3G1FA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydroorotidine 5'-monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
220
Chain Sequence
VDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 77
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1fA00
1FDYA 3FS2A 1MO0A 4MFDA 1IIHA 1LBLA 1DHPA 3STEA 5EMUA 4PFMA 4N02A 1W5PA 2NX1A 3NPVA 2HSAA 3TSBA 1KTBA 5FEWA 3LCGA 3HJZA 3IIOA 8TIMA 4R33A 3NG3A 4UC5A 1S5VA 4JN6A 4E38A 3TE9A 4DXVA 1EIXA 4P2VA 3O6CA 4UTHA 5F1UA 5C2XA 2WV8A 3W70A 5AHNA 2LLEA 1VGAA 4I7WA 1XUUA 2TPSA 3ABOA 5K4XA 1ML1A 3FEMA 3W1AA 1LDCA 2JK2A 5HR6A 1ZAIA 4M19A 2YFOA 1TREA 2G5WA 1YTDA 4LVGA 3PBUA 1JQVA 2NXHA 3DAQA 3PB0A 1Z42A 4O8RA 4QNWA 2DZTA 1KA9F 1RZMA 2QCDB 3UD6A 4RK8A 5DCEA 3FJ6A 5DXXA 4NJIA 1F6PA 1W5NA 4ADSA 1AL7A 2H8ZA 4M6PA 2HTMA 2YSWA 4O15A 1FWSA 4FNPA 4Y90A 1H7PA 3GKFA 3TDFA 3NQ6A 4K7YA 2QCDA 3B0PA 4O1BA 3P5ZA 4BK9A 3TSMA 2F84A 1TPFA 2GQ9A 4BFAA 1TRDA 1G69A 1TV5A 5KZDA 2X1TA 3GAKA 3CT7A 2VKZG 3OBKA 3CEPA 3IVSA 3B05A 4X3ZA 4AWTA 1KLZA 5EBUA 1Z44A 4ADUA 1KM6A 2ISSA 3P7YA 4KWWA 4H4IA 4PA8A 2CLMA 2ZZ4A 5D32A 1P0KA 2YFNA 5HWJA 2E1DA 5FEXA 3IRDA 4H3DA 1TPEA 4Y96A 3WJWA 3RLUA 3GKAA 3PC0A 4GJ1A 4O28A 3NPWA 5AC6A 4UR8A 1SZGA 2E6YA 3GYEA 4FX8A 4PC8A 2FPTA 3EWXA 4XQ6A 4XKYB 2C15A 5DELA 3VKJA 1H7NA 3QMTA 3MP4A 2NLIA 3I6RA 4DQWA 4JTSA 4RXFA 1ME7A 4HIBA 2ZZ6A 1EA0A 2X1RA 2YYUA 1W0MA 3DZ1A 5I3FA 1P0NA 3HO8A 2NX9A 3W1RA 1HTIA 5ABTA 2DORA 3WK3A 4RCXA 5AHMA 3NQFA 4JTUA 1F05A 4FEZA 1LTDA 2UV8G 1AW5A 2Y61A 4CNPA 2VFEA 2FB3A 1TTPA 1QFEA 5EL1A 2EPHA 3W2NA 4UTJA 1GYLA 3G1DA 1OK4A 1GQNA 2CLFA 4HNVA 1VC4A 5HQEA 4UTWA 1ZAJA 3FKKA 3RK8A 2VFDA 3W74A 1C8VA 2NXIA 3G1XA 3N9RA 4W9TA 3BK0A 4PCFA 1H63A 5U4NA 3EWZA 1XBZA 1OFEA 4RX0A 5LGZA 4M5PA 2YW3A 3LCFA 1W3TA 3NM1A 3L66A 3D0CA 5GVJA 3OA3A 1NF0A 1B4KA 3L67A 4ICNA 1MEIA 1LRTA 3DKJA 4N4QA 4JTKA 4ONVA 2AQWA 5D2TA 1FCQA 2ZRUA 3M9YA 5F4XA 1W5MA 5HNRA 3NDOA 3SJ3A 1LLZA 1R2TA 3W7RA 3F03K 4R34A 2H6RA 3NM3A 4O12A 1XBYA 3S0CA 3SSJA 4GUHA 2A4AA 4C1KA 2WNQA 1T0OA 4BI6A 4Z0JA 4LVDA 1LORA 1AK5A 3NL6A 2V5LA 4JGDA 5E1QA 1TQXA 4NNBA 3CB8A 2WQPA 2JKPA 4N2YA 1BWLA 3DI0A 4QSHA 4O14A 5AOUA 3ANYA 3NA8A 2DJXA 2VFHA 2CW6A 1GZGA 3O07A 1LRNA 1G67A 2FB2A 2WKJA 3HG3A 4UXDA 3M43A 3UYCA 1PS9A 4QIUA 3ZWSA 3A9IA 1UUMA 4PH6A 4M7SA 2GJNA 3NQ8A 3NQVA 5FF7A 4CCCA 3KRZA 1SUXA 2BWGA 1KTNA 4X9SA 2J9XA 1L2UA 4S1FA 2E6DA 3NQCA 5CSSA 3LBCA 5D2WA 1XM3A 1H1ZA 1W8SA 2ZYFA 1H7WA 2P1FA 3IGXA 4OQVA 1EWEA 1DORA 3QSTA 1GVQA 1VLIA 2B0MA 1WBHA 4FXRA 3SECA 3B0VC 2C14A 1Y0EA 4OE7A 1TPVA 3TCEA 2YGYA 3BG5A 3IIPA 3QC3A 1RVGA 1VRDA 5K4ZA 3O63A 4IPIA 4HNNA 2PRHA 3N9SA 1T8XA 3NNTA 1TTIA 5SWUA 3R8RA 1BWKA 1IXQA 3LDVA 1P5BA 3H54A 2V81A 4G1KA 3UPWA 3UWUA 5IBXC 1I2QA 1UBSA 3MHFA 1TMHA 1XXXA 2ZRWA 5T26A 3KVKA 4AF0B 3BG9A 3C0JA 4ZZ9A 1W5OA 3NPUA 4Z08A 4NX0A 1KM4A 1WOBA 1AMKA 3TFXA 3PF3A 3TKFA 5D09A 2X16A 4JYDA 1I2NA 4RLIA 4LUIA 3O6DA 1K02A 2V2HA 4U28A 3BARA 1EWDA 3S1WA 3P5YA 2P0OA 3GNDA 4WJEA 3USBA 1TTJA 4TR9A 3HQ1A 1JRBA 4AEOA 3HBLA 2KZHA 1FQ0A 3W7JA 1M7OA 3KVJA 3MYOA 5AFDA 2EF9A 4Z1BA 2GUUA 1JJKA 1PVNA 3W2JA 4AMAA 5DCBA 1TYGA 1QMLA 1Q45A 4MPQA 2GVGA 4NT0A 3THAA 3KVMA 2QDGA 3O05A 4CNNA 3HPSA 3CIWA 4K8HA 1EP1A 1VYPX 4JTJA 1WA3A 1NSJA 1YPIA 2FQIA 3TAKA 3PUDA 2Y7EA 3S5NA 3PSWA 3BW2A 3YPIA 3VNDA 2DP3A 2B7QA 3EWWA 2R91A 3MI6A 1L6YA 4JTHA 2A6NA 4NJGA 1ICSA 3DFSA 3M5YA 4O4VA 4NXSA 3TUUA 3TNOA 2JKAA 3M16A 2R8WA 4RZ5A 1Q6OA 4XTDA 1ZNNA 4CQ8A 1WQ5A 5LNSA 3INPA 4JTLA 4XWUA 5FEZA 1K7FA 1KBIA 4QQ3A 1W3IA 3M1ZA 2ZZ3A 4JTFA 2VOMA 5AC8A 1VHCA 3MP5A 1LM1A 3G1HA 4MLRA 3Q37A 2Y89A 5U7SA 3SIZA 1P4CA 2V2CA 3F4NA 2DZWA 3GAYA 2AGKA 5C54A 4AWUA 3NAVA 1Q6QA 3C8FA 1O94A 4MZ1A 3W85A 2E68A 1R30A 3NOEA 5EY5A 5BRBA 4FNUA 3N19B 1FCBA 3W7IA 2J6XA 2A7RA 2YR1A 4Q4KA 3LCLA 2QCGA 4O1CA 3BO9A 3NYZA 4ZMGA 1T99A 1DVJA 5CZ0A 4YWIA 3L5LA 3EKLA 1WOAA 4JTGA 4HNTA 3FKRA 5KSWA 3S5ZA 3TFCA 1MEHA 2E6AA 4XUGA 3NXFA 1OF6A 3TXVA 3PS7A 1JQXA 5DXYA 2NV1A 3PY2A 3C2EA 3LBMA 4GFSA 3A5FA 1RPXA 3G18A 2VFIA 2ZTKA 1FDZA 4AHOA 1OX4B 2VEMA 5AHFA 2ZBTA 1ME9A 4MVAA 3JS3A 2R94A 1TIMA 3W7KA 2XN1A 3TC6A 4ZQCA 1H62A 4NQ1A 4UTLA 4LC8A 4NJKA 4TX9A 3Q2DA 1VYRA 2V30A 2ZRYA 4FO4A 1PL9A 3GDTA 3ABSA 4GRSA 3EEGA 4EWND 3NQMA 1YXCA 3LLDA 4O50A 4IWWA 3A24A 5DCDA 3STCA 1ZHAA 2CLLA 4FIQA 4KFPA 5F2LA 2H3DA 3B4UA 2CZ5A 1AL8A 3R5EA 3MBFA 1IXOA 2ZA3A 2EGZA 1ICPA 3CTLA 3TQ0A 3L5MA 1I2RA 1GTEA 3M5XA 2YDAA 3W88A 1NAL1 3GIYA 1EX5A 1GJPA 5D37A 1H7RA 1FWNA 1I2OA 4DF2A 3OVPA 3W7LA 4AF0A 3W1XA 4UTKA 1TB3A 1ONRA 1KV8A 3TQVA 1JUBA 3C2FA 1OFRA 1J5TA 1V7YA 3PB2A 2W0UA 1JR1A 3R12A 2Q3OA 4DBEA 3RNDA 5D05A 3I65A 4JX6A 1ZY9A 2VEKA 1THFD 3KOFA 3UWQA 4WOQA 2FIQA 3M0ZA 4WQ6A 3HOJA 3NQEA 1QPNA 3TW7A 3M47A 4JIPA 1TSIA 4MYXA 2EHHA 5D2VA 2Q8ZA 3BG3A 4Z0SA 3P61A 1XBXA 3QM3A 3RU6A 2TSYA 1CX9A 4IMFA 2XN0A 1CI1A 2XN2A 4EVZA 5DN1A 1LBFA 4JDBA 1VCVA 3EWYA 1M7PA 5H91A 5C55A 3V75A 1K8ZA 1LOQA 1Q3NA 1TJPA 3TIMA 2JKEA 1W54A 2VELA 3QSRA 2XFWA 4RZ4A 2X1SA 4Q33A 5J5RA 2ALDA 3O15A 3NQDA 4LT9A 3ABRA 4HN4A 3U8GA 3HG2A 5KZEA 3O06A 1DQXA 2Z0IA 4DPQA 2RHGA 2Y6ZA 3TH6A 3NZRA 1WAUA 4XZ9A 3VI2A 2QJGA 4C1LA 2GVLA 3P8JA 2BZNA 4FNSA 3P80A 1JUEA 1OX5A 3W76A 1GYNA 3T4CA 4DO6A 1GVOA 5CZTA 5E93A 3STFA 3HIJA 1TTQA 3DENA 2ISWA 3S8HA 1LCOA 3TX9A 1MSSA 3PSVA 7TIMA 1LBMA 3QZEA 4NZFA 3C52A 2A2IA 3QYQA 4CNOA 1GOXA 3G0XA 1ZALA 4LY8A 5KMYA 1A50A 3EWUA 1J2WA 3LV6A 1JUKA 1FCUA 3GZ3A 3IEBA 1PV8A 1LOLA 2NWSA 3MMTA 2W6RA 2E5DA 3QW3A 1H51A 4NXKA 1D3GA 4LTSA 1RQHA 5D03A 2E5CA 4ZQPA 5E0KA 2TRSA 4Z1CA 3P60A 1JRCA 1WX0A 1EB3A 2OMAA 1F74A 4KFOA 1PHWA 4H6KA 3E02A 4JYFA 5A8GA 3LCWA 1HO4A 4U4MA 2DZUA 4PL1A 2YXGA 5EYWA 3ELFA 1QO5A 3CU2A 3BW4A 4DEFA 1Z41A 4TMBA 5CKSA 3UPBA 3GXNA 1Q6LA 4LS1A 3W1UA 5HINA 1WBJA 1G6CA 1K03A 1F5ZA 4MFEA 5FF3A 2EKCA 5AB3A 3TW6A 4WOZA 1KM5A 3LXBA 3P67A 3LHYA 3I7SA 4MYAA 4UFMA 1PIIA 3E9AA 4WUIA 1VS1A 1SR9A 1TPH1 3NL5A 4JX4A 3FA5A 3BW3A 4TU1A 2Y85A 1HG3A 3TA6A 4K38A 2C16A 3OIXA 4UNLA 4FB7A 1QO2A 2GQAA 4QNEA 2WPBA 5CPMA 1F73A 2BXVA 1HO1A 1AG1O 3NQAA 4IMDA 4MY1A 1KFJA 1GG0A 2FPVA 4JY8A 1JCNA 1GPWA 1OABA 2HS8A 2O7QA 5K9DA 1D3HA 1IF2A 3HMJG 5TBOA 4GUIA 4OBTA 5LGXA 4M6QA 3P81A 2ZFAA 5EA9A 1R46A 3PBWA 2C3ZA 1Z48A 3MW7A 5AHLA 3DGRA 3SW6A 4BR1A 3EX6A 5BW6A 5AN7A 4JIQA 5F4WA 3ABQA 1YTKA 2GJLA 4O54A 1PHQA 1NFBA 1YLVA 1H7XA 3KRUA 1XDMA 3HGOA 4O4WA 4B5NA 1YTEA 1U5JA 3A5VA 1LYXA 2NZLA 4O1DA 4BWLC 4MKNA 3W7MA 4ZVJA 4GUGA 3HGJA 4NNAA 2NUWA 3WK1A 4FF7A 3LCIA 2FLIA 2QKFA 3HPXA 4L4LA 3NQGA 2C19A 5J5DA 3G0UA 3PAJA 1KFEA 5I3GA 1FX6A 1JCMP 4D2JA 3CEUA 4LVAA 1K7EA 5DLCA 4FNTA 1XDLA 6TIMA 1W31A 4NUWA 4E0CA 4Y9AA 4IJBA 1IGSA 1LLWA 3W1PA 3LRMA 3WJXA 4NZJA 1XI3A 3PBVA 4JTTA 2OZ0A 4O17A 1OFPA 4ZQMA 3W3OA 2IQTA 4TIMA 1DL3A 5HWMA 3C2OA 2YYTA 3EB2A 5HMSA 5D2YA 3PM6A 2QR6A 3ZWTA 2RDUA 4O10A 2ZZ5A 4POCA 2ZCGA 1KFLA 3SZ8A 2CLEA 1O4UA 1UB3A 1YDOA 1TPB1 3I7RA 5KTLA 3P84A 2F7FA 3FIGA 2TYSA 2PRLA 1KM3A 1H50A 1VCGA 5LNWA 4NX5A 1SO6A 1MEWA 2C0AA 1X6UA 3G24A 3N2MA 4FNQA 3W7EA 4KWVA 1O5KA 3DBPA 2QJHA 5HUPA 3DI1A 1FXPA 5LKYA 3TU9A 1LRQA 2ZRXA 2Y88A 5KINA 3C3NA 2QUTA 3W7HA 3SI9A 1OJXA 4HNUA 2FDSA 3QH2A 5LHEA 4GUFA 4O53A 4WY0B 1QDSA 3L2IA 4JNMA 4K8EA 3B03A 1C29A 1M5WA 5CGQA 3K30A 4LWWA 3W7QA 5I3HA 1TCDA 3N3MA 1KM1A 2ZA2A 4A2SA 2ZDRA 3FOKA 4NNCA 3DHFA 1OHLA 1SFLA 2ABBA 5BMWA 3IVTA 3MHUA 3W2LA 2CWNA 3LOTA 4MZ8A 2J88A 1E51A 2C1HA 4ZL1A 3TQKA 2BTMA 1WDWA 3LTPA 3UWYA 1OFAA 3GDLA 3LRKA 4J9JA 2OX1A 1SQ7A 5F2IA 4EF9A 2ATSA 1SU5A 4TMCA 3QMRA 1GVSA 1QOPA 3CQ0A 3BGGA 3S6DA 3MHGA 1ZENA 4P61A 4LOCA 1YYAA 4PTNA 3G3MA 5AHEA 4R7JA 3OHIA 4JR5A 3G8RA 4DO4A 3MYPA 4NU7A 2WO5A 4M7TA 3LV5A 3G1FA 3OG3A 4JS3A 3N14A 1DJNA 3M5VA 1BEUA 1H5YA 3DXIA 1MXSA 1C9DA 3UXDA 2YCEA 1TPUA 5F2MA 1UASA 3KRSA 3B04A 1OVDA 1EPXA 3DFTA 2H90A 3KHJA 2B7NA 1L6SA 5HR7A 2VXNA 1IXPA 4BF9A 3O1NA 2NUXA 4O18A 3I68A 2Y63A 1LOSA 2E6FA 3B0UX 1FUYA 4YL2A 4RXGA 1JCJA 4K37A 1LZOA 1B9BA 1TV7A 3W1NA 1KM2A 1SO3A 2DU2A 1JULA 4A29A 4XBSA 4L4MA 3C2RA 2FPYA 1DBTA 1ICQA 4FNRA 5BOOA 2QCFA 3CM4A 4UTWC 3G3DA 3DH7A 1HFBA 2ABAA 4JEQA 4EOUA 1K3UA 2QCEA 4JTEA 3PG8A 1ZAHA 3LHVA 3W7OA 1FY6A 2A5HA 1XKYA 1ME8A 4QAIA 3W1MA 4EF8A 3MBDA 3MO7A 4JY9A 3KXQA 3S5YA 5DY2A 3GXTA 2DZPA 2GPTA 3W1TA 1I45A 2FTPA 2CLIA 5F1VA 2VFFA 4HHPA 3M44A 4IXHA 1YDVA 2X1UA 1TPWA 2X2GA 3LRLA 4ML9A 4O16A 4HPJA 1G7VA 3F1QA 1JVNA 4GNJA 3W71A 3ZR4A 3IIXA 4LW7A 3EX1A 4OWGA 1SW3A 1UJPA 3W1QA 3B06A 3BLEA 3W23A 5I3IA 3PG9A 1F6KA 3O6YX 1BKSA 2PRMA 3SR7A 1FWWA 5HULA 4OU1A 2ZZ1A 4DELA 3HG4A 5KZMA 3CLMA 4NJHA 3S1XA 1OFOA 3KX6A 3RLVA 3KFTA 1TRIA 1TV8A 4Z1DA 4MUZA 4A22A 1DKWA 4FX6M 2RKXA 1PE1A 4RV8A 1K7XA 4FXSA 5AYZA 3EWBX 4O0ZA 4UFJA 3W7DA 1G4TA 2Y62A 1XL9A 3IVUA 4IMGA 4AH7A 1GVFA 3IGSA 5C5YA 3LM7A 1XC4A 3JR2A 1JCYA 2A85A 1XCFA 4OGZA 2A21A 1H7OA 2NX3A 4ZQNA 1W3NA 3OEXA 4CQ9A 1S5TA 1A53A 4UTMA 3LHWA 4N9CA 4YXGA 3H53A 1W5QA 1SZFA 3DKLA 3FFSA 4DF1A 5CZSA 3A22A 4NVTA 5D30A 3MP3A 3W2UA 2NUYA 1O60A 1N55A 3BPWA 1VLWA 1FBAA 3NQ7A 5FESA 2CLHA 1YXDA 5BNKA 4ORIA 1OX4A 3N34A 2CU0A 2FJKA 4RR4A 3T44A 4OV9A 4O52A 5L9FA 1W37A 2RH9A 1X7FA 3GXPA 2PE4A 3T55A 2WSQA 3C61A 3WJYA 1G4PA 4QISA 1R2RA 2YW4A 1FWTA 3TAOA 1YPFA 2AAMA 2G97A 2V9DA 3UNDA 3OVRA 3BV4A 4CLMA 2OJPA 1LP6A 4OHQA 4RZ6A 4IX2A 3WK0A 4HSOA 3L21A 3BLFA 1OFBA 1N7KA 2Y7DA 4AHPA 2V2DA 1GVRA 1KLYA 2G96A 3TMLA 1WXJA 4FIRA 3EXSA 4UTTA 3T7VA 5MHBA 2I14A 2OT1A 4YCPA 3UXAA 1KM0A 4O13A 1NVMA 3NZ1A 4YCOA 4IQLA 3M5ZA 5DY3A 1EP2A 3SGZA 4UCGA 3LCHA 4MY8A 5G2WA 3L68A 4XBKA 2ZQ0A 1XFBA 3V1PA 4MIMA 1F7BA 1QNVA 4KFNA 4N9BA 3KAOA 1T96A 2FFCA 5FF0A 4MY9A 3LX9A 5G4EA 1F2JA 1QPRA 4WY0F 4UTTC 4HPXA 3UY8A 4O57A 3LXCA 3VE9A 4X22A 4PODA 2CZFA 2W79A 5LNVA 1J4EA 1SSGA 3NL2A 5I3JA 2EAWA 3ZFHA 3LLFA 3FYOA 3BLIA 4IOTA 1QR7A 3GDKA 2ZRZA 2J27A 3GVGA 5AYYA 3TC7A 4IMEA 1IXNA 3QJAA 4A3UA 2I1OA 2PC4A 5K3VA 4JICA 3CHVA 1B3OA 3MWAA 4MJMA 4S2BA 4JD4A 6ALDA 4I7UA 1NF7A 2CLOA 1OX6A 3F4WA 3SFKA 2DZSA 3W72A 1SFJA 3WK2A 3NGJA 2P10A 5D02A 4IPJA 5AYXA 3W2KA 3GR7A 2CZEA 5DBUA 3DFPA 3DFQA 5CPNA 3NPXA 3G22A 3QRHA 3TSDA 1RD5A 3T78A 1YDNA 4RKAA 3W84A 3DU0A 2ZTJA 3IIZA 3GR8A 3O8AA 1KFCA 2A1YA 4LV9A 2HMCA 1A5SA 4OV4A 3HB9A 3U2OA 1V5XA 4MLJA 4GBUA 2O7SA 2D73A 2V8ZA 1X8FA 3UWWA 5D2XA 3LCXA 3ATYA 1I2PA 3LHTA 1W56A 4UTUA 4MZYA 5G2IA 5CG7A 3NQ2A 1B4EA 1GT8A 4K36A 3W75A 4WZHA 4BWLA 4JX5A 3M7WA 2E77A 4CCEA 2C13A 1QOQA 4Q32A 3W2MA 5CZJA 3VE7A 3W73A 3EXTA 3G0SA 3P8IA 1L6WA 1X1OA 5BMXA 4LUJA 3RFAA 1FCVA 1KFBA 2VC6A 4HSNA 1JCLA 1JCXA 1WV2A 3C6CA 3H55A 3QPZA 1A5AA 3GK0A 5K7JA 2BX7A 2QCMA 2Z1BA 3W7NA 5AC7A 1LROA 1IIGA 4I7VA 1FDJA 3EKZA 1QPQA 4WY0A 2YPIA 3LHZA 2WJZA 3CWOX 1A5CA 5AHIA 3P74A 1A5BA 2JBMA 4DO5A 2H8XA 4IGHA 2J9YA 4HKPA 1FWRA 4RJEA 4DBDA 3I7QA 4UMAA 3EX2A 4Z1AA 2QCLA 3DFOA 4JXCA 5G4WA 1QAPA 5HWNA 1Q6RA 1G4EA 4QJ1A 2Y70A 1N8FA 4BI7A 4N9EA 3R2GA 2QAPA 1SSDA 5C6MA 3BVJA 3AO0A 3PUEA 5CSRA 3CC1A 1OG0A 3C4UA 3E96A 3VCRA 2V0TA 1VJIA 4UMBA 4UFKA 1K8XA 1YXYA 3VFLA 2V5BA 3HGSA 1AW2A 1SW7A 3W7PA 5KITA 3LTSA 1VR6A 1RQEA 2GVJA 2BLEA 1GWJA 3TJXA 1RV8A 5G1TA 5IBXA 3MJYA 3WJSA 1G4SA 2QEZA 4I9AA 4ADTA 5LZLA 3ZS4A 4M6VA 4N6EA 4DF0A 5D33A 4UFHA 2CLKA 3CPRA 1RQBA 4DPPA 1I8JA 4E2BA 3W7GA 3GX9A 3G1SA 3EXRA 1VZWA 5G1YA 3L0KA 3STGA 1YADA 2Q3RA 3R89A 3FYPA 2NV2A 4O0KA 3S5OA 2J24A 1S5WA 1H60A 2ATMA 1OYCA 3FJLA 5G2HA 3QPYA 2DZVA 3RMJA 2QCCA 2RFGA 5EKYA 4S2CA 2YX0A 3P62A 1I4NA 4AVFA 4MJZA 4LV4A 1O95A 1KW1A 1XUZA 2Y7FA 3NR0A 4UR7A 3C2VA 2RDWA 4ZQOA 5HJLA 1KV5A 4A2RA 1VQTA 1BTMA 2VENA 2V82A 3LTYA 1VHNA 4Y8FA 3BGJA 2ISVA 1EUAA 2C6QA 1H1YA 1GG1A 1QCWA 3W6YA 4K7VA 4PL2A 4R53A 4WD0A 1TPC1 2OT0A 2RDTA 1EEPA 2ZA1A 1VH7A 1DQWA 3QQ1A 2QCHA 3W83A 2WNZA 3WFAA 1ZCOA 3C56A 4IUOA 5TIMA 3W22A 1OYAA 3U6WA 3DHDA 3W7CA 3HGRA 2WSYA 3UZJA 4AWSA 1CW2A 4K6AA 3PBYA 5K2ZA 1EUNA 4A21A 3GLCA 5LHFA 4UMCA 3TXZA 3EX3A 5L6UA 3E12A 4ORMA 3SGUA 3SY5A 2A6LA 2H3BA 3Q94A 2OCZA 5CPLA 1VYSX 4N4PA 3QFEA 1D9EA 3HPZA 1UCWA 1GEQA 3NEVA 2TMDA 2JGYA 4UUIA 3PWAA 4WXZA 2WSRA 5D04C 4LRSA 2DZXA 2PURA 4JDYA 1KFKA 5LNRA 2A7PA 5IM51 3G1YA 1WYIA 1S3HA 5LSMA 3KVLA 3JRKA 3GDMA 3LERA 3N2XA 2PCQA 4YLWA 4O11A 1EP3A 4EIVA 3IGUA 3UWVA 5G5IA 3T40A 1UUOA 2NXGA 3LI0A 1DOSA 1OFQA 1L9WA 2NWRA 1VCFA 5LNUA 3QMSA 3W07A 3GDRA 4FX7A 2Z6JA 4LU0A 1R2SA 3MI2A 3L0NA 2QJIA 3LXAA 3DFNA 3L65A 4PEKA 4N6FA 3PR2A 1OK6A 3UY7A 4O19A 2C18A 3HG5A 4AXKA 4ALDA 4E2DA 3IV3A 1OF8A 1KTCA 3UQNA 3GB6A 3L5AA 3OVQA 3M6YA 3N73A 1ZFJA 3FLUA 2B4GA 2E5BA 5CPOA 4LVBA 2Z2UA 3QW4B 4HT3A 1OFDA 2ZZ7A 4KKXA 1SW0A 4AHQA 4O1AA 4NJJA 4UNKA 2ZZ2A 5F4SA 4WXYA 5F2GA 1QPOA 3RF9A 3LGEA 2VEPA 5FF4A 3IIVA 3TR2A 2R14A 3UWZA 4QM1A 2Z6IA 1KBJA 3W1LA 3TK7A 2HS6A 3Q58A 1DJQA 2CFFA 2DJLA 3B8DA 3M41A 3QEZA 1M6JA 1TPDA 3L9CA 4GC4A 4WX2A 3HF3A 3S9YA 4UFLA 3LHUA 3W9ZA 1W1ZA 3W86A 1G7UA 3W87A 1PCKA 4UTIA 3NO5A 1VPXA 5I3KA 2A7NA 2E09A 2CZDA 1O5XA 2JGQA 3PULA 4LC6A 1RR2A 2QCNA 3TV8A 5A5WA 3G1VA 1HL2A 4Y6GA 3S42A 4LRTA 3LI1A 3CWNA 4JYEA 4LS2A 1SZNA 1HUVA 5D38A 3E0IA 5DBTA 3UZ5A 5HUOA 4UIOA 5FF2A 4UFIA 1SPQA 3THQA 2B7PA 3AJXA 4AB4A 1PCWA 1XBVA 4X2RA 4CQAA 2QF7A 2YZRA 4IX0A 1FXQA 4LVFA 3P82A 4FHAA 4XKYA 5FEPA 5FI8A 2BSLA 1TQJA 3EX4A 4GUJA 4GWEA 3E49A 3TMQA 2I9EA 3A23A 4CCDA 1NEYA 4BI5A 2QDHA 4MOZA 3QF0A 4JTIA 1B57A 5TQLA 1X1ZA 2QUVA 2GQ8A 2VEIA 2QAFA 2QUUA 1ALDA 1F76A 3QQ0A 5K9CA 3TJLA 2ZRVA 5K9XA 2G95A 3NL3A 2GOUA 1AW1A 2Y7GA 4LS0A 3MUXA 5H2ZA 5EPDA 4AAJA 3G1AA 1H61A 3L0GA 2A0NA 3O16A 4TO8A 2J9ZA 3ATZA 1TO3A 4K39A 4OT7A 4IMCA 2WNNA 3PUOA 4YMZA 1SO4A 2B7OA 4IXXA 1U83A 4ZQRA 2Q8LA 1QWGA 1SZEA 1GTHA 1P1XA 1MZHA 1ADOA 3WJZA 2WOQA 3MI3A 4LNYA 3PVFA 3G8EA 4GXMA 3CIXA 3R13A 1SO5A 1R47A 3S1VA 1TJRA 3TROA 4QITA 1K8YA 3GNNA 4N9DA 3A21A 4XTIA 2X30A 1ZJIA 3LB0A 3NVTA 2VFGA 1OYBA 4GE8A 1DV7A 3S1UA
chains in the Genus database with same CATH superfamily
3ALGA 1XQKA 1LBLA 1DHPA 3IUHA 2PSNA 4PFMA 4ZE5A 1EDGA 1ZP4A 1E9LA 1KTBA 1YE4A 3IK2A 3VKBA 6PTDA 3HJZA 4JAWA 1UWUA 3KE0A 3SQSA 4R33A 1TE6A 3PK7A 2OO6A 5AHNA 3GW0A 3ABOA 5K4XA 2GGGA 3RDKA 4HOWA 3O9NA 3FEMA 3VKCA 4DYEA 4ZODA 1KCLA 2FHBA 3SRHA 1FHLA 1TZ7A 2OZ8A 1ZAIA 3DYOA 4M19A 1Q66A 2G5WA 1YTDA 4LVGA 3CQIA 3DYPA 5A8NA 1C9WA 1Z42A 4K1GA 7A3HA 3UFYA 1KBLA 3FDGA 4NJIA 4ADSA 3AXHA 4O15A 1FWSA 4CGTA 1C93A 2DQXA 4O1BA 3P5ZA 3TSMA 2F84A 3GTNA 4UBPC 1TRDA 4UB9A 1TV5A 2X1TA 3GAKA 3VKKA 2HXUA 4QGCA 3VIKA 4WEVX 3B05A 5EBUA 1Z44A 1XDJA 3UJRA 4DY1A 1VIWA 2DZAA 2HEJA 1WKEA 2CXEA 3A13A 3Q45A 5D32A 3DERA 1P0KA 5HWJA 3RLHA 5XIAA 1HKKA 2Y24A 4AD2A 1TPEA 3PZGA 1K4HA 3KL3A 1A5LC 3T0CA 3GYEA 4H9VA 5B80A 4PUNA 4AC1X 2C15A 3IARA 1HJQA 1JXKA 3CZJA 3W4RA 4Q8NA 4RXFA 1ME7A 2PP0A 2E67A 3CASA 2ZZ6A 3GRIA 2X1RA 2YYUA 1MXDA 2OYMA 2V6AA 2FHCA 2WZTA 4KCUA 3FAXA 4NYUA 1UZ1A 4RCXA 3L4XA 2IXVA 1IEXA 1XLMA 2RAGA 2NQJA 5E0FA 3T07A 2UV8G 1AW5A 1E6RA 3SCVA 1L6GA 2VFEA 2ONEA 5KZ6A 3LU2A 1W1VA 3VNIA 4UTJA 3G1DA 4C6LA 4FLRA 1QNRA 4UR9A 3BJFA 2BY3A 2CHOA 3WDHA 1VC4A 1SJAA 3W74A 3FV9A 3G1XA 1BGGA 1M7XA 5BROA 3TP4A 4CU8A 1XBZA 2WCGA 2ON3A 5RUBA 2UY5A 4RX0A 1YW1A 4NZ1A 1UWRA 2YCLA 2F6UA 1MDRA 4PGLA 5C9RA 2J13A 1LRTA 3WD1A 2VD9A 4IG2A 3NDZA 2PTWA 4MPKA 4JTKA 4ONVA 1JPDX 5D2TA 2ZRUA 2PZ0A 1Z32X 5FOOA 3SJ3A 1LLZA 3W7RA 3VIMA 3F03K 3HA1A 4O12A 4OUIA 1JAEA 4GUHA 4C1KA 2WNQA 3MTWA 4BI6A 5M1TA 2C79A 3K5XA 4J7RA 2VNCA 2VCCA 3NL6A 4JGDA 4B9ZA 4DB7A 1ITCA 2VUNA 4OBSA 2ZXQA 2F2HA 1BWLA 5HQMA 1FKWA 3NA8A 2VFHA 2CW6A 1GZGA 2FB2A 2WB5A 4UXDA 1PS9A 3A9IA 1UHVA 4JFVA 3KRZA 3VVGA 2J9XA 1L2UA 2O92A 5CSSA 5D2WA 2UY2A 3BH4A 1H7WA 3IGXA 2RGLA 1EWEA 1FHVA 3UCCA 4Z2HA 3LPPA 1VLIA 5IDIA 1WBHA 3SECA 2C14A 4OE7A 1E9ZB 1Q6GA 1TPVA 4BCEA 4ENLA 3TCEA 4DO7A 2ZOXA 3IIPA 3VOHA 3CH0A 2E3ZA 1RVGA 4QLJA 4J35A 5K4ZA 3O63A 4E4PA 2PRHA 1TTIA 1KB3A 1P5BA 3WY1A 3H54A 2JIEA 1Z6KA 3ARVA 2C1GA 4WDWA 5JVLA 3GY1A 1I2QA 3P0XA 1MNSA 1UBSA 4EX4A 4FLSA 2UBPC 1TMHA 3ZLGA 4GYPC 2HE5A 4R9OA 4DJFD 1W5OA 2V5KA 3NPUA 4NX0A 4GGHA 1WOBA 1AMKA 3TFXA 1V6UA 2V5CA 5FACA 5D09A 1HVQA 4P8UA 2VVSA 2IXUA 4TUFA 4D9PA 4CNTA 1TTJA 3RCNA 3N2CA 2NT1A 2PTDA 3GXMA 3KVJA 4PBGA 2PWDA 3T4WA 1JAKA 1XX1A 2GUUA 3DFYA 4JTRA 3VNLA 1QMLA 1Q45A 1RBAA 3GM8A 3THAA 3KVMA 2XVNA 4CNNA 1XSJA 4E3VA 1CXLA 4HZ6A 1VF8A 1EP1A 3TAKA 2FQIA 3WUBA 2E0PA 3EDKA 1OCJA 4H7CA 4DIAA 1JCTA 3BW2A 5EFFA 3GFZA 3YPIA 5GNYA 1A49A 1XG3A 2B7QA 2PLJA 3SCPA 2CC0A 3MI6A 4YTQA 4NJGA 4G7FA 4NASA 4OIFA 5JIWA 2HZGA 2GK1B 4NXSA 4JHZA 3TNOA 3M16A 3ZSTA 4JNZA 4XTDA 1EGVA 1ZNNA 3VGEA 4LXFA 4HJFA 4B3KA 5BU6A 2J8TA 4S3KA 5AC8A 1CGUA 5LA0A 1QW7A 2DZWA 3GAYA 1I0DA 4L5ZA 1Q6QA 4S3FA 3WL1A 3C8FA 1UKQA 1H11A 1TKKA 1S46A 4MZ1A 1MQPA 4IGNA 1NARA 5BRBA 1F4HA 3OOQA 4FNUA 4LEFA 1FCBA 4P7NA 3W7IA 2J6XA 3UYIA 2EXOA 1UZ4A 4YVVA 4F0HA 2YLLA 2G4FA 1DVJA 4I6KA 5CZ0A 3L5LA 3EKLA 4YWIA 2DIJA 4L64A 4AEEA 4A3QA 2E9MA 5CJNA 3WBXA 3T8LA 2CESA 3TVAA 1BTCA 1UD4A 1JQXA 5DXYA 1A0EA 3PY2A 3C2EA 2ZVRA 3B8IA 4GFSA 1XYFA 1RPXA 3G18A 3C0QA 3VGFA 3ZXWA 3MUZ1 3W7KA 3OU8A 4NSBA 4CQCA 1GUVA 1DXIA 4B5TA 5CAKA 1E9IA 1IEIA 1SJDA 3AXMA 4GRSA 4GYFA 4QAWA 4WSHA 5C9WA 3NQMA 3LLDA 3THDA 3KBSA 4Z17A 1JD9A 1MUMA 3MSDA 5E6ZA 1P48A 5M3WA 4W84A 3AU6A 1MXGA 3STCA 3WQ6A 5B7YA 3B4UA 3R5EA 3TQ0A 1B3XA 1R3WA 1XGDA 3GTIA 1XLDA 3M5XA 3GIYA 1YHTA 2CLPA 4MB4A 1EX5A 2HDJA 1I2OA 4C6OA 4UTKA 1W1A1 3TQVA 3DN5A 1TMQA 3SUVA 2OG9A 4GY0A 2C91A 7TAAA 2ZKMX 4DBEA 3RNDA 3IUIA 3UWQA 1ZY9A 4X61A 3KOFA 4WOQA 1S2CA 3PN8A 1UMYA 1I1XA 2H9AB 3V36A 4NHVA 4ZTXA 4EKJA 3M47A 4JIPA 1TSIA 3E1F1 2QPUA 5CAHA 3P61A 4IMFA 3ITLA 3VOJA 2PDUA 3K13A 4EVZA 4C91A 3ZLFA 3HV9A 4RDVA 5A95A 3R8HA 2NQZA 1E40A 4B16A 4F4RA 3GIQA 5H91A 5C55A 2F9RA 3O3RA 4A8IA 3PZQA 4HB7A 6REQB 4BEUA 4Q33A 3O15A 3NQDA 4H9YA 4LT9A 3SN0A 1CXKA 3O06A 4HOXA 1W1YA 2WM0A 3VX0A 3H2EA 4W4QA 1WAUA 1J5SA 3CPUA 4HN8A 4XZ9A 1H49A 2V38A 4A8LA 1SVDA 2VD8A 2GVLA 1EIBA 1ELSA 2Q02A 2P0IA 3DHUA 3U2ZA 1IHIA 1OX5A 5TNVA 3CV1A 1GYNA 4PCNA 1PTAA 5E93A 4D6GA 1EC9A 4JHMA 3STFA 1ITQA 4NRSA 2INEA 4JIIX 2Z1SA 3LMYA 3TX9A 3PSVA 4NZFA 3QYQA 3VZYA 2AQOA 1A50A 3EWUA 4HJWA 4PN2A 3MUIA 2X7VA 3VIJA 3V0TA 4ZOCA 1FCUA 4HCDA 3HFTA 3IEBA 1LOLA 2B31A 2CHNA 4EPBC 2E5DA 4EXAA 3TYAA 1ZBVA 1H51A 1D3GA 1BPLB 5D03A 4GIRA 2I16A 5E0KA 2TRSA 4Z1CA 3GG0A 3AYTA 1JRCA 3CZLA 2AL1A 2EPLX 2OMAA 2GLKA 3E02A 5M2FX 5AY7A 3CXOA 4LCQA 5CLWA 4GYKA 3BW4A 4WJ8A 4DEFA 1WKDA 5HPCA 4L1GA 1E0TA 3ARTA 1PKLA 3B97A 3TW6A 1KM5A 3P67A 4DYKA 3LHYA 3ZVHA 2Y5SA 5M03A 3AIRA 4BF7A 4R3UA 3AIVA 3FA5A 4E8CA 4B5XA 4TU1A 2E8YA 2C16A 5A2CA 4QNEA 3N4AA 4RPPA 3C2YA 2BXVA 1KRMA 4W93A 1HO1A 1P0DA 1V6WA 2OELA 3RR4A 1KFJA 1GG0A 3M07A 2ZDSA 4JY8A 1OABA 2O7QA 4Q4PA 1QVBA 3RGTA 1X98A 4IL2A 2ZFAA 4RW3A 1R46A 1G94A 1Z48A 5AECA 4BR1A 3EX6A 1M9HA 4HNCA 4O54A 2XIIA 3OLIA 1YLVA 1H7XA 3QKZA 3KRUA 1XDMA 3HGOA 4B5NA 4GIYA 3N6HA 1XIGA 3BWWA 4O1DA 1JF6A 2NLYA 2FZNA 2AL2B 2P3EA 1OWQA 3HGJA 2NUWA 1WUEA 4FF7A 2WXDM 1DWAM 1RBOB 3KW3A 3NQGA 1XRVA 4H8HA 1KFEA 3GUWA 1EH9A 1FX6A 3G1RA 1XDLA 4C6FA 1W31A 4MWAD 4GQBA 4XIMA 1S39A 4NUWA 3MDWA 4E0CA 4GINA 4NAEB 1FWGC 1LLWA 5FAGA 2GUBA 3W1PA 4NZJA 4JTTA 1R7AA 4O17A 5GJNA 1EEXA 3W3OA 5DMYA 1CXFA 4MB1A 4HPNA 3CZKA 2YYTA 3EB2A 3QV7A 5C7VA 1PX8A 4PUDA 1CGVA 1REQB 1ISZA 4POCA 4O10A 2ZZ5A 2IPJA 1B1YA 2A3LA 1UB3A 1UKPA 3I7RA 4C6CA 1KQYA 2F7FA 2HQAA 1OZQA 1V93A 3BQ6A 3WF0A 3SIMA 1AZ1A 1GOQA 1MEWA 4H19A 2Y8KA 3W7EA 1E1CA 5HUPA 2J7CA 4FSAA 1FXPA 1IYXA 1CECA 1LRQA 5KINA 1DXFA 2WWDA 3SI9A 1OJXA 2FDSA 2DY3A 2QDDA 4GUFA 4EANA 5LHEA 2F38A 1POJA 2PB1A 2FMNA 3GFXA 4JNMA 3CB3A 1M5WA 1KXTA 1Q6DA 4Q4SA 5I3HA 2VTFA 3U7BA 4NNCA 5FJUA 1OHLA 1SFLA 3B4YA 1EJWC 1WZMA 1NWSA 1ZS2A 4PMXA 1VFMA 3IVTA 3MHUA 5HOSA 3UG4A 4AIEA 2CWNA 3GWQA 3LOTA 4AZBA 1TX0A 1W8GA 2BV9A 1CB2A 3VCNA 3WD0A 1EKOA 1PXGA 3OZPA 2QV5A 4C1NA 3VIPA 1GVSA 1TMLA 2D3NA 2L5HA 1N2VA 1ZENA 1CLXA 2YDQA 4PTNA 5HJYA 4V28A 3OHIA 4JR5A 2BDQA 2DSKA 4S3EA 4XG1A 5LXEA 1DJIA 3R0DA 1Y5XA 3WDPP 4H9ZA 1XYCA 1C9DA 2QZRA 2QVHA 2OLAA 3UNTA 1TPUA 3DUGA 1GVIA 5F2MA 1E0VA 1CLKA 2KAUC 1OVDA 3KHJA 5FJOA 2OFJA 3VU2A 2XYLA 4A3RA 2PDYA 1LG1A 3I68A 1ESWA 1EPVA 2VVNA 3SSZA 3B0UX 3VTRA 5C2GA 3BURA 3W28A 3WD3A 3LPGA 4YL2A 4H6EA 2WLZA 3H2CA 3S6OA 4L4MA 2BOEX 3FY1A 3LM3A 2FPYA 3BSGA 3CM4A 2CERA 4UTWC 3QOMA 2INFA 3EWDA 4KGLA 1EBGA 2QCEA 2IKJA 4JTEA 1ZAHA 4Z2GA 3CV2A 1K9FA 1E6QM 4QAIA 3UCQA 2J7FA 3MO7A 1BQCA 2DZPA 2FTPA 4X9YA 2CLIA 1LQ0A 4PULA 1ZGDA 3M44A 3WLIA 2PCEA 3BOFA 2X1UA 1WZLA 3K8MA 1B31A 2X2GA 4ML9A 3TQPA 3WF2A 4PMUA 1U5VA 1G7VA 3ZJ7A 1CWYA 1QI0A 2BMBA 5I3IA 1DWHM 4ZO7A 3M7SA 4W7UA 3D46A 2J79A 2ZZ1A 2G41A 4C6EA 1OFOA 2ZXBA 1TV8A 4Z2IA 4MUZA 4A22A 1DKWA 4FX6M 4FXSA 3M0IA 4LF1A 1JF5A 2WBGA 3AI0A 3VX1A 3SQLA 4UFJA 3W7DA 2Y62A 2FTWA 1J0HA 1RCXB 2YKKA 1R9YA 3IVUA 1UG6A 4IMGA 3QYSA 1YDYA 3IGSA 2WSKA 1BF6A 1UIPA 2GVEA 2A21A 4Y9NA 4ZQNA 4DJED 3M6DA 2VDIA 4HMDA 2J77A 4Q7BA 1S5TA 4B91A 1A53A 3DX5A 3PPFA 4ILSA 3VC6A 1W5QA 1POKA 2Y1HA 4HMCA 1GHSA 3SCTA 3MMUA 1CB7B 3CQKA 3BPWA 2BVDA 2YCKX 1OADA 2CLHA 1PEZA 1OX4A 1HXJA 3H2OA 2CU0A 1MUCA 1O66A 1S2AA 3M0VA 3T44A 4OV9A 2WYSA 1HT6A 4CEXC 4EPDC 3V35A 3WQ4A 1US3A 2FVMA 1GNXA 1YPFA 2HE8A 2AAMA 2OQYA 4LF2A 1JPMA 1TWIA 1UP0A 2OJPA 1LP6A 5CPSA 2WNWA 3WK0A 4GQRA 1RCOB 1KLYA 3C0LA 4PUWA 3GC2A 6XIAA 2OODA 4AZ6A 1XYLA 2VZUA 4O13A 5DF0A 3ITYA 3D3FA 4IQLA 1SR0A 5DY3A 4QBXA 1EP2A 4AEFA 3F2CA 2Y4SA 1L8NA 2ZWZA 1BVZA 3EBVA 4MB3A 2HJPA 5G2WA 3CUZA 4P8VA 3STPA 2A3CA 2FFCA 4HU3A 4DYJA 4MY9A 1B5TA 3LX9A 1FWJC 2PLKA 3POHA 4UTTC 4DJFA 4O57A 5BXPA 3GFYA 1KFWA 3MUAA 4QEEA 3ARWA 3K2GA 2EAWA 2UZ9A 4PE8A 1EJTC 4IOTA 2VQUA 1A4LA 1IXNA 4ZOEA 3QY6A 4Y9MA 3CHVA 4GMEA 4JD4A 1Q85A 4ATLA 3F4WA 4FZIA 2P10A 3DGBA 4PTMA 5EMKA 3OLEA 4R88A 3LSBA 4RL3A 4MAZA 5FCZA 1RD5A 2PWVA 4O0QA 2I9UA 4IFOA 4HVXA 4DZHA 2CBIA 3WFLA 1I0BA 4KRUA 3U2OA 1ITUA 3PHAA 1ITXA 2D73A 5D2XA 3ATYA 5G2IA 1DWFM 5HANA 2OOFA 4WZHA 3EOEA 3W53A 3W2MA 2GQ3A 4B5WA 1BWVA 4D6IA 4O1FA 3CZEA 4G1NA 1KFBA 4WVXA 3IS4A 2PF8A 3QOKA 1QNPA 2WMGA 3C6CA 3H55A 1A5AA 1SYTA 1V3KA 2Z1BA 4TOQA 4AWEA 5AC7A 3CHCA 1QPQA 3SM0A 3L4ZA 5IRPA 1NELA 3ORWA 5AHIA 4W8LA 4MF4A 4DO5A 3L7RA 3H7UA 3BCFA 3VIGA 4XIAA 4EACA 4LAUA 4ZB5A 3EX2A 3QV9A 4Z1AA 3DFOA 4FPSA 4R27A 3AAMA 5HWNA 2I5IA 2EJAA 3UERA 2Y70A 4BI7A 4KESA 2QAPA 3WDIA 3BVJA 4EXBA 3AO0A 3PUEA 4HYVA 3A4AA 3CC1A 3F5LA 3VCRA 3GNOA 5BXSA 4UMBA 4IIHA 3QPEA 1ZLPA 1VR6A 1V3HA 3GVQA 1RV8A 3MJYA 4M6VA 4N6EA 2XHYA 1UIOA 1RQBA 2FFIA 4DPPA 3UGRA 2OLHA 1TV4A 3HV8A 4JL2A 4AD1A 2WVUA 1YADA 4R9XA 3RPDA 2NV2A 5AC4A 4DNMA 1H60A 5G2HA 4RNFA 3QPYA 4S2CA 2YX0A 1GOMA 4B4HA 4MJZA 1V4YA 4B4FA 4LV4A 2VGGA 3AHYA 5A8OA 2Y7FA 2RDWA 4DWSC 3LBOA 1TJ2A 3V1HA 2YB4A 1KV5A 3NOYA 3G5EA 4LEQA 2VENA 2V82A 4AIBA 4F0LA 1EUAA 2C6QA 3MKKA 5HNNA 1QCWA 2OT0A 3AICA 1VH7A 2IPWA 3VGDA 2WNZA 1ZPTA 5AYBA 4JKMA 1CLVA 3TTYA 3W22A 3SQMA 4ZXLA 2DEPA 1LQAA 1CW2A 1Z8AA 4K6AA 5K2ZA 1D7KA 5LHFA 4DJDC 3CHFA 4D8ZA 3E12A 1SMDA 2H3BA 5J04A 2OCZA 4KWSA 3E5PA 1UP2A 4OECA 1UR9A 2BG5A 1BRLB 1UCWA 2DUXA 2FGZA 1A0CA 4GC3A 3B9EA 3BQ5A 3PWAA 4AX6A 4WXZA 5EGRA 5A6JA 1W1B1 1KFKA 1T6MA 3FAWA 1WYIA 3GTXA 1OEPA 2QNEA 2VDHA 3LERA 1RK6A 3SN4A 4J27A 5G5IA 4QLKA 3FJ4A 1OFQA 1L9WA 2NWRA 3VK5A 3B0XA 1UOZA 5LNUA 3W07A 4FX7A 4LU0A 1R2SA 4LFYA 3EPNA 2QV4A 5FJJA 5I6SA 4N6FA 3PR2A 5M17A 3CO4A 4E5TA 5CC7A 2C18A 2DZBA 3SCSA 1K4GA 4LUTB 3IV3A 3GB6A 1BF2A 3M6YA 3N73A 3R8GA 3RUBL 2B4GA 4QP0A 5D9PA 3KZPA 2Z2UA 3QW4B 3R1ZA 1OFDA 2ZZ7A 2FVKA 3MVTA 5F7UA 1EJSC 4RNIA 4M24A 3P14A 5F2GA 1QPOA 3TR2A 8A3HA 3OHMB 3SY8A 4IZGA 2OO0A 3PZ9A 3NWRA 4TXEA 2DJLA 3NIYA 3M41A 1VBJA 1TPDA 3CUXA 2YA2A 3N25A 4DBUA 4IGSA 1XGZA 3AMKA 4W5UA 4DJDD 4UFLA 5AKQA 3LHUA 3ECQA 3W9ZA 3W86A 1G7UA 2F61A 1X7IA 4GKTA 3NO5A 1QW9A 2YA1A 3WH5A 1IR2A 1U30A 4Q7IA 4MJ4A 2QCNA 1M7JA 5JU6A 3G1VA 1HL2A 4GX9A 5BWAA 3E0IA 5HUOA 1UQYA 1B3ZA 3THQA 3UPMA 3AJXA 1VD6A 4A3HA 1RCQA 1XISA 1B54A 1ISYA 2YZRA 3E2RA 1FWEC 1LJYA 4Z1YA 1TQJA 4GUJA 5A1AA 3G77A 2WC4A 1HJSA 1NEYA 4BI5A 1VP5A 2WM1A 4E8DA 1KXHA 1XQLA 1HW6A 3QQ0A 2GWNA 2BVTA 3IJ8A 5IFTA 3BLDA 2GOUA 2Y7GA 1E6SM 3VZZA 4L9YA 3TN3A 3ATZA 3EMQA 2WNNA 3C0SA 1SO4A 5C9ZA 4XX6A 4HMEA 2R1PA 4UQAA 3RM8A 1QWGA 2W66A 4Q4OA 1PKMA 1SZEA 1QI4A 1XYMA 3WJZA 3WMBA 3TJ4A 3MCMA 1EF2A 1HF6A 3Q65A 4XVEA 3CIXA 4Y8EA 3R13A 1SO5A 3VOCA 3L4WA 5A6TC 1PZ3A 1BKHA 4KF1A 4Z2LA 1YNPA 3L4YA 4N9DA 1W9UA 3A21A 4XTIA 1RA5A 1UZHA 1OYBA 1G5AA 3S1UA 1FDYA 2GGEA 2BS9A 1T41A 4W88A 3STEA 5EMUA 1AZ2A 3VDHA 4HTYA 1QNSA 1B9ZA 3UA4A 1WKFA 1G9HA 3NG3A 4JN6A 9XIMA 2IS7A 4ASTA 2LLEA 3AYRA 4KS0A 1HKIA 4I7WA 4C1NB 3BC9A 3H4WA 3TYEA 3ARYA 3BAIA 2NQLA 3VD4A 2PDLA 1DJHA 1TREA 3PBUA 3WFZA 3PB0A 4M29A 4CQDA 3U57A 1NFPA 1VEPA 2GSJA 2RDXA 3F2DA 1F6PA 5E09A 5MKGB 1AL7A 1W3LA 2FGBA 3OGVA 4RE2A 4Q8TA 4HQVA 3TCSA 1VAHA 1GW9A 3GVWA 1VKFA 3NQ6A 4KEZA 4D6JA 2WJEA 4D72A 4MWAE 4C6JA 2VURA 1TVPA 3GC4A 3EOLA 2GQ9A 1H3GA 1RLDA 4PMNA 4AWTA 4D6HA 1ZRQA 2ISSA 3SB0A 3P7YA 1BGAA 2CLMA 2ZZ4A 1UMLA 3WQ5A 2YFNA 3GVVA 1H2JA 3EKGA 4LSBA 3WD4A 4PMYA 4H3DA 2X40A 3GIPA 3ZMRA 1GJUA 3RLUA 3GKAA 3PC0A 1IEVA 4GJ1A 2PA6A 5AC6A 1Y5VA 3RITA 3IJ9A 4FX8A 5CPTA 4NAFB 1EYWA 1XLIA 4XQ6A 2WSPA 3NZGA 3WBAA 3VKJA 2GDUA 1H7NA 1KO0A 3MP4A 4F3HA 3I6RA 4JTSA 4KCTA 3BAJA 3ZT6A 5ABHA 4HIBA 1J93A 1EA0A 1XGEA 2V3GA 4L56A 1A3XA 1MNZA 2ZUUA 2I5QA 3VIIA 2YL8A 2PF0A 2P3ZA 5I3FA 4JQ1A 2NX9A 1CGXA 1E0UA 1CZ1A 3ARUA 3I3DA 1JD7A 1EHNA 5AHMA 3W24A 2HBXA 1E1EA 3NQFA 4WSJA 2V68A 3QR3A 5E9AA 2Y61A 4N0RA 1WXZA 5HDRA 1D7FA 1EL3A 1RVKA 4W87A 3BAYA 3T81A 1RAKA 3GBEA 5DT5A 2WLYA 2XVKA 1GQNA 1CCWB 2CLFA 3FSUA 3ARQA 3N4FA 6A3HA 5HQEA 4UTWA 1O5RA 3WBEA 3FKKA 1C8VA 4MTVA 4HHMA 4IISA 3CAKA 3H7RA 1VFUA 1GKPA 4S3GA 3KBNA 3KP1A 4B15A 3LCFA 2R82A 2CBJA 1C7SA 4QQUA 4QTGA 5A6AA 3D0CA 4U3CA 3OA3A 3AHXA 2GVYA 5LXXA 5DRCA 3ZYZA 1B4KA 2XVPA 3HN3A 4ICNA 1MEIA 2BB0A 4ZTYA 5BCAA 3WX7A 1WDQA 4N4QA 5JXQA 1K70A 3DOPA 4CNUA 1FCQA 3M9YA 4AC7C 2F2KA 1E55A 4ICMA 5I0DA 1S3TC 5AZ0A 4KH2A 5CBJA 3N18A 3T9PA 4I8YA 4KETA 4ERAA 1EC8A 3GHRA 1XBYA 3VOFA 1TA3A 4LAMA 4AZGA 4R85A 4KRZA 1HJUA 3R7MA 1NTHA 4GPNA 4GQ0A 3B9OA 4J3UA 3CB8A 2WQPA 4N2YA 1PWLA 4QSHA 5AOUA 3ANYA 1DIDA 2OSWA 4OVXA 3TW9A 1LRNA 3VNYA 3UYCA 4QIUA 2J66A 4PH6A 3HQOA 1ONXA 4M7SA 1BXNA 3L4UA 5FF7A 3NQVA 4HA1A 1MWOA 3VNKA 1QK0A 4CCCA 2G0WA 1SUXA 1E6PA 1KTNA 5EMMA 4MM1A 2E6DA 1A80A 3LBCA 1YRRA 4Q6JA 4S3JA 3TLQA 2PWFA 5ENLA 3EAUA 1C90A 3PJUA 1DORA 3QSTA 4LYQA 2FH8A 1GVQA 1EYEA 1DJYA 1FWCC 1N8IA 4ERGA 3QC3A 4QCFA 1VRDA 1W91A 3VDCA 4IPIA 4HNNA 3N9SA 2XU2A 3RJXA 1BWKA 1DJXA 3BLOA 3T08A 5FJTA 2Z26A 1GOKA 4EPEC 4G1KA 3UPWA 1WDDA 5IBXC 3MU7A 3TEVA 4DJEC 5T26A 3KVKA 4AF0B 3C0JA 3VPLA 4Z08A 3KBWA 1OGSA 1E70M 3PF3A 2C8NA 4JYDA 3AYSA 4IQDA 4U31A 4C6KA 3HQ1A 4OUEA 4AEOA 5D8WA 3S2NA 3HBLA 4X0NA 3R58A 4PR4A 2JALA 2EF9A 3EDJA 4ZCWA 4JIEA 2I56A 2PDQA 5FAJA 3W2JA 4AMAA 1IE7C 3GW3A 5DCBA 1A3WA 1RLCL 4MPQA 4NT0A 2GVGA 3SCWA 3AU2A 2Y8VA 2KX9A 5ABGA 2CXGA 3HPSA 1QK2A 1QNOA 2XSXA 4K8HA 3RILA 3O7UA 2X0SA 3TYBA 3PUDA 2D2GA 1HQTA 1XJBA 1XRSA 2ESCA 3LUTA 4K3ZA 3PSWA 2ZWYA 1BVWA 4TX8A 1EDTA 1Q7ZA 4FA3A 3AIUA 1E1CB 3VNDA 2DP3A 3OVGA 1A4MA 3EWWA 4FAMA 3BANA 4PUJA 4JTHA 2DT1A 3VMNA 2W91A 2OZ3A 2XISA 3DFSA 3TZFA 5I02A 5MF5A 1I75A 3TUUA 2JKAA 1Q6OA 1WQ5A 2PDKA 1R86A 3LNMA 2ICSA 4ROQA 3INPA 1A5MC 2Z7KA 1TR1A 1KBIA 3M1ZA 4WHBA 2ZZ3A 4K8GA 1OC7A 1R3TA 5A6BD 3OLDA 5I3DA 4ZXOA 1JPKA 1AQFA 4GJIA 2X0YA 1X6NA 5U7SA 3KHDA 2VQTA 3H4XA 2AGKA 1EF3A 3NDYA 4E8GA 3GU2A 2XWDA 3VXGA 1O94A 3AWOA 2DPEA 2WKGA 1B3YA 1R30A 3HTWA 2WZIA 4Q7NA 4O1CA 5C9UA 4ZMGA 1EQCA 4AY8A 4HNTA 1JI2A 5KSWA 3S5ZA 3TFCA 1MEHA 2XFFA 2ALRA 4XUGA 2BGNE 1KRCC 3OG2A 2VL4A 5A8PA 1K8CA 5BOFA 1HGYA 2DDXA 3QZAA 1OCNA 4AD4A 4N42A 3CTTA 2X2YA 2VFIA 1FDZA 1OX4B 3CUJA 4QEHA 3MSYA 2E25A 3LGDA 3IACA 4JNYA 2XN1A 1J9YA 2CNCA 4UTLA 3I4EA 4OKDA 1GONA 2HNEA 1TZZA 2PTYA 4ZOBA 5T9CE 5CJ5A 1PL9A 3WELA 2MANA 4EWND 2WMIA 3C86A 1J8VA 1TCMA 1UWTA 4IWWA 3A24A 3MCOA 2EG6A 1KRAC 1VB9A 2C71A 5BRPA 1T8QA 2PDFA 4XO6A 1TG7A 5FL0A 2CZ5A 2EG7A 1EJRC 1SJCA 1AL8A 2Q6ZA 1V6XA 2E1WA 2EGZA 3CTLA 2YDAA 4QE1A 4BKNA 1R8LA 4DBWA 3UG3A 1V08A 4MMWA 1GJPA 4PB5A 1FWNA 2O0TA 3OVPA 1BYCA 1KKRA 1M1BA 3MMWA 4AF0A 2OEKA 1FFQA 3UR8A 3PZIA 1JUBA 3C2FA 1OFRA 1V0KA 1J12A 3AWNA 3LPOA 2Z2BA 3I65A 2VEKA 1THFD 2OEMA 4XV0A 3ZJ8A 3TW7A 2AMXA 5DRIA 2QUMA 1FA2A 4MYXA 2PEVA 2EHHA 5D2VA 2Q8ZA 3LSCA 3K8LA 1A5KC 2YBTA 4GX8A 1CX9A 1ECEA 5A2BA 1XYBA 2XN2A 4G9PA 2PDMA 1Z7AA 5DN1A 4JDBA 1XP3A 3EEZA 1AH3A 1M7PA 2WPGA 2O4QA 4H6QA 5HPOA 1TX2A 2JKEA 1W54A 2XFWA 4LUYA 2XIQA 5J5RA 2ALDA 3L2LA 4JKLA 1E0XA 3HG2A 2CBVA 3H8AA 3XIMA 2FZMA 4DPQA 3NCOA 2Y6ZA 4DUXA 3NVDA 3NZRA 4UOQA 2QJGA 2BZNA 4FNSA 3UXIA 3PTMA 2HK1A 3P80A 1JUEA 1TR9A 3FSTA 3UJSA 3B8WA 1BSLA 2Z1KA 4DO6A 1GVOA 4L4PA 5CBIA 1TE1A 1TTQA 4WJXA 4IHCA 3S8HA 1JZ4A 1LCOA 2VR2A 7TIMA 1LLOA 1UC5A 4RV3A 3UZYA 3WQGA 3WQVA 4MWAB 5EMYA 5CLTA 2R9RA 3WH6A 3NZQA 1PV8A 2V5JA 3MMTA 5CZKA 5M5DA 2O55A 4Y7EA 2E5CA 2R1KA 1W6TA 1XLCA 1XKJA 1R3RA 1WX0A 1F74A 1PHWA 4IFRA 4H6KA 3ALFA 5A8GA 3LCWA 1HO4A 1XFCA 4U4MA 2GUYA 1ISVA 1XHGA 4GCXA 1QO5A 3ITGA 3CU2A 5FA5A 4TMBA 3UPBA 4AW7A 3W1UA 1NDYA 1K03A 1F5ZA 1W3KA 4MFEA 5AB3A 3TJIA 4IIDA 1UC4A 2WWCA 4AYSA 3VYLA 3I7SA 4UFMA 1A0DA 3E9AA 1KWGA 2DT3A 4WUIA 4S3AA 2GSHA 4D71A 3KDOA 1VS1A 3LS9A 2HNHA 3ITVA 1K9EA 2OB3A 2PDPA 2Y85A 1HG3A 4K38A 4QS6A 4DUOA 2BGQA 2GQAA 2WPBA 4H2CA 4HU4A 4MGGA 4IMDA 4UQBA 3PTDA 4MY1A 1RUSA 2VGIA 5A94A 1EZWA 1JCNA 1GPWA 1PZ2A 1IF2A 1VRXA 4OBTA 1UWIA 3CJPA 3P81A 4DBSA 4J1OA 4H00A 5EA9A 3GHUA 3PBWA 1Q6FA 2C3ZA 4GK8A 9CGTA 3MW7A 3DGRA 3ONBA 2UWFA 3P2VA 4E6MA 4W89A 3NJ3A 1IV8A 1J96A 2DVUA 2O9RA 1XIFA 2VX5A 5E9XA 1AQMA 1NFBA 4QHRA 3AROA 3P0WA 4JPGA 1C8YA 4JIRA 2HPMA 1BLIA 2W3ZA 2NZLA 2R1MA 4KMQA 3GHSA 4NNAA 2D2HA 3LCIA 1E6XM 1AD1A 2QKFA 3ERPA 5J5DA 3G0UA 3FHAA 1R9ZA 5I3GA 3E0WA 3AXIA 4LVAA 1K7EA 5DLCA 4F0KA 3ZOAA 2PDHA 1E4NA 4A05A 4LCRA 3WJXA 5C7HA 1D8WA 2BHZA 3BLPX 3M0XA 1RBLA 4TIMA 5HWMA 3WF1A 1AJ2A 4XB3A 3TN5A 4WLCA 4BJHA 3PM6A 3ZWTA 2RDUA 3FGCA 3SZ8A 2CLEA 1O4UA 4UWMA 4HHLA 3PUGA 4WR3A 5KTLA 2BXYA 1OCBA 5I77A 1BG4A 4PMDA 1KM3A 1P6WA 4JEJA 2XH2A 5LNWA 1BXBA 2ACRA 4L1WA 1KWKA 1SO6A 2PFHA 1W9BM 3G24A 1MZRA 1O5KA 4RPQA 3H26A 1HN1A 1J0IA 5LKYA 4HK5A 3TU9A 1F3EA 1IGWA 1FP8A 3C3NA 4AD0A 1MUWA 4Y9OA 1LL7A 4EAMA 3KTSA 3DC8A 4O53A 1QDSA 1HL9A 1M03A 3Q4DA 4QJ4B 3L2IA 4YTTA 1UJQA 4J40A 1UR0A 5FJIA 4IJRA 3N3MA 4G7EB 3MDUA 2ZDRA 1UWQA 4D6CA 2G3FA 1S2TA 3GXIA 4Q8QA 2J88A 3J7HA 2FHFA 3BZGA 1EHAA 1US0A 1EFZA 1E1FA 1HZYA 5C9XA 2ODOA 4JTCA 3GDLA 3BTNA 5F2IA 2OX1A 2G50A 4EF9A 2ATSA 3QMRA 3CQ0A 2W9MA 4F66A 1FH8A 6TAAA 3F4DA 4CKQA 1BYBA 1J0YA 3G3MA 1J6PA 4Q4QA 3F4VA 3ZO9A 4GA8A 3G8RA 1RHCA 4CUCA 4JS3A 5IFPA 3N14A 1H5YA 1MXSA 5T91A 3XISA 2YCEA 1NP0A 1UASA 2G8ZA 3DFTA 4WSKA 2WMFA 1KC7A 1L6SA 3WNLA 4BF9A 3O1NA 1Q6CA 1UZDA 3PZMA 1FUYA 1DTNA 3E74A 1JCJA 2PAJA 1K1DA 4K37A 1QW8A 1B9BA 1TV7A 3W1NA 4DM2A 3L4VA 4B2DA 4XBSA 5E70A 1DPMA 1DBTA 1ICQA 1JDDA 3DH7A 1F61A 3OBAA 2ABAA 4JEQA 1K3UA 3CMFA 1FY6A 2PDBA 3W1MA 4S23A 4BF5A 4H04A 2ZUWA 3KXQA 2D0FA 3S5YA 3W1TA 2WMIB 5F1VA 1VFLA 4FLOA 4MDOA 4LUSB 3FW6A 4O16A 1JVNA 4IP5A 3NUKA 4GNJA 3SCNA 1F3WA 2ADAA 2ZUTA 4DXXA 3B06A 3W23A 1KCXA 3M46A 5CC5A 3EDDA 1B3WA 2PRMA 3WNPA 4P8XA 4OU1A 4DELA 3S1XA 4LB4A 3KFTA 3H24A 4NL1A 1PSCA 4Z1DA 3LZ3A 4DUWA 4H6RA 1K7XA 5AYZA 4PUMA 1XSKA 2ZX5A 5BOEA 4WGXA 1G4TA 1XL9A 1Y65A 2XZ7A 1OY0A 2CHRA 5A2AA 2FZBA 1XC4A 3JR2A 3NO1A 4OGZA 1H7OA 2PP3A 3OEXA 3PZOA 2ZE3A 1XPYA 4P7RA 4EE9A 3A9BA 4C6IA 4UTMA 3CUFA 3LHWA 4K2SA 4QR6A 3H53A 1UWSA 4DF1A 3FVDA 2J8FA 5CZSA 3UZZA 4NVTA 1FWIC 3MY9A 3OTRA 5I2UA 1XS2A 1M68A 1UWAA 1N55A 1XLEA 2D1ZA 3VCCA 1YXDA 2HVNA 4ORIA 3N34A 2FJKA 5L9FA 1W37A 2RH9A 4EWJA 1DQUA 3T55A 2O9OA 2VX4A 3OO2A 9XIAA 3HM7A 3GSMA 4DI9A 3DG7A 1G4PA 1V6VA 1R2RA 2YW4A 4S3DA 1FWTA 2IMRA 3TAOA 2G97A 3F5KA 2DT2A 3WLTA 2O9TA 2HBVA 3TYZA 2E4TA 4OHQA 2VX7A 4IX2A 2O9PA 4HSOA 4J2MA 3JUGA 3L21A 1N7KA 2YOCA 3EOSA 4PFHA 3WNKA 4REQA 2V2DA 2G96A 3TMLA 3SUSA 4FIRA 4IPPA 3EXSA 2ANUA 4UTTA 3EB4A 4K68A 3M5ZA 4JFWA 4PTVA 3SGZA 3T42A 3LCHA 2QJJA 4LUSA 1P1MA 2FTYA 3H21A 3L68A 4F9JA 4XZMX 4Z42C 4MIMA 1MRQA 1F7BA 4DWSB 1QNVA 3CV6A 1VBRA 3CL6A 1QPRA 1FVPA 4WY0F 2VEFA 3IANA 3CQHA 3LXCA 3VE9A 2CZFA 2W79A 5LNVA 1E4LA 1FHDA 3FYYA 4C60A 3BLIA 3GH7A 3GVGA 5CPQA 2PODA 3ABXA 3VDBA 4R7OA 5K3VA 4S2BA 4UTFA 1NF7A 1OX6A 4BQ4A 3TN4A 4DHGA 3NGJA 1EO5A 5D02A 3AIEA 1KRBC 2CZEA 3A3XA 5DBUA 3DFPA 3DFQA 5CPNA 2PWGA 4QLLA 4GLEA 3SN1A 3ZVIA 4J4KA 3DU0A 3GR8A 3O8AA 1AQ0A 1KFCA 1SJBA 2HMCA 3WQCA 4QSFA 1A5SA 4M1RA 1V5XA 1GGOA 2O7SA 2V8ZA 3S1GA 1W56A 3PP7A 3RPMA 3NZPA 3NQ2A 3CMGA 4PTXA 4E3TA 1QOQA 1PKNA 3OIHA 2C7FA 3VE7A 4MB5A 2OKOA 3RPTA 4EAYA 3EXTA 1XLAA 7REQA 3KCOA 1F3XA 3P8IA 1X1OA 4DZIA 3RFAA 1H4PA 3L12A 3WQOA 2VI0A 3NGFA 1IEWA 2XTKA 4Q8VA 3E2QA 1JCXA 3GG7A 2QMJA 3CHEA 3W7NA 1LROA 1IIGA 1EX1A 3CV7A 2YPIA 3LHZA 2W62A 2OQHA 1B90A 3CWOX 1A5CA 4AQLA 1A5BA 1WDSA 3IGHX 4US6A 4GVGA 3GG1A 3I7QA 2Q71A 1ZBWA 3KL5A 2IKIA 5G4WA 4I3GA 3R43A 1QAPA 3N13A 1SFTA 2GOKA 5I00A 5C6MA 2Z25A 3MJMA 1XH2A 3KEHA 3JZUA 2J25A 2V0TA 1VJIA 2XFRA 4ZO8A 2XIMA 3ENLA 1V0NA 1SW7A 2OOGA 1DJWA 2HRWA 2GVJA 2BLEA 1GWJA 4H1ZA 3WJSA 4M56A 1G4SA 5LZLA 3ZS4A 3USZA 1GHRA 3U2EA 5D33A 3CPRA 4C65A 4IH3A 4E2BA 4DLFA 1PKYA 3W7GA 3GX9A 1XIEA 3CH9A 3TWBA 3OJGA 4O0KA 1R3VA 2J24A 2HCVA 1J79A 3RCYA 3RM9A 4JZ5A 2DZVA 1V0MA 2DVTA 4GXPA 3P62A 4IUGA 1I4NA 5KEZA 1X96A 2CZVA 1O95A 1XUZA 3NR0A 4ZQOA 3TN6A 1MW0A 4JTAA 4B90A 1VQTA 3WH8A 5MKGA 4Y8FA 3BGJA 4J3SA 4LCSA 1UPPA 1GG1A 4K7VA 3AS0A 4QX4A 4R53A 3URAA 1EEPA 1HJXA 1R3QA 1QU4A 3GU9A 3QQ1A 3WFAA 3GH4A 3IJ6A 2NQHA 2X7WA 3U6WA 3UZJA 2WSYA 4AFYA 4GCAA 3VD7A 3PBYA 3V7PA 1IT8A 1GPFA 1EUNA 1V3LA 3TXZA 5A6KA 1ZTVA 3Q94A 3CS2A 3T2PA 4HOZA 3AIBA 4N4PA 4LBRA 1GQIA 4EXQA 4GOAA 4YHEA 4UUIA 3CHDA 1E6ZA 3S6TA 2PURA 1PYMA 2ZC1A 1KGWA 4URIA 4KWOA 4DZAA 3WMLA 3ANUA 3AS2A 3QY7A 5LSMA 3KVLA 1QI5A 3RAOA 2PCQA 3REQA 4EIVA 3IGUA 3ARXA 3A6OA 4F2UA 2QXWA 1UUOA 3LI0A 3RCMA 1WAWA 3QMSA 5ABFB 3MI2A 1OG6A 3LXAA 3EZ4A 3DFNA 3L65A 4DJFC 4PEKA 3EA3A 3H4GA 2AKZA 4O19A 4AXKA 4E2DA 5I07A 4GNKB 3L5AA 4E2VA 2E5BA 2PDGA 3QV8A 4MHBA 3UGVA 2RGMA 1P7TA 4AHQA 4UNKA 4AZCB 3RF9A 4MDPA 3LGEA 2VEPA 3IIVA 2R14A 3FNDA 2Z6IA 5CG0A 3MPGA 4HZ8A 1AJ0A 1QRQA 1Z69A 5D8ZA 1MFUA 3MQTA 2CFFA 3QEZA 3T2OA 4NP7A 1UKTA 4W8AA 3M0JA 1EGMA 3WUFA 3W87A 4PRTA 1P43A 5I3KA 1NWUA 2CZDA 2WZMA 1WB0A 3PULA 4LC6A 4PBFA 3VINA 5A5WA 2OGJA 2OVLA 4ACZA 4LRTA 4DVOA 3CWNA 4JYEA 5D38A 4A8NA 3UZ5A 5HMEA 4UFIA 1VFSA 2B7PA 1OGGA 1PX4A 3HPAA 3N3TA 5FSEC 1PUDA 4IX0A 2PDXA 3MANA 1JDEA 3P82A 4FHAA 1V3IA 4O1EA 4GWEA 3TMQA 2I9EA 3A23A 3QF0A 4JTIA 5TQLA 1B57A 1X1ZA 2GQ8A 3RM4A 1E72M 2VEIA 2EBNA 4P7QA 4Q3MA 1F76A 3PPHA 3VKDA 4KRTA 3WF4A 3K4WA 1EBHA 3T6CA 2ZRVA 2VRJA 1GCYA 4US5D 5H2ZA 4LS0A 1QBBA 1WE5A 3GR4A 3L0GA 4BQ2A 2IW0A 4TO8A 2J9ZA 4IIEA 3NSNA 1TO3A 3OZOA 7PTDA 4XKMA 3RN6A 1XRTA 2Z24A 3FDKA 2DSVA 5REQB 2WHMA 5ABFA 2WOQA 3MI3A 2PC8A 4GNVA 1VPYA 4LNYA 2BODX 3PVFA 2NSXA 4PMVA 1R47A 3BE7A 4NZCA 5LIWX 4KPLA 1V02E 4GI8A 2X30A 2VFGA 1DHKA 4GH1A 1WDRA 4LALA 3ID7A 1MO0A 4MFDA 2YDRA 1IIHA 4N02A 1W5PA 3THCA 1AD4A 2HSAA 3RO6A 4F79A 3M0KA 1IT7A 2BHYA 1BRLA 4XSMA 3T2QA 4I9JA 5IXEA 3IIOA 5I5RA 2XM1A 4TV6A 4E38A 3TE9A 2GWGA 4DXVA 1P7TB 3O6CA 1MI3A 3WD2A 5C2XA 3PTQA 4L1XA 1PTDA 4HK7A 3VNMA 5B7ZA 3WLJA 1R9XA 2HISA 1VGAA 4F0RA 2TPSA 4AZIA 1ML1A 3W1AA 2JK2A 2W4XA 3GH5A 4HBKA 5HR6A 3WO8A 1M65A 2WHLA 2ZXAA 3WF3A 2IQ0A 1JQVA 3H23A 2VM8A 3DAQA 4QNWA 2QCDB 1W9PA 3UD6A 5DCEA 3FJ6A 5DXXA 1JNEA 3KLKA 1W5NA 2NQ9A 3N04A 2HTMA 4US5A 3UESA 3WUGA 4ZEPA 4QJ3B 1H7PA 3GKFA 1HIZA 3TDFA 2OQLA 3B0PA 5CC6A 4L6DA 5DO8A 1FKXA 4PRWA 2J7GA 1TPFA 1UP3A 4XK2A 1Z89A 1G69A 5KZDA 2VKZG 3OBKA 4UQEA 4YTRA 3CEPA 2XVGA 2X42A 4ADUA 1TV3A 4V33A 3PZTA 1KXQA 1CTNA 2XVLA 3B9NA 3II1A 3CGTA 2NW0A 3PJWA 4Y96A 3BMXA 3AQUA 4O28A 1REQA 3NPWA 2VRQA 4UR8A 1V02A 1XWYA 4PC8A 4ES4A 4PMJA 4XKYB 3WLPA 3A4JA 1ZBKA 3KOYA 3QMTA 2NLIA 1HP5A 3VC5A 4DQWA 1XLKA 4QDWA 1FWDC 3CAVA 3CUHA 1W1IE 1AODA 3DZ1A 1BYAA 3HO8A 3GZAA 3W1RA 1HTIA 5HATA 5ABTA 1YKWA 1UD2A 4ZOAA 1K6AA 1NDVA 2PUZA 4IGMA 3KOZA 4HA0A 2CETA 3NSMA 3L2MA 4HA4A 4FEZA 1LTDA 4CNPA 2YBVA 4RDZA 3WDJA 1Q7MA 1GYMA 5EL1A 3W2NA 3WKZA 1OK4A 2QHAA 1E6NA 3NQBA 4M3PA 2Q8XA 4D8LA 3DG6A 2VFDA 4JN8A 2NXIA 5EBAA 4W9TA 2ZX8A 4R7WA 1E5NA 4CEUC 3JZEA 5U4NA 3EWZA 1EXPA 1JI1A 5HJXA 1OFEA 3NFUA 5HXMA 3IJIA 4L7ZA 4M5PA 2YW3A 2POZA 4IT1A 2J7EA 4PSRA 3NM1A 5A8MA 1MW3A 3L66A 4I5RA 5HK4A 3BICA 1W17A 2PI6A 6CGTA 5A69A 4B3LA 3L67A 4OZOA 4XD6A 1ONEA 2G3IA 3TNBA 3EOOA 1RH9A 1GJWA 2E8ZA 1OT1A 1R87A 5F4XA 3IAQA 1XSIA 2BHUA 2Z4GA 1V03A 3RO8A 2I7GA 2PWEA 4R34A 2H6RA 3NM3A 5TF0A 4XZWA 3S0CA 2O56A 3FN9A 1T0OA 4KIRA 1XW8A 4LVDA 3GO2A 1E5JA 1AVAA 2V5LA 3UJ2A 5E1QA 1EXBA 3PBGA 4IL0A 4L65A 3ES8A 4FR6A 2JKPA 2J4GA 2J7HA 2NV9A 3DI0A 4H9TA 3KBVA 1RJRA 3O07A 2WKJA 1L8PA 1TIWA 2JQXA 1VFHA 4IP4A 3AOFA 3C8NA 1J0ZA 1GOOA 2BWGA 2VT0A 2QQ6A 4PUKA 1I6NA 4GH3A 4X9SA 4S1FA 2XGBA 3O0FA 2XIBA 1H1ZA 1W8SA 4OQVA 2GDVA 2OR2A 4B2DD 1BYDA 1SM9A 1VBGA 2B0MA 1DJZA 4FXRA 5XIMA 5JBDA 2QGHA 1I60A 4D6FA 3B0VC 1FWFC 1MVYA 1Y0EA 2YGYA 4IPNB 4Y9PA 3BXWA 1V79A 2XZ9A 1T8XA 3NNTA 4QDPA 4JIHA 4TVDA 5JUVA 5SWUA 5GPRA 3R8RA 1CGWA 5HMDA 1L0PA 1OSEA 3E2VA 1EJVC 3AXXA 3K46A 2V81A 4D1IA 3FEQA 3UWUA 4YYCA 4EPKA 4GZEA 4ZBCA 3N17A 4G2DA 1XXXA 2ZRWA 3BG9A 1VJZA 4GKLA 1C92A 4ICCX 4XZBA 2GJPA 4KQNA 2BY2A 2X16A 4RLIA 1K02A 4XISA 3BARA 2Y8UA 3P5YA 2P0OA 4WJEA 3USBA 5BZAA 4ZB0A 3CIVA 1P6BA 2KZHA 1FQ0A 3W7JA 1M7OA 3MV11 4NKCA 4FALA 4W85A 5AFDA 2MNRA 2XH4A 3MUY1 1JJKA 1J6OA 3SUUA 4HNLA 3AMDA 4E4FA 4NG3A 1LWIA 1U22A 3CL8A 3COTA 8CGTA 4IF2A 4HA3A 4FP1A 2WCSA 1W1TA 1CPUA 2PP1A 3SUTA 2H9AA 3PFMA 5A3HA 4K1WA 5AC5A 4NY2A 3GNRA 4IM4A 2Y7EA 3S5NA 4AUBA 3LPFA 5XINA 3HQNA 3CT2A 2P8CA 2SFPA 3CWHA 4ZR8A 2PPGA 2A6NA 1CENA 1HJWA 1ICSA 3SADA 2WHKA 1CGYA 1QT1A 4RZ5A 2XSAA 1JZ3A 4XWUA 2ACQA 1K7FA 1W3IA 1W9DM 4E4UA 2D2JA 3W29A 3QC0A 1LM1A 3G1HA 5I24A 3Q37A 4DN1A 2Y89A 2WJFA 1ZJHA 3SIZA 2V2CA 3F4NA 3UBPC 2DQWA 4HK6A 3NAVA 4PMZA 1PBGA 3CBWA 3NOEA 5EY5A 3AHTA 8RUCA 4XZNX 3N19B 2A3AA 1XPGA 1NM9A 2A7RA 4QE5A 1ISXA 1FOBA 2YR1A 2DIKA 2QCGA 2J62A 4FR1A 1T99A 4IFKA 4IPLA 4TVUA 3K8KA 1WOAA 1MMFA 4JTGA 2GDQA 5HQLA 2VGBA 3FKRA 1JXJA 4QG9A 5H6HA 1GK8A 1OF6A 5LA1A 3TXVA 1S5MA 1JDFA 3VM7A 1F9CA 1XCXA 3A5FA 3QLDA 2VEMA 3VIOA 2ZBTA 1B2YA 2QDEA 4HPGA 3D47A 3W82A 2VOTA 3TC6A 4ZQCA 1C3FA 4ZA0A 1H62A 1L6FA 4HU8A 3H2MA 4NJKA 4Z2JA 3UR7A 1VYRA 2V30A 2XH0A 2ZRYA 4FO4A 3POCA 3ABSA 4Q8WA 2A3BA 3EEGA 5I03A 1Q5MA 4F0MA 3VFCA 3MSRA 1YXCA 4TV5A 3N15A 2F6XA 3I3EA 3KS5A 4AZ5A 4GY1A 1J2BA 4HNOA 2VO5A 3KOWA 1M3UA 1JZ5A 2CLLA 4FIQA 4HSHA 4KFPA 1RD6A 4PYSA 2H3DA 5F2LA 5CQ1A 2P88A 1JFHA 4KEUA 1ICPA 3B8SA 4UOJA 3R10A 1I2RA 1ISWA 5BYWA 1GTEA 1NAL1 1UUQA 3QHNA 3AZRA 4B9YA 4V27A 1UR4A 3APGA 4CCZA 2ZUMA 4GQQA 3R11A 3W7LA 3R25A 3W1XA 4MNJA 5I79A 4G8TA 1ONRA 4JQ4A 3VDGA 4GZ7A 3LEPA 1J5TA 1YMYA 3CQJA 3PB2A 4H9UA 2Q3OA 3S47A 3G2GA 4WF7A 4JX6A 3M0ZA 5FIPA 4WQ6A 1GEHA 2ZIDA 1V3JA 5KETA 2MUCA 5DX7A 4XVDA 3IJDA 2R6OA 1QHZA 3CK5A 3VO0A 3BG3A 3RU6A 2TSYA 2ZXDA 1CI1A 1YNYA 3MMDA 5JBFA 3QFWA 1LBFA 4C5YA 3V0UA 1VCVA 3EWYA 2VWSA 4QROA 3V75A 1BD0A 2D69A 1LOQA 1Q3NA 2WMKA 4FK9A 2FZ9A 4RZ4A 2X1SA 2EPNA 2V69A 3SBFA 3U8GA 5H8MA 5KZEA 2JFEX 1PJ9A 2Z0IA 1JZ8A 2RHGA 4GIEA 3TH6A 3UEQA 3WSUA 1YBQA 4DRSA 3HU7A 4C1LA 3MZ2A 1UR8A 2Z1WA 3BL3A 3VUSA 3E5BA 3VGBA 1EDQA 4IJCA 3ZSSA 2DFAA 1RXOB 1H5VA 3HIJA 1X6LA 2ISWA 1RJQA 1JPHA 1LUCA 1MSSA 1LBMA 1DXEA 1GOXA 4RUBA 1ZALA 3AFBA 4QDMA 4LY8A 5KMYA 3DESA 4M8UA 3FX4A 1J2WA 3KWSA 1JUKA 2YCLB 2NWSA 2W6RA 1XLBA 3HFYA 2YLAA 2WC7A 3W26A 4F2TA 4ZQPA 2ZADA 1F8IA 2NSOA 3BJSA 1EB3A 4JYFA 2YA0A 3RJYA 2DZUA 1I9CB 2P53A 2PDIA 3UR2A 2YXGA 3RX2A 1GQJA 3A4XA 1HJVA 1Z41A 1Q6LA 3WDRA 2C1IA 1PB0A 1G6CA 3ITTA 1NQ6A 3THUA 5FF3A 3OGSA 4CD4A 2EKCA 2WCAA 4I9TA 4WOZA 3VD9A 4MYAA 5CSUA 1PIIA 1JYWA 3N29A 4L61A 1QTWA 3T0AA 4FXJA 1TPH1 3NL5A 1R6WA 3FVMA 3A47A 1DWJM 3TA9A 3TA6A 4PTWA 2WVVA 3OIXA 4UNLA 2OEJA 4HYWA 2DIEA 5DMNA 3QZ6A 1YEYA 4HCHA 4RNHA 5GJMA 1FRBA 3PZNA 2QULA 4MKSA 1QHOA 4WCJA 4HPHA 4H01A 2WMJA 1D2KA 5D4YA 2J75A 2F6KA 2YCJA 3ZZ1A 4NZ5A 4GUIA 3VA8A 1CXEA 4M6QA 3TZNA 4PBEA 1JG9A 1FWHC 4YN5A 3HZ3A 3WMSA 2PDWA 1GZJA 3BJTA 1D8CA 1V6TA 1YTKA 2GJLA 2BOGX 4G5DA 1MQQA 5E5CA 4O4WA 1YTEA 1U5JA 3A5VA 1LYXA 4JCLA 3QTGA 4F8XA 3GBDA 1K9TA 3QKEA 3WK1A 5REQA 3QTPA 3SRDA 4L4LA 1CGTA 1JZ7A 1X97A 2JIWA 3PAJA 1M04A 4IFKB 4QRNA 1JCMP 4D2JA 3GE7A 4H2HA 6TIMA 3EA1A 4IJBA 1GVEA 1W1PA 2HK0A 3WQWA 3CL7A 1IZJA 2OZ0A 2WVSA 1OFPA 4ZQMA 3URBA 1DL3A 3C2OA 5CJMA 5DMMA 2J47A 4PUUA 1J01A 2QR6A 3S2MA 4NF7A 2QIWA 3GXFA 1YDOA 1TPB1 3R0KA 5C8BB