2J4GA 1HKJA 2ANUA 5DLCA 4AIUA 4FOUA 3WBXA 3M6YA 5MKGB 5A6JA 4QG8A 4HTBA 4D6EA 3MMUA 2PGWA 5DCBA 2P0OA 1MWOA 3W82A 4W8AA 4JFWA 4B16A 4PE8A 1TPH1 4DNHA 3UD6A 4RV8A 1GW1A 3HG5A 1DWAM 1W6TA 5D02A 1GWJA 1Y0EA 5AECA 3TYZA 1ZQ5A 4JOMA 3CT2A 3U5UA 1XYMA 3GC2A 3OOQA 2IPGA 1TWWA 4YCOA 1N8IA 4QAIA 2WNWA 1SJBA 3N15A 3HPFA 3QV8A 2J9ZA 3ID7A 1WDQA 3T2PA 1DVJA 1P7TB 2O9OA 2VFGA 3W7MA 3A3HA 1E4NA 4WVXA 4IGMA 2VYOA 3EEZA 2V69A 4XV0A 3CPGA 2O56A 3BLIA 3BJFA 1UQYA 4LYRA 2GGJA 2FLIA 4XKYB 4S23A 3L5MA 4LAKA 1EA9C 2PWUA 3WNLA 1TPB1 3BANA 3TW9A 2J79A 1U30A 9RUBA 1XKYA 3NL2A 5HJLA 1FH8A 4CN1A 1DWIM 1TCMA 1EC7A 3C6CA 1YNPA 3RCNA 3TXZA 4ZL1A 4GRSA 4N9DA 4X22A 4AD2A 4AWTA 3T8LA 1R38A 1BG4A 3KLLA 4H9VA 3RJXA 1J10A 2WKJA 1C93A 1KCXA 1ONRA 2R6OA 1ZZMA 3PJTA 5HDRA 1GVOA 2GUUA 3TAOA 2CETA 3OZPA 1FWSA 2VVSA 2XN1A 3P0WA 2OLAA 3T9PA 1GPWA 3LSCA 5HINA 4WQ6A 1EO7A 1W1YA 3OVRA 4A8NA 3PUDA 1CWYA 1XPYA 4WGXA 2GL5A 4GCAA 3TN4A 2FPYA 1OX5A 3R0KA 3WUBA 5A3HA 4F0SA 3UWZA 3K30A 1KM0A 3GTHA 2DZAA 1YDYA 4RE0A 2BODX 1TJ1A 3EMZA 5FSDC 3A12A 5EPDA 3GU2A 4JTLA 2VFIA 4HCLA 4UOZA 4XD6A 4Z2KA 4W89A 4B3KA 3MC5A 1EDTA 1XDJA 2V67A 3FSTA 3KTXA 4XVDA 4YLWA 2XFFA 2FB2A 3EX2A 4IFKA 1GQLA 1IR2A 1J0IA 5A1AA 1M41A 3O0KA 3QRHA 4YNGA 1ONXA 3XISA 4QISA 1SUXA 3F4WA 1GVEA 5G1MA 3B97A 4LY4A 2IPWA 7CGTA 5HJYA 1QJWA 3KZPA 4K39A 3B8DA 4LCRA 3PZGA 2ZC1A 3M5XA 1DTUA 4J40A 1UJPA 3NDZA 1S5WA 2GJXB 4GUIA 2QPXA 4RPQA 3WH8A 1WDWA 3A3WA 1RQHA 1OB0A 3K2GA 2W79A 1GJPA 3B4YA 2DW7A 4EP8C 3RF9A 3YPIA 5LXXA 3FVMA 1J2BA 4U2ZA 1RK5A 1A49A 2FPVA 5XINA 3A4JA 1PEZA 1YADA 1HL8A 1XH0A 1QI2A 1RPXA 3AIQA 5FJRA 3GDBA 3VCNA 1VYSX 3UZXA 4S3BA 2VZTA 5DANA 3M0VA 1DJGA 2YDQA 1PTDA 1OX4A 1RQBA 5LYRA 5ENLA 4EXQA 1DWJM 3QTPA 3NQGA 4BA0A 1K6WA 4J7RA 2HV5A 3WMCA 3MYPA 1TUFA 3U4AA 3TDFA 1MEWA 3W25A 2BHYA 2DZUA 2GUBA 1T6MA 4NNAA 3KVKA 3PUEA 1OSEA 4CGTA 1A5KC 1B3ZA 4FX6M 1K70A 3O7UA 2FZ9A 3TC7A 2CZEA 4JTHA 4AZGA 2H3BA 3R6IA 4NXSA 3VOGA 3PZ9A 4HTYA 4QFUA 3F03K 1C92A 1P6WA 3WY1A 3UNDA 1M01A 3ZVHA 4O0ZA 2PBOA 4IMDA 1O66A 1DIKA 1LLZA 1JGMA 1JVNA 2QDDA 4NUWA 4Q7NA 5E5CA 1Z8AA 3UWYA 5A6SA 1EJVC 4R9XA 2IPJA 3LXCA 4YCPA 3AXHA 3VFCA 2IXUA 1IEQA 2VD8A 3LQLA 4TUFA 3I65A 3MSRA 1WBHA 4GZEA 3K8LA 2GDVA 1OABA 3ZXWA 1R6WA 4JTIA 1JI2A 3CAVA 2V38A 2GGGA 2DZTA 1J12A 2QAFA 1NP2A 3SI9A 4OHQA 1PTGA 4LX4A 4PUJA 4F9JA 1SFSA 3JVAA 2VP8A 1ZPTA 2PWVA 3B0XA 3RRXA 1CZ1A 4YVVA 1PBGA 2PDLA 5G5IA 1XKJA 2E67A 3ORWA 1LL7A 3XIMA 2HK1A 5M5DA 1P43A 1TPVA 1XLDA 3C3NA 3PBVA 1L2QA 3ABSA 4PCTA 3NA8A 4L9YA 3C3UA 3RLHA 5BXSA 3BZJA 3EX1A 2QGYA 4PRWA 4IQJA 5HBFA 4O18A 3W2JA 3H8AA 1KO0A 3B05A 2HNEA 1EJSC 1XPGA 3VIOA 1CBGA 3RX3A 1AQMA 4GX9A 1DP0A 5CG0A 3TTOA 1MW0A 2PCEA 3PB0A 3W7IA 4HMDA 5EBUA 1S2TA 1ONWA 3SECA 1OT1A 3CUHA 3G1FA 1ADOA 1E70M 4Q8MA 2WWDA 4IX2A 3D6NA 4ZXLA 3KOWA 3FEQA 1GZGA 1HKWA 5EFFA 4U3CA 1V6XA 1VFSA 3GVGA 4PBEA 2I1OA 3QGKC 2ZX8A 2WMIA 3WK2A 2E7FA 3R13A 3PSWA 2CEQA 3OLDA 4PR4A 5A8GA 4L1WA 3SB0A 2OSXA 1SMDA 4H6QA 2ABAA 4X2PA 2JE8A 3LI1A 4W9TA 1UWUA 4XAFA 1BQCA 1ESWA 4RZ4A 3FAWA 2L5HA 1OY0A 2P8CA 2J7CA 3NQAA 3G3MA 3KL5A 2WSYA 1QT1A 2WPGA 1V51A 3ITCA 3M0MA 1SFTA 3IARA 1J01A 4R33A 3PBMA 1US0A 1DXIA 3LB0A 3LCIA 2BDQA 3AXKA 5D9PA 4W7UA 1W9DM 2PPGA 2X42A 1BF2A 3EEGA 4Y96A 3QC0A 4Z0JA 4JKMA 1PIIA 1VC4A 3EZ4A 3T40A 4JAWA 1YXCA 1SJDA 3EA3A 2GVEA 2TMDA 2Y70A 1XGZA 3QPYA 2WQPA 2VRJA 1UD2A 3S5ZA 4BQ3A 2YL8A 4XTDA 1RCQA 5LIYX 2F9RA 3NEHA 3C0LA 3CMJA 5BXRA 4JQ2A 4HVXA 3ZWTA 3LPOA 4L1XA 2UV8G 1JPHA 3FGCB 4PMOA 1LLOA 4G1NA 1IWPA 3MCMA 3LM3A 1LJYA 2VOTA 1Z89A 5KINA 4ERAA 5CC5A 1XYZA 4IM4A 4JS3A 1NP0A 2Y0FA 5AHMA 4NRSA 2XISA 4US5A 5ABEA 4H8NA 4JIPA 3W26A 1S38A 3D3AA 4TTGA 1HJSA 1FKXA 4QJ4B 1HKKA 2J9XA 2DZXA 3QR0A 4HZ7A 3ES8A 3WLSA 5AHLA 4WX2A 2YCKX 1BGGA 2A4AA 2W6RA 2QCEA 3S6DA 2WZHA 2E3ZA 1ZBKA 4W4QA 1A50A 3V16A 3DU0A 3GW0A 4WDWA 1RCOB 2CHRA 3WNPA 2PP3A 2W27A 5HNNA 1P0EA 4IMEA 3SJNA 3AAMA 1Q6QA 1BG9A 4K1GA 4GQBA 2O92A 4ALDA 1VJSA 4YWSA 4OU1A 3SY5A 1R3RA 1B54A 2OGJA 3DEQA 4B5XA 4G2DA 4UTUA 1C7SA 1UZ1A 2ZDSA 2WM1A 3ITOA 3C61A 3IK4A 2BY2A 1KKRA 4NJHA 4WXZA 2XIJA 5E70A 3MS8A 4D8LA 4DO6A 4N9EA 2TPSA 3UYIA 1XLEA 4QX4A 1VEOA 4HIBA 2OQHA 3CIVA 3K4AA 3TX9A 3VU2A 3UJRA 3LPFA 4ZZ9A 3MCNA 1QHPA 4LPCA 3S2JA 3WLNA 4DI9A 2BLEA 3FAXA 2BOFX 2BY3A 2EO7A 3UERA 4MWAB 2QAPA 3P8JA 2XIBA 1XFBA 3EWWA 5ABGA 4Y6GA 2ZX5A 2QUMA 2P76A 4L6OA 4QP0A 4W87A 2D2GA 1JZ3A 1QPRA 2X2GA 2OEMA 3I68A 5C2XA 3MDUA 3QN3A 1TE6A 4Q33A 5CKSA 3VDHA 3W2KA 4RNHA 3EX6A 1G7UA 1K1DA 4NJIA 2B4GA 3KBJA 2BFGA 2ZA2A 3N3MA 3UT0A 3NO1A 3MKKA 4RKAA 3TQPA 3NSXA 4D8AA 4PA8A 3CMFA 5DN1A 2R9RA 4HPXA 2GQ8A 2Z6JA 1FCBA 4U10A 2PBGA 1KQZA 3R43A 4UTIA 3WQGA 1YPIA 5DY3A 3R0DA 1S2UA 3RYSA 5A69A 4PTNA 1WBJA 3E74A 2OPJA 4M29A 4W8LA 2EG8A 3W7HA 1PAMA 1XYAA 2PGFA 1QBBA 2J25A 2NV2A 3O3RA 1GYLA 4EPDC 3L5AA 1Q4WA 5G2WA 4JTSA 3NL6A 3NL5A 3VE7A 3ARSA 4R7OA 4HA3A 1TV7A 3TXVA 3CHEA 3QBUA 2O9PA 3M9YA 2PDCA 4DBSA 3RIKA 4PUWA 3KE0A 1OK6A 2D20A 4LYQA 5D2WA 3RLUA 4ES4A 1P0KA 5CAHA 5H6HA 1MMFA 2ZVIA 2QUUA 3L4WA 1AW1A 2PDKA 1SR9A 1PYFA 1UJQA 3E9AA 1Z32X 5HA7A 3NNTA 1MZHA 4CQDA 2WZIA 4NY2A 3EA1A 1TQJA 3FXGA 4Q4PA 2PA6A 1XLJA 1GKQA 1GOQA 3KDNA 4FLQA 3ARZA 3ARPA 1D9EA 1EGVA 1R87A 3EKLA 4H9TA 4DEFA 1KV8A 2WPBA 3QFWA 1JCXA 3DHUA 3SRKA 3QMTA 1K3UA 4HN8A 4WRHA 4MYAA 3CC1A 1I4NA 1G0CA 2AAMA 4PRRA 4MPKA 4IICA 1X38A 4Z2LA 1JZ8A 1LL4A 3R7MA 1MNZA 2XVPA 2FZNA 1O5QA 3S2CA 3W7KA 3E02A 1QPOA 4I7VA 1AJZA 2JIEA 3G18A 1LBMA 4A6GA 3KUMA 4NZ4A 4AIOA 3MZNA 2AL1A 4DF1A 5DBUA 1IEVA 1SGJA 2JIWA 4LB4A 3JZEA 1EHNA 1HO1A 3IJIA 4HJFA 4Z1AA 4RXFA 4ZCWA 4UB9A 3BDKA 4AY1A 3CASA 4V28A 4JICA 2GDUA 2FGLA 1JNEA 1UMYA 4F8XA 1GTHA 2GFTA 2FZMA 3SURA 2QQ6A 3AXXA 5C7VA 2PWEA 2FTPA 1KKOA 3ARWA 1WYIA 2G8ZA 3LXAA 2WVTA 1LDCA 3A5FA 3ZFHA 5CC7A 1S2AA 2YB4A 3KBVA 4N42A 4GO9A 3H2MA 4R5EA 3SCVA 3CAQA 1KFCA 3RMJA 4Q8NA 3UR7A 4GQQA 3ZSSA 4UQDA 1D8WA 2H3DA 4D1IA 2E9MA 3TTEA 3ZLFA 4NZCA 1RPKA 2RUSA 4U33A 3GZAA 3SQSA 4A05A 2DZBA 1A5OC 3PFMA 5EY5A 1H7RA 1OD0A 4QAWA 2VX4A 4C7DA 2POTA 3EX3A 1IWBA 4XAPA 3N6QA 3VX0A 1MI3A 4I9JA 1H5VA 4IQLA 2VURA 4O11A 4B2DD 2IUZA 1T8QA 2F61A 1W9UA 4ZQPA 3P8IA 3BMWA 3FYPA 1NVMA 1ZUAX 4CD5A 1RVKA 3TZNA 5IBXC 3KHJA 3ZQ9A 1JFHA 3W86A 4J27A 1P4CA 2WC4A 2V5LA 1KRMA 2QPUA 3VKKA 1B1YA 2E1WA 4IIEA 2IKJA 2XUCA 1RY8A 3QV9A 1VQTA 1V3KA 2QV4A 4CQBA 4CQ8A 1W5QA 2CCRA 2CZFA 3V18A 3ARYA 1W2PA 2E6DA 1Q65A 3H4WA 5DMYA 3NUKA 1K9DA 1UPPA 1W1VA 1UKQA 3FFSA 2Y7FA 1UG6A 4NIRA 3AZRA 1XISA 2WAGA 3MW7A 2QCFA 5GNXA 4HU8A 2RJGA 1YPFA 1YXDA 1OCBA 1JPKA 4OFCA 3SN4A 1OADA 4C1KA 5EMLA 1QBAA 1K8YA 4UFLA 5D8ZA 3OHIA 3W1XA 4QS6A 3CL7A 3PUOA 3OQ8A 4IFKB 1GJWA 4Z1BA 1JUKA 1CTNA 4F2BA 1KBLA 2X0SA 1MW1A 2NXIA 1UR9A 4LXFA 1KM3A 4N2YA 1GJUA 3ATYA 4C6MA 4LW7A 3WFAA 4LS1A 2NWRA 1EYEA 3DC0A 2DU2A 3BW4A 1A5CA 1IV8A 4KRTA 3AYVA 2C16A 2NQZA 4DBUA 4EF9A 1KV5A 1A80A 3NPUA 4PMRA 3K4DA 5HNRA 2PFHA 5T26A 1GQNA 3UGVA 3BLOA 1EWDA 3HFYA 3SUSA 1PZ0A 1UH4A 4JIHA 4P7LA 5C70A 1L8NA 4I7WA 4GO8A 3TVAA 1XBVA 3W53A 1RJQA 4HD5A 2AQOA 4F66A 4ZQMA 2VMFA 2ZE0A 1MVYA 3EGJA 3M46A 2DT0A 2OELA 3C0JA 3DG7A 3GXIA 3PTMA 1CXFA 3CUIA 3DFNA 1H1ZA 3KVMA 2O9TA 2VFFA 3WH5A 4HMCA 5LA1A 4NJGA 2UWFA 1UW9A 4IUOA 4UTKA 2OFJA 1RV8A 2OVLA 3E2SA 2AAAA 1B57A 4H6RA 1E15A 5H2ZA 2VUNA 1Q6EA 4EPKA 4S38A 1IWAA 2Y5JA 4H7VA 1S39A 3TU9A 3VGHA 1HJQA 3MUXA 5L6UA 5K9CA 1HF6A 4B3ZA 1I9CB 3LA4A 1BLIA 4Y9AA 3EWYA 4DXXA 3CAWA 4PULA 2XIMA 2OJPA 1UD8A 4QR6A 2H6RA 3RGTA 4LNCA 3PNZA 2QPSA 2WCSA 1XYFA 3VYLA 1TO3A 4GA8A 1LLWA 1YX1A 3ANVA 1HT6A 4A4AA 1H09A 3HG4A 1GZJA 2Z2UA 3GE7A 4R53A 3JS3A 1XYCA 4MZ8A 1UP0A 4FOJA 1PE1A 4UTTA 4A3RA 1DJQA 1CXHA 1NJJA 2XZ9A 3DXIA 3I7QA 1H7PA 1OZQA 4WDUA 3WLLA 1A5NC 4XIAA 3RLVA 3WD1A 4ICCX 8A3HA 4W85A 3HA1A 1KXVA 5D33A 1FRBA 2OZ8A 3QV7A 5C55A 3VKDA 4RPPA 4Z1YA 1C8VA 4FS9A 2UY3A 3U7VA 1S3TC 5I7GA 1Q45A 4RDZA 5DF0A 4UR8A 2WW5A 2JKPA 1CB2A 4X61A 3VILA 4JGDA 3OHMB 5M17A 2J7EA 3AISA 1W17A 1WZAA 2A3CA 4XO6A 1PXGA 4KW2A 1TMLA 4UCGA 4EXAA 3UZJA 3PBWA 3UJEA 1XF0A 1VKFA 2YOCA 5CJNA 2ZZ6A 2FH8A 4ZO9A 2Q8XA 3CLMA 1SJAA 1ML1A 5A6BA 5FF3A 1U1JA 4TU1A 3GYCA 2ZTJA 3LRMA 5FF4A 2INEA 1B3YA 2QCMA 1G7VA 4JIEA 3LYEA 4LWWA 4XIMA 1LG2A 4LRSA 2E8YA 2ACQA 4KS0A 4QLJA 3QPEA 1ZTVA 2FVKA 1UR4A 2P10A 1FDZA 2Z28A 4N4QA 1C8XA 4DNMA 9CGTA 4MFEA 3FY1A 1UBPC 1X6UA 2OLHA 3DHPA 1PJ9A 4DJFA 1EP1A 2YXOA 3KS5A 3MO7A 4AZHA 1HJUA 1H7WA 1KLYA 3QH2A 3ZYZA 1M7XA 4KIRA 4FMVA 4EPEC 1FDYA 1GKRA 3IUIA 5AYIA 3OG3A 1J0KA 1EKOA 3O1NA 4ENLA 3BTNA 2I7GA 3H4GA 4Q6JA 2KX9A 4GI4A 1Q8AA 4HPNA 1S5MA 3IGSA 1W91A 4M56A 4HNCA 5KITA 3IJQA 4H41A 3CMGA 4W5ZA 3TWAA 3UJSA 3VI2A 3OGRA 3W84A 2BS9A 1Z69A 4GVGA 1XLIA 4O8AA 3QY8A 3FS2A 3EDJA 3CQHA 4LFYA 1CLXA 4P61A 4QIUA 4F0RA 4NX5A 4L61A 4XD3A 5HUPA 5LZLA 2EJAA 5AVNA 1KTNA 4W84A 1YMYA 1F05A 3H2CA 1IXOA 4UOQA 2HXTA 3QXBA 3WMBA 4XSLA 2FHFA 3FA5A 1EP3A 4Z2HA 3OW1A 4H83A 1LM1A 2HPIA 3PZOA 4KWWA 1E4MM 1UOKA 1EYWA 1OG6A 2HWGA 4LY8A 3CZEA 3T4CA 3DZ1A 4AISA 2WLZA 3DGBA 1JCJA 4GIRA 4HZ6A 4ZQRA 1AH3A 2VL4A 2PTYA 2BXYA 4B5UA 1YTKA 3IWPA 4U4MA 3VDGA 1A3XA 3R25A 4PCNA 2G97A 1AH0A 1QPQA 3S1UA 3WDRA 1OFRA 2G96A 3RJYA 2PB1A 1V3HA 1UKOA 3B9EA 2WCAA 3S42A 3VXGA 4LV9A 1H41A 1ITQA 3BUVA 2VGFA 1I1WA 2C1HA 1WXJA 3SUUA 4DZHA 5EL1A 4PMQA 1M5WA 4OBRA 3BG5A 8RUCA 3FA4A 2GQAA 2XZ7A 4INFA 3AROA 3MJMA 2HDJA 3MA8A 3AIVA 3PHAA 3GU9A 1VPQA 2QUNA 2G4FA 2UZ9A 3IGXA 1N55A 4OV4A 4BI5A 1F6PA 3TCSA 4HP5A 2Y8UA 3C52A 4DJDA 1ZAHA 5GVJA 4MJMA 4XK2A 3BLEA 3LCHA 1TWSA 1AH4A 2Z2BA 4N9CA 2QMJA 3SUWA 1H7NA 7XIMA 1A5MC 2ESCA 1U33A 4PB3A 5BRPA 1QK0A 4QJ5B 4DX3A 3L4XA 4XSMA 5BU9A 2QJGA 1D2KA 3ICJA 3HGRA 4GUJA 3FLUA 2FKPA 1VB9A 4KGJA 3L12A 4R3UA 4BR1A 3N9SA 4ZOBA 2BHZA 2YDRA 1RR2A 1T5AA 4C5YA 4NNCA 4S2BA 1LT7A 1Q3NA 1W9BM 3K4WA 3UZ5A 2FZ8A 1W5PA 2W66A 2CPUA 1MQQA 4O17A 3MDWA 2IQDA 4XZHA 1FWBC 4Y8EA 1JDAA 1A0EA 3BV7A 2XVKA 3GZ3A 3W3OA 2X8RA 3A4AA 3MUCA 3UXKA 4XZNX 4J3XA 5REQB 3S5YA 1XBYA 4MDOA 4ZEPA 3B0PA 1JEZA 1IXNA 2DH3A 3P5YA 2XM2A 1SSGA 2VCBA 1MSSA 1U22A 1V93A 4ZO8A 2NLYA 1J11A 2PF8A 2GGIA 5C0QA 4MWAD 4GGHA 5I3IA 5L9FA 1C9WA 3A23A 2PD5A 4ZO7A 3R11A 2RDTA 4IUGA 1MW2A 4JQ4A 2Z7GA 3RN6A 3AWOA 1KWGA 3UR2A 3P62A 2PRHA 1JYXA 5DFAA 1MEIA 5F2LA 3N12A 4FLOA 2Y2WA 3PZUA 5EKYA 2WNZA 1VFOA 4UFMA 4HMNA 1BYAA 4GE8A 5AYXA 1AZ2A 3GBEA 4GKTA 2EPMX 5D04C 2OG9A 5JIPA 1C29A 3T0TA 3W7GA 3LZ5A 1X7FA 4H8HA 2DT1A 1AW5A 3CHFA 1PIGA 4GXMA 1UWTA 5HANA 2VC9A 4RR4A 5J5DA 2CLKA 3NYDA 3T2QA 3P60A 1OQFA 2J7BA 4WIWA 2P1FA 1OVDA 2EG7A 3MKCA 4M1BA 4DAFA 3G1XA 2WZEA 3E0LA 4OUIA 1W8GA 2QJHA 3B3DA 3BAXA 3KAOA 1F76A 1XG3A 2PP0A 3K46A 3ZR4A 1XL9A 3L23A 3UVAA 2O4MA 3VVGA 4BZYA 1GONA 4MJ4A 1CGWA 1KXHA 6XIMA 5HMFA 3ITVA 2Q01A 4ZB0A 4YU1A 4MIMA 1CXKA 1R2TA 1KTBA 3CL6A 3TR9A 3C2YA 3TKFA 3HIJA 4OJYA 4ZBCA 3M47A 1R3WA 2Z6IA 1A5SA 1UP3A 1XIBA 1ZBVA 4JXCA 4IXXA 2ZUNA 3BLDA 4LYKA 2DZVA 4E38A 3UG3A 4K7VA 3ZT5A 1E4LA 1F6YA 1H0GA 4P2VA 1C91A 5CSUA 2CIPA 5F2IA 2CBJA 4JY8A 1H7XA 3VO0A 1EBHA 1F4HA 2NT0A 1SYTA 4PFMA 3W83A 4S3CA 3VD4A 1DIEA 4H2HA 3B8IA 5M3WA 3EDFA 3TWBA 1E4IA 3L67A 1E0VA 1QU4A 2DSUA 3TCEA 2ZX6A 1EIXA 3M0YA 3VIKA 1TA3A 3ZLGA 3GAYA 3PAOA 2X30A 5G1TA 2YJQA 3GFYA 1TPEA 3U2CA 1PKLA 3GIYA 4PC8A 2NWSA 3UU0A 2CLOA 4YXGA 1E5JA 3IJ6A 4AZCB 1GG0A 4QJ1A 1FWNA 2GZXA 3G1SA 1LUCB 4JEJA 2YLLA 4Q8VA 2FJUB 3AMGA 3C56A 3W7NA 2YDAA 4AF0A 3NFUA 3QQWA 4AX6A 4MJZA 1X1OA 4L9ZA 5CC3A 2AKMA 1EJTC 2Y89A 3VIIA 2W5FA 4LTSA 3DBNA 3W2LA 3PF3A 5TBOA 1L6WA 4AEOA 3WD2A 4O19A 1RP9A 4RK8A 4ZB2A 4NAEA 4GY7A 4O4VA 3QC3A 1QCWA 3PZMA 3KL0A 2PDGA 4I6VA 3L7RA 3KHDA 4MKSA 4NL1A 2PDWA 5EGRA 1LROA 2X7VA 3I7SA 3TONA 3WDQA 4D6FA 3H2EA 4QXIA 3GFXA 4CD8A 1QRQA 8TIMA 2X16A 1NSJA 6CGTA 3MTWA 1CYGA 4QRNA 3P80A 2VEPA 4K36A 5DXYA 2OLSA 3L4UA 4R85A 1V6UA 1X1NA 1P48A 3QR3A 1MXSA 1ZJAA 3SCWA 1HVQA 1QHZA 5F2MA 1UZDA 3TN6A 3H7RA 4JYEA 3E38A 3UG5A 3NVDA 3TJXA 1KTCA 4YWIA 3MP4A 3G6MA 3B40A 3HF3A 1GORA 5H8MA 4DJFD 1O12A 1E3XA 3MJYA 1HKMA 3I3EA 3LHWA 3L2LA 4DN1A 1OCQA 5C54A 4MKNA 4CN4A 4G7EB 4WEVX 5D2TA 3UPWA 3RM9A 4K68A 2ZQ0A 4I9AA 1RH9A 1EF2A 2AQWA 5C71A 3GR4A 3WLKX 4HNOA 1YPXA 1QAPA 2WMHA 1RP8A 2OT1A 3TK7A 3W7RA 3R5EA 5HR7A 1RQEA 4KCUA 1SO3A 1KCZA 1BXBA 3A4XA 4A22A 1TTJA 2V5KA 6ALDA 4O54A 2WANA 4OZOA 5I00A 4GJIA 4C6OA 4C6CA 3BAKA 2XG9A 3KCJA 1FCVA 1VHCA 4H7CA 3WNMA 4PUMA 3WF0A 2Z25A 1U1UA 2GSHA 3AUOA 2VFEA 2D0HA 1TCDA 3GHRA 1UIOA 3KP1A 2A3AA 4H8UA 1IR1A 2X09A 1FWRA 2Q09A 5DT7A 4A2SA 1RCXB 1AL8A 2NZLA 1HKIA 2Q71A 4UNLA 4J2MA 3E5BA 5FJPA 4GQRA 3RX4A 3GG7A 1NY1A 3VK5A 1ENUA 4ONVA 4D6IA 3AO0A 2GQ9A 3M0ZA 2FJKA 3CXOA 5LNVA 1GOOA 4MWAC 2R91A 2CBUA 2VC7A 3B9OA 3DYPA 2DORA 3VIPA 3W37A 3LBMA 2XGBA 1XBZA 4Q7BA 3I6RA 4DXKA 5E6ZA 4HPJA 3FKRA 1RJPA 3GNNA 1SZGA 2YZ5A 1Q6GA 1G01A 2OYKA 4O57A 2D0FA 5U7SA 5A6AA 1J93A 4CCEA 1XQLA 3C86A 3OIHA 4HK6A 1KBKA 3AHXA 3WQ8A 3RAOA 4D6HA 1KCLA 2BOEX 3KRSA 1XIHA 4MJ2A 1PUDA 1BPLB 1MDRA 3W9ZA 3WQWA 3T09A 3M0HA 4NJKA 1X6NA 1XV8A 2RKXA 1DJHA 1XWYA 4K8HA 3H53A 2OWCA 3UXIA 5F1VA 3HPZA 2VGGA 3L4YA 4FNRA 1RALA 3SY1A 3LV5A 2BHUA 3WUGA 4Q4OA 1VFLA 2VNCA 1CXIA 3WQ6A 1SPQA 1HO4A 1XRSA 1YIXA 2BSLA 2Y7DA 3BLPX 5EMKA 1EJRC 2XWDA 3GVVA 3NXFA 3PK7A 3APTA 4XB3A 2PC8A 2RH9A 3GNRA 2A5HA 4LALA 3SCUA 2E1DA 4HGXA 5AHIA 1JD7A 4WLCA 4WY0B 4G7EA 8XIMA 3LK6A 2OWWA 3I4EA 4WOZA 1HXJA 3QLDA 5FJJA 3QYQA 4O8RA 1Y5WA 3MUAA 4M3PA 1I0DA 3K8KA 3MY9A 1OHLA 4XZIA 2GWGA 2QZRA 2DUXA 4IP7A 3STFA 2J7FA 4PH6A 3U6WA 3IIPA 1W9XA 4NZFA 3W1QA 3OEXA 3W00A 3DHFA 4E2OA 4B15A 1QASA 3HURA 4L7ZA 2YXXA 2E9LA 3PZVA 2EPLX 3QYSA 1Q6OA 3QHOA 4ZE4A 4NI3A 1H11A 2ZOXA 3EXTA 3GHTA 3CWOX 5HPCA 4PFHA 3V5OA 1E3ZA 1GOKA 3N1AA 2YFNA 3KBNA 2EHHA 2J7DA 3PZQA 2D73A 4NZ1A 3HO8A 2C1IA 4DYJA 4HA0A 2EXOA 1XDLA 4XZLX 1FDJA 4WY0A 4RE4A 5SWUA 3SFWA 5IFTA 5KMYA 4LYPA 2GQ3A 4MLJA 5DX7A 3AHZA 3GFZA 2HE5A 4AYSA 2FZBA 2GGEA 3CBWA 5AYZA 4BY3A 3U5YA 1R3VA 5EMJA 3DFTA 1W1TA 2V9DA 4XD4A 1HL9A 1VFMA 3PPGA 1VFTA 4PN2A 3A5VA 1V6WA 4OE7A 3T2OA 4CNPA 3ONCA 1YW1A 1PKYA 4H00A 4LVGA 3CK5A 5FACA 1U1HA 3WJSA 3NAVA 1E0XA 1PWLA 5T9BG 4IZGA 5G2IA 1XRTA 3CQJA 1OFAA 4JTTA 3W1RA 4O13A 4AZCA 4HCHA 4HNNA 5FL1A 2F2HA 1OIMA 2J7GA 1H4PA 3QPZA 4QQUA 3AU6A 4E0CA 4IFRA 2JF7A 1M9HA 4S1FA 3H26A 2VEMA 4P8WA 1O5KA 4WKFA 3FN9A 3LQGA 1CW2A 2QMKA 2WVSA 1B90A 1E71M 4IMFA 3W6YA 1NAL1 4GVHA 2QR6A 5BWFA 3DX5A 3SZ8A 3ECQA 1T41A 4F0KA 5JVLA 1PTAA 4C1LA 3NQFA 5C9WA 2E0PA 2F84A 3BL3A 3ERPA 1FWDC 3LG3A 4E8GA 5EMUA 2QCDA 1FVPA 4HJWA 3B9DA 5EMYA 1KXQA 1TPFA 2WVUA 1EL3A 4PSRA 1A0CA 1YQ2A 2ATSA 3USZA 3N2TA 2D0GA 3M1ZA 3EB4A 4JFVA 3PWIA 1Q6CA 4ZTYA 1E6ZA 3PUGA 3F5LA 4C6JA 4A8LA 4RZ6A 4JEQA 3SFKA 4EACA 1OZMA 1G4EA 3KP0A 3ME3A 3PJWA 3W75A 2R1NA 3BJSA 3S6TA 2YBUA 4AZ6A 1Y5VA 4C6LA 1DJIA 1RVGA 3VNJA 3TN5A 3HGOA 3QW3A 3WENA 1GEHA 5C8BB 1SVDA 3PBYA 1QXLA 4NX0A 1FWWA 5KZEA 5AOUA 4DJDC 1TZ9A 4A3UA 2Z1WA 1E73M 1TYGA 4X9SA 1SFLA 2CZVA 2IS7A 3ARRA 2VCAA 4BEQA 2PTDA 1PWMA 3AS2A 1T99A 3M7SA 3F4CA 4IP4A 2VR2A 5I79A 1ODUA 2QCCA 1YDOA 5HULA 1A5BA 3CH0A 4PTXA 3TYEA 1K8ZA 2G3JA 4J4KA 1UQZA 3PG8A 2OO6A 2OODA 1DIDA 4NZJA 3F4DA 4WSJA 4WKAA 3HGSA 4KGLA 2E5CA 4PUDA 4GOAA 3II1A 3WG6A 5LKYA 1VF8A 2Y85A 5CZSA 4BCEA 4AVNA 1LQ2A 2VC5A 1TMHA 4H1ZA 1PL9A 5HR6A 3DC8A 3G1AA 3AZTA 4NVTA 4D9PA 4JTCA 2OZ3A 2Q8ZA 4LCSA 4ADTA 3V4BA 4MNKA 5E93A 5A94A 3RDKA 3UR5A 3VIFA 2BASA 2NQLA 3N2BA 2WKGA 4G56A 3OBKA 2V2HA 2TRSA 2PDUA 3R10A 3TYCA 2WSPA 1J0ZA 1AQHA 1ZRQA 3MYOA 2WHLA 4GKLA 3VNDA 1B30A 3VKBA 3UQNA 2ZXDA 3SRHA 2CZ5A 3UFYA 1DQWA 1UUMA 5BOOA 4IMGA 3W7JA 3NQDA 1O95A 1LOSA 1W32A 1W54A 4FNQA 4L4OA 2PRMA 3NQCA 5A6MA 1V4YA 1I2NA 1R3SA 4O1CA 3F2DA 3WK0A 3GXPA 3FYOA 1R9XA 3EWXA 3CH9A 4GD0A 2YA1A 3QW4B 4LBRA 3GXTA 2HBXA 2NQ9A 1KRBC 3OTRA 4UWMA 3O15A 3UG8A 3LLXA 1CLVA 1RLDA 1TKKA 1XRVA 3LDVA 2NX1A 4FXSA 4KKXA 4RNFA 1NWUA 2E6AA 3LN3A 3WEZA 4GXWA 5CSYA 3URAA 4E5TA 2QDEA 4LUJA 3IJ7A 2OCZA 3P14A 3Q94A 3F5JA 1E43A 1C90A 1OC7A 4HYRA 1POKA 2NLIA 3JU2A 3NSNA 1ZJBA 4GUFA 3UJFA 1JQVA 4O12A 5AC6A 1F3XA 4BWLC 3AIEA 3RM4A 1IEWA 4HNUA 4A21A 4HHHA 4BEUA 1ZU8A 4IL2A 4C6DA 2G37A 3WF3A 5H91A 2A3BA 4AMAA 1XGEA 5JH2A 2WNNA 3REQA 4CCDA 1VH7A 5E09A 2BP1A 5C2CA 5ABFA 4C6FA 4XZMX 4L1GA 2DP3A 1EOKA 2E4TA 5F4WA 2PEVA 2P8BA 4Z42C 3M5ZA 4DO7A 4WDXA 1NIUA 2FGZA 4KCWA 3U2EA 2E09A 3VMPA 4I5UA 1E56A 1HP5A 2H9AA 1W3NA 3V3WA 5A8PA 4OIFA 3QHNA 1REQB 4PCPA 1XSJA 3FDKA 4GLEA 5LGZA 1BKHA 2W62A 4XAGA 1XLGA 4NAFA 1E40A 1THFD 2NV9A 2R1MA 2BVTA 3CTLA 3QQ1A 4PCFA 1H60A 3PSVA 3RG6A 1CGUA 2GVYA 3WLOA 4YTUA 3E96A 3AXIA 3FDGA 3HG3A 4B4HA 2Q3OA 2OQYA 2C7FA 1XLMA 3C8NA 5DMNA 2ONEA 1I2PA 2OGYA 4PYSA 3WQ5A 2ZRVA 4K6AA 1O5RA 4R9OA 4UQAA 4XAZA 1HFBA 3BLFA 4IGHA 2J8GA 3QM3A 3SN1A 3N19B 4MOZA 1B4EA 2PTXA 2A0NA 1GYNA 4LT9A 2X41A 4LQ1A 3RCMA 2HROA 2W67A 1EXBA 4HOZA 1NTHA 1TRIA 4J28A 1XICA 3UWEA 3BCFA 4Z0SA 4F2UA 4M6VA 4BS0A 4X60A 1F4AA 4DBEA 3SCRA 4FXFA 1XG4A 3V35A 1AG1O 4KEUA 4U3AA 1J79A 2C0AA 1VGAA 3SGGA 3WLPA 1F73A 4F2TA 3C0SA 5F4XA 3RLGA 4DPQA 1OM0A 4A3HA 2ISWA 4QE1A 1Q7QA 3FJ4A 4E2DA 5D9MA 2R1KA 3MPGA 3VNMA 1ISVA 3C0QA 1LOLA 3QFEA 2C91A 1BYCA 1CXLA 1ZLPA 1EP2A 5AN7A 2QJMA 1ME8A 2O7SA 3D46A 4JHOA 4IWWA 1J5TA 4JIRA 2P5NA 1NDZA 2TSYA 5A8MA 4MY9A 3OLIA 2D1ZA 3LPPA 1F6KA 3OZOA 3TAKA 3SCSA 2EGZA 1OIFA 5LNSA 2MUCA 2CLHA 4IPNB 4A3QA 3SSZA 4EWJA 5CLWA 3PN8A 5LNWA 1X1ZA 4ECLA 4AVOA 3VUSA 2FVLA 3VMNA 4RDVA 5DCDA 4LEQA 2BGQA 5GJPA 1IYXA 3WQDA 3KS6A 1JRBA 2WKLA 3NG3A 4KETA 3H23A 1MNSA 2A7NA 2OKTA 3RCYA 1EF3A 1IEXA 3CHVA 3TJ4A 9XIAA 3DOPA 4JYDA 1VYPX 4YHGA 2ZX9A 4QNEA 1IGSA 3LS9A 3TW7A 1Z7AA 2VEGA 1GOIA 1C8YA 1UD3A 3BVJA 1R5YA 4DZIA 3IIZA 4WHBA 1AMKA 4Z2GA 3V5CA 3VUPA 3NQMA 3SCPA 4PMUA 3AFBA 3EB2A 1FUYA 5KEZA 4QSHA 3LV6A 3W4RA 5JBEA 2PAJA 4KEMA 2ZRWA 1TPC1 2OSYA 4GIAA 1ICPA 3I6TA 1BAGA 3ZZ1A 1BHGA 4E2BA 2D22A 2UY5A 1EB3A 1M03A 4Y9PA 3USBA 3U8GA 3AIRA 4QDPA 3DFYA 5CGQA 1K9FA 1B9ZA 4J35A 5I3GA 3EOLA 1UA7A 4CNOA 1FXPA 5ECVA 1RJRA 5IDIA 4AY8A 1VBHA 2PDJA 3HFTA 3B8VA 2QVHA 1Q66A 1D7KA 4IOTA 2MANA 2NSXA 1WDRA 3RR1A 4ZOCA 3WNKA 1UKTA 3WD3A 2OWXA 4BKNA 1JPIA 2YCJA 3BSGA 3A6OA 1XLCA 1TELA 3WBYA 3DFHA 3GC5A 2ODOA 1BFNA 3IRSA 2B81A 2DIKA 1QTWA 3W7CA 1F7BA 1M1BA 3TNBA 2NUYA 3VGBA 1CLKA 3M0IA 4GFSA 4DYKA 1W1B1 2CLIA 3TYAA 4Q8WA 3UYCA 1SO5A 4AD1A 3XINA 4RXGA 1RA0A 2AMXA 3APYA 1L8PA 2YFOA 4HNTA 4JTEA 2CLFA 4PTWA 4HYVA 5LNUA 3DFOA 3AWNA 1JGIA 4Q22A 4Z1DA 1XCFA 1V79A 1LBFA 4GPNA 3PWGA 3S6OA 1JUEA 4TXEA 3WMLA 4IXHA 3NZGA 5JIWA 3PPFA 3GIPA 1FHVA 5DMMA 2DJXA 3N2OA 4DUXA 5HMEA 2V0TA 1R47A 1H49A 1JRCA 2ZWYA 3T05A 3LBOA 2PSNA 3P67A 4UUIA 3W27A 1J0JA 3S1GA 4JQ3A 3STGA 4QS5A 2PCQA 3BLKA 4FR1A 4Q4QA 1PO9A 2PDHA 3AICA 3MANA 4JN7A 3KL3A 2PDMA 1EA0A 4G6CA 1MYRA 1NQ6A 1QNQA 4DIAA 1UB3A 1KM1A 1SQ7A 1OFOA 3MB9A 4HA4A 4XO7A 1QUMA 3UCQA 4TO8A 4OBSA 4UBPC 3KOZA 4N9BA 3NR0A 2GJNA 5G2HA 2BTMA 4UR9A 4IFOA 2R24A 3SR7A 4MNJA 3UW6A 4JTGA 1L6FA 3IK2A 4GZIA 5A6LA 4UTWA 3S2MA 1UC4A 4S3KA 4JNYA 1PIFA 2F2KA 1QFEA 3IIVA 3B8WA 1F3EA 3W29A 4PUEA 5ECUA 3HZ3A 1FHDA 4BQ2A 1X6LA 2Y1HA 1IHIA 1TG7A 1H51A 1MW3A 4REQB 2QCHA 2V6AA 2CNCA 2DQXA 4ZQOA 2BMBA 5G1YA 1RY0A 4IPIA 1I0BA 2C79A 5IBXA 1TJRA 1B3VA 4WOQA 5AC7A 2V82A 5HXMA 3AS1A 1AQ0A 3CGTA 3WIJA 3LENA 1LWIA 4Y2WA 3WO8A 4JIQA 2QEZA 1G6CA 4ADSA 3SBFA 3C2EA 1UZ4A 3DBPA 5A2CA 4KFNA 1IZKA 3G0XA 4G7FA 2CW6A 4XKMA 4FF7A 3JUGA 1XLLA 3KBWA 1OBAA 2DW6A 1W3JA 4M5PA 4RJEA 4S3EA 3OYZA 2BOGX 3TQKA 1S1RA 1VPXA 2GJPA 3CWNA 3WX7A 2QULA 2PDFA 3AUJA 3CQIA 3GKAA 3V0SA 3DESA 3P6LA 4C1NB 4PEKA 5KZMA 4X0VA 2XINA 3VOHA 3UR8A 3W2NA 1EUAA 3S9ZA 4IX0A 1R0MA 1TR9A 4KMQA 4PMYA 1LBLA 1TR1A 1XJBA 3TJLA 4AVFA 5C9ZA 4EVZA 3R79A 1XIDA 2I5QA 4CVWA 7ENLA 2Q8LA 2VGIA 5JXQA 3OYXA 3CZGA 1EPXA 1QATA 1G69A 5EMMA 4D8ZA 3ISIX 1UP2A 3GNXA 2HZGA 4AAJA 4JX6A 1P5BA 4M19A 3T78A 3F4NA 1S2WA 5CPSA 3UY7A 1AD4A 3GDTA 3BO9A 3URBA 1KW1A 1Q2RA 1F61A 3R0UA 5CZJA 2ACSA 1ZENA 4UOJA 3BSMA 4L65A 3MZ2A 4OT7A 5TD4A 3QHMA 2OB3A 3IACA 3OA5A 4GY1A 2VELA 3N11A 4R27A 3HQPA 2NT1A 2A3HA 4I3GA 3P0XA 5CLTA 3H2OA 3AZSA 4AXNA 4TR9A 3WQ4A 1V77A 1TX2A 5HJXA 5JBFA 2AOSA 4L4MA 1S5VA 2YKKA 3TROA 4H9MA 3ARQA 3OVQA 1D8CA 3KRUA 3AALA 1FXQA 3U4FA 2D2OA 2ZZ3A 2H9AB 4ZXOA 1KCKA 3OBEA 3TE9A 4R88A 1A53A 1JR1A 4C65A 2WXDM 3NZPA 1M6JA 1UWQA 3EPMA 4J1OA 1F8MA 1VBRA 1JL8A 1FFQA 1J5SA 3FOKA 1OJXA 1PDYA 2H8ZA 4PMVA 4MADA 1GYMA 2AKZA 4GISA 1HJVA 4QHRA 3QZEA 4GI8A 5ABFB 3G8RA 1POJA 2ZUVA 3CLWA 2F6UA 3MVTA 5E6YA 4O10A 4FF5A 1R3YA 4I8YA 3S2NA 9XIMA 1EC8A 1ZNNA 3O05A 4HHLA 3WLHA 3WBEA 2A79A 3P84A 3DDMA 1UWRA 1BKSA 3WLQA 1F2JA 1CPUA 4FO4A 1OFDA 1DJXA 5D4YA 1TVLA 2BBFA 2D2JA 4URIA 2NSOA 5AVHA 1ZB5A 4IJRA 2V3FA 1ALDA 1LYXA 2ZBTA 4IJCA 3ZT7A 1XHGA 2WSQA 3NSMA 4D6GA 2DIJA 1SZRA 3IGHX 1XLHA 3W73A 4DYEA 4P8XA 1NDYA 1BXCA 3IEBA 3UZWA 4M8UA 4M82A 4UC5A 1NOWA 1OFQA 3WJYA 3I4KA 1QI4A 1CX9A 1HZYA 4J3TA 1R3QA 3IPWA 5EU9A 1RBAA 5HAOA 4F40A 4DY1A 4DJEA 3ZIZA 4TMCA 4UZUA 3W1MA 4LBUA 4AG0A 1XUZA 1A3HA 3H12A 3EKZA 1KGUA 3WZ0E 1GGOA 3CPRA 1N8FA 3VKAA 3T7VA 5A6KA 2Z7KA 1ZAIA 2J7HA 1TA3B 4QROA 5DQPA 3Q2DA 3WQCA 1ISZA 1VJZA 4FHAA 3UWUA 4BK9A 1TFVA 1RLCL 4JL1A 4P7OA 1FFRA 3A47A 1EXPA 5D2VA 3IUHA 1WDPA 3F4VA 5H1WA 5A2AA 3RX2A 2CERA 1L2UA 3MHGA 4C5ZA 4U5KA 3MO4A 2VUYA 4DHGA 3B03A 4IIFA 3FGCA 1WA3A 5CH9A 3W71A 4MZ1A 4UTMA 4EOUA 2VDGA 4RLIA 1J0HA 3L0KA 1X7IA 3RK8A 3DI0A 2CLLA 4MB1A 3AHTA 1H2JA 1GHRA 3NO5A 5D9OA 3QZAA 5AHFA 1VEPA 3E2VA 4RX0A 4UIOA 4LBSA 4U5IA 3FEMA 3NGFA 1ZSXA 1J18A 5D05A 3W07A 3HQ1A 3UWWA 1GUVA 1XR2A 5REQA 2JGQA 1W2VA 2WOQA 3BXWA 3N4FA 4KWUA 5DELA 5CBJA 2WQDA 3LHUA 1UH2A 4M0XA 5BNKA 4QNWA 2FHCA 4H2CA 1YRRA 5MKGA 5FCZA 1FOBA 3ANUA 1XLFA 1ECEA 3VC6A 1ECQA 1SW7A 1E6NA 4XBJA 2IXVA 4NHVA 2WJDA 4I8DA 2SFPA 2VEIA 3N29A 3NO3A 3DG3A 3UBPC 4MM1A 3VNZA 3WDIA 3ZJKA 2QDHA 4MDPA 1XUUA 5CAKA 3WBAA 4Q8UA 4ATLA 2WSRA 2NVCA 2VZUA 4AC1X 2NQHA 5A2BA 4UMCA 1DPMA 2NQJA 3EDKA 1XYLA 4MG4A 3B04A 1TUXA 5I0DA 4PMNA 1WB0A 1VBUA 1Y7VA 4I6KA 1DBTA 1FX6A 4E8CA 1NFPA 4D6CA 2VVNA 4GNJA 1REQA 3SCNA 4JHZA 2J8TA 4Y9NA 2GDQA 3W2UA 2DV0A 1TWZA 3CL8A 3CO8A 5C7HA 4PB4A 2EF9A 2ZUTA 4GZJA 4K3ZA 3MKVA 4GVIA 3WCZA 3W1AA 4G9PA 4ATWA 5F4SA 4N0RA 3ITTA 2QCDB 2A1YA 3VTRA 3OG2A 4CD6A 2PRLA 2X05A 2PMQA 3L4TA 4Y9OA 2QIIA 3EDDA 1FBAA 5BMWA 5FJIA 1Q13A 1VEMA 3RR4A 3QY6A 4H9XA 4BFAA 2R94A 2WB5A 4FX7A 1QWGA 3TA6A 4K2SA 4XBSA 4BJHA 2JF6A 1TQXA 4S3DA 4BF7A 1BVNP 7TIMA 2PC4A 1AVAA 5BOFA 5T8GA 4UQBA 3WK3A 1MO0A 1DYSA 1JJKA 3A3XA 2JK2A 3CQKA 3GTXA 3R1ZA 3W1UA 4H6EA 3RO8A 3VGDA 1J6PA 1SM9A 4JTKA 3GDKA 5CGTA 5CZ0A 2TAAA 3R8RA 1LZOA 2X1TA 1GNXA 4AW7A 2VR5A 3P82A 3FVDA 4IT1A 4ZA0A 1SU5A 4G8TA 4IGNA 4AFYA 1KFBA 4UFIA 1UC5A 3MBDA 4EAYA 2W91A 3NZRA 5FEZA 4ADUA 3WQFA 3ZJ7A 1Q6FA 3W22A 4E3VA 1BWKA 1AUSL 5F7UA