3G24A

Crystal structure of the mutant d70n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIANFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g24A00
3LBCA 3LTSA 3UNDA 3TXVA 1OX5A 2GUUA 1WYIA 3OVPA 3QZEA 3LHYA 1F6PA 4PC8A 1JQXA 1KM4A 3C8FA 5AHMA 3TU9A 5SWUA 1Z48A 4LW7A 4IMDA 4LVBA 4MZ1A 1VHCA 1D9EA 3G8EA 3PG9A 3VFLA 2YX0A 1VR6A 1QPQA 4JTEA 1OFPA 3N73A 3ZWSA 1IGSA 5D30A 4GNJA 4MY8A 5T26A 2Z1BA 3NPVA 1W5OA 1DORA 3W75A 2WPBA 3O16A 1QFEA 2FQIA 4O1DA 1JCYA 1TPC1 3NQ2A 3ZR4A 3TKFA 1TPVA 3T4CA 3QW4B 1TRDA 4WXYA 4LOCA 1W54A 2CZEA 4JX6A 3PS7A 3VKJA 2C16A 1VGAA 2WV8A 3R5EA 4JTJA 1DBTA 1T96A 4O10A 3GX9A 1T99A 2GVLA 1KA9F 2E1DA 2OZ0A 1JVNA 3P67A 1ZENA 1F05A 3GB6A 5LNRA 1KFJA 3C3NA 5HQEA 4HSOA 3A22A 4WZHA 3L5MA 4UTUA 2P0OA 1NF7A 2DJLA 2CLKA 3EXTA 4AWUA 2TRSA 4JD4A 2Q8ZA 1TIMA 3CEPA 4FNRA 1YDOA 1EPXA 3A23A 1OG0A 4O12A 2A6NA 3ZS4A 3BV4A 4JXCA 1P1XA 2VFGA 2ZZ3A 4JTTA 2EGZA 4MJZA 1DV7A 3R89A 5AHEA 3M1ZA 3B0PA 3G0SA 3O1NA 1TV5A 4O18A 3IIXA 3STCA 5KSWA 3STFA 1MXSA 2YGYA 2WNNA 1XXXA 3P8JA 4MY9A 2J9YA 2G5WA 3NNTA 3NO5A 1OX6A 3W74A 1MEIA 3O15A 3LI1A 1N55A 4MZYA 3W76A 5EA9A 3QSRA 4N6FA 3VI2A 3BLFA 2QJHA 3W7PA 1WDWA 1H60A 4O8RA 3UWYA 1S5WA 2NWRA 2YW3A 2H8ZA 2QAPA 1I2QA 3AJXA 5D2YA 1VPXA 3M7WA 5CKSA 1J2WA 4QISA 4ZQPA 1W3NA 3GZ3A 1R30A 2V82A 3KX6A 4YWIA 1JCLA 3MYPA 1JULA 4O17A 2V5BA 3PUOA 2UV8G 1OJXA 1KTNA 3QH2A 1WAUA 2NXHA 4Z1CA 2Y63A 5AB3A 4FXSA 4A29A 3TNOA 2VFFA 4WY0F 3AO0A 3S1XA 3TCEA 1LM1A 5KZEA 4R53A 4RXFA 5CPNA 5F1UA 1OK4A 4Y96A 4JDBA 3W1XA 3GDTA 2VKZG 1IXOA 4JX5A 2YYUA 4GUJA 3P61A 2QCEA 1G67A 2ZTKA 4UTMA 1O94A 1WQ5A 1S5TA 2CLFA 1B9BA 4JTIA 2Y88A 5IBXC 1BKSA 3OHIA 5CSSA 1HO4A 2NX9A 2WQPA 3CEUA 3G1XA 4ONVA 1XCFA 5I3JA 2ZRWA 4IJBA 3DBPA 3HPXA 4IMGA 4HNUA 3W7QA 2CLMA 5AFDA 5G4EA 1VH7A 5GVJA 3KRZA 2CFFA 4MKNA 3S6DA 2YYTA 4E2DA 4CNOA 2V0TA 1I8JA 4WOZA 3MP5A 1KM5A 2NUYA 4AEOA 3M5XA 1W5PA 3L0GA 1TQXA 1P5BA 4HNVA 3I7RA 4Z08A 3B03A 3S1WA 1NAL1 4O0KA 4N4QA 4M6VA 4OBTA 3LCWA 3GXTA 2B7NA 1DHPA 1PHWA 1TTJA 2AGKA 3LX9A 4O4VA 4FIQA 3ATZA 1K3UA 4UTHA 3U8GA 3GNDA 5I3FA 3BPWA 3GXPA 5DCBA 2QUTA 3O07A 4B5NA 4KWWA 3CC1A 3NPUA 2RDWA 4HPXA 1I45A 3IEBA 3PUDA 1NVMA 1OABA 3W7OA 2WJZA 4AH7A 5D09A 3O6YX 3EB2A 2Y89A 1R47A 4FO4A 3O6DA 1QO2A 5MHBA 3A24A 3IGUA 2J9ZA 1CX9A 3T40A 1KV5A 4NJGA 3WFAA 2GQ8A 3RK8A 4RZ5A 1TV8A 3EX3A 1UASA 3TE9A 1GEQA 3BW4A 4MIMA 3UZ5A 3U2OA 3SIZA 2P10A 2BX7A 5AHLA 2CW6A 1O5XA 1JCJA 4RLIA 3HMJG 3W7IA 4ADSA 2YCEA 4LV9A 5IM51 3M5ZA 4AXKA 1N7KA 3I65A 3NL5A 4DPPA 2RHGA 1SPQA 2DORA 1ICSA 3LB0A 4N6EA 3G1HA 1K8YA 3DAQA 2BTMA 1OFRA 1TPH1 3KRSA 3L2IA 3PB2A 4XBSA 1OF8A 4K6AA 4ZQOA 3C52A 1ZNNA 3FLUA 2XN1A 3W7KA 2A2IA 1ZAJA 3GVGA 2FFCA 1WA3A 2NUWA 1XBZA 1THFD 3C6CA 4JGDA 1RV8A 1HFBA 1A5CA 1SW0A 2PRHA 2A85A 4DBDA 1OYBA 3SECA 3WJXA 4FNQA 1LBMA 3LRKA 5HJLA 1L2UA 5EMUA 2X1SA 1YXCA 4MUZA 3RLUA 1L6YA 3LBMA 4ZQMA 3WJZA 3IGXA 4UUIA 3W2LA 3N2MA 4KWVA 4UC5A 4S2BA 1OFAA 4EF9A 4K7VA 4UFIA 3KVLA 1O95A 1SZFA 5E93A 3WK1A 5D2VA 3LCXA 1SSDA 4R34A 3QM3A 4UCGA 2DZVA 2XN2A 2ZZ7A 4JN6A 2ZZ4A 4O50A 3MI2A 4LS0A 2FJKA 4PFMA 1WX0A 2BZNA 3TR2A 4JTKA 3BW2A 5DXYA 3MBDA 4EF8A 1ALDA 2YDAA 4XKYA 1FWSA 1FDZA 5I3GA 1RR2A 4IPIA 1XKYA 3PM6A 2DZUA 1QDSA 2E6DA 4NVTA 1M7OA 3L65A 3P5ZA 4NZJA 5EBUA 3TK7A 1B57A 4L4MA 1R2RA 3NL6A 5DBTA 5DCDA 3RMJA 2RDUA 3HGSA 3NQDA 3QF0A 4QSHA 3V1PA 3HG4A 4A22A 4XZ9A 5HNRA 3W2KA 1XUZA 2FTPA 4K38A 1ME8A 4N2YA 1KBIA 1JUBA 3QFEA 3IVSA 3W2JA 5HR7A 2GVJA 4FNUA 2J6XA 4FXRA 1KFLA 3W1AA 3L68A 4GUHA 1ZCOA 1D3GA 3KRUA 1Z42A 4AWSA 4JY8A 1OFEA 4LC8A 1TCDA 5DLCA 3PSVA 5AOUA 3W7MA 5FEPA 1LLZA 2ZA1A 2ZA2A 5BRBA 4POCA 3G22A 5FEWA 5KTLA 1Y0EA 4GRSA 3TDFA 3W73A 1UJPA 3HGRA 1ZY9A 5AC7A 4G1KA 4UFKA 4HHPA 1FWWA 2A7RA 3HF3A 3LOTA 2KZHA 5H91A 4DF0A 3ZWTA 3LV6A 2ATMA 2E6FA 3IIZA 3UY7A 5BW6A 3M47A 3FEMA 3QMRA 3YPIA 1TTIA 5K9XA 3G3MA 1RQEA 3MJYA 3DXIA 2HSAA 2ZYFA 5EL1A 1KM6A 1VC4A 3S1VA 4UTWC 4IX0A 4DF1A 3BG9A 3NYZA 1GYNA 1T0OA 4JTGA 4H6KA 1N8FA 4GBUA 3V75A 4EIVA 3A5FA 1VZWA 2E5BA 1C29A 3KOFA 3GNNA 2WO5A 1W8SA 3JRKA 4ML9A 4QIUA 1MEHA 4O14A 1IF2A 1AL8A 3N9SA 2FPVA 3G0XA 3I7SA 3W7EA 2CZDA 4PTNA 2C1HA 5LGXA 5ABTA 5C55A 3KHJA 1QPOA 1PCKA 3QMSA 4UMBA 2ZZ2A 5F2IA 5FF7A 5L6UA 1SO4A 1W37A 4WJEA 3EX4A 3E9AA 1GJPA 2E09A 1VCVA 3LDVA 5AHNA 4UXDA 5F4XA 1T8XA 2Y61A 1YDVA 2CLLA 4MYXA 1VLWA 5KZDA 3OBKA 1MO0A 1GZGA 3OEXA 3THAA 1KTBA 4DBEA 2JGQA 4UTKA 2NUXA 4O1AA 1OYAA 2QEZA 4O0ZA 1EX5A 4OU1A 1YTDA 2VFHA 4QM1A 2J27A 2R94A 3L0KA 4GC4A 4TMCA 1VCFA 3LHVA 1M7PA 2EAWA 4OWGA 1XI3A 5CSRA 1K7EA 2GVGA 4WY0A 1FCBA 1K03A 3HGOA 5TQLA 1YADA 3TC6A 4E2BA 2FB2A 2QAFA 4GUFA 3TQ0A 1XDLA 3EEGA 4DO4A 4WD0A 3HG5A 3DKLA 5DCEA 3OVRA 2WNQA 3U6WA 3UY8A 4FNTA 1W31A 3T44A 2B0MA 1LRTA 4I7VA 3ANYA 4JTLA 2JKAA 3I7QA 3THQA 3C2VA 4O16A 2NV2A 3HIJA 4UMCA 2EHHA 1GG1A 4O28A 3TJLA 2DZXA 2NLIA 3IV3A 3L9CA 3TMLA 3HO8A 3LGEA 4AF0A 5AHFA 4KFNA 1A50A 2J88A 4JICA 4PA8A 2A6LA 1JJKA 3P60A 3Q37A 1KFCA 1OF6A 1SSGA 1DOSA 3SGUA 4RX0A 4CNNA 2Q8LA 3P82A 3SR7A 4JNMA 3LXAA 1LCOA 1M5WA 2Y7DA 3C0JA 5CGQA 2Y62A 4O1CA 3DHFA 4MVAA 3F4WA 1JCXA 5D02A 1ICQA 1FXPA 3PC0A 4Q4KA 2ZDRA 5K4ZA 4RCXA 3W1RA 1EIXA 1Z44A 3QQ1A 1SZEA 1LORA 3LCGA 4R33A 4ZQCA 1P0NA 4WXZA 3ZFHA 3N9RA 4GJ1A 2OT0A 3EWZA 4BWLC 3LXCA 5CG7A 4CQ9A 2QKFA 4M7TA 3NQ6A 5HULA 5K4XA 2QDHA 4LS2A 5D38A 1GTHA 2E68A 4IWWA 3Q58A 5DY2A 3BG3A 2V2CA 2QUVA 3M5VA 1XBVA 1VLIA 3C2EA 1VRDA 5F2MA 1I2RA 2WSYA 5F1VA 5D03A 2VEMA 1QCWA 4MPQA 2ZTJA 3NPWA 1HL2A 1M6JA 1Q6OA 1EEPA 4QITA 1B3OA 4MJMA 4EOUA 3OG3A 3SJ3A 2NX1A 3WJSA 4UTJA 3DU0A 3T7VA 3VE9A 3N19B 3UZJA 4TO8A 2XN0A 1YDNA 3IRDA 4D2JA 3GAKA 4LNYA 1ADOA 3WK2A 4UR7A 3UWVA 2JGYA 1UCWA 3DKJA 2VELA 3Q94A 1KFEA 3TX9A 3W23A 1J4EA 5A5WA 3T55A 4WX2A 3DI0A 1ZHAA 3GKAA 3BK0A 3W7LA 3PVFA 4JTSA 4YMZA 5LNSA 4AAJA 4XTIA 6ALDA 4ALDA 5G1YA 3G1DA 1LROA 4DEFA 4GWEA 1KTCA 2E5CA 3MBFA 4AWTA 1WOBA 4NX5A 1H7WA 4NJHA 5DBUA 5C6MA 1DQWA 4JEQA 3PSWA 3TV8A 1TQJA 2WKJA 1TSIA 1SU5A 4NU7A 4UR8A 3G1AA 3LHWA 3UQNA 3CHVA 1SR9A 3PUEA 1KM2A 1Q6RA 3GLCA 4IMEA 2QR6A 3I6RA 2QJIA 5J5RA 3BGJA 2GJLA 5HUOA 2W6RA 3EWWA 3EXSA 2R8WA 1GVSA 4DO6A 3MHFA 5HMSA 3B0UX 1L6WA 5G4WA 1XL9A 3R12A 1P4CA 3LHZA 2Q3RA 2FB3A 3CU2A 1YPIA 1OFBA 2X1TA 4NXSA 4JYEA 1QOPA 1DL3A 3A21A 4O15A 4UTTC 3LCLA 1MEWA 3O06A 1OYCA 2DJXA 3T78A 1ZJIA 3A9IA 3O8AA 2A21A 2TPSA 2VEPA 2A7NA 3W07A 3MHGA 1IXQA 1MZHA 2A1YA 2B7PA 2FPTA 3W1LA 3GR7A 4NXKA 4IGHA 1LTDA 4JIQA 2H8XA 3NQCA 5I3IA 3I68A 1H62A 4U28A 3LCHA 3CPRA 2PCQA 3W72A 1KLZA 4IPJA 3NQ7A 2ZZ5A 3M0ZA 5LGZA 7TIMA 1WBJA 1SZGA 3TW6A 3CQ0A 5K3VA 3P81A 1YXYA 4ICNA 4IXHA 3FJLA 3N34A 3VCRA 3QMTA 3F1QA 3W1UA 1EP2A 2WOQA 1TPFA 4Z0SA 5TBOA 4GFSA 3B06A 1PL9A 1VS1A 1EWDA 3GDKA 1SO6A 3E02A 4GE8A 4BK9A 1JQVA 3SSJA 3UYCA 4YCPA 5F2LA 1AMKA 3UWQA 2FIQA 3PWAA 4FNPA 4RKAA 3WK0A 3UXAA 3E49A 4HNTA 1H50A 4HIBA 4LWWA 4DXVA 5AYZA 1XC4A 5KMYA 1XBXA 1EA0A 3C2FA 3W1PA 5D2WA 1G69A 1DKWA 1C9DA 3M5YA 2V2DA 4XBKA 2AQWA 2YPIA 3N3MA 1OX4A 2DP3A 1E51A 1FBAA 4AVFA 1FXQA 3LV5A 1XM3A 5U7SA 1G4EA 3B4UA 3W71A 1OFOA 3BARA 3NM3A 3F03K 3G3DA 3HBLA 4I7WA 2ISVA 1H7RA 1UUOA 3STGA 3KXQA 1RQHA 1Z41A 1A53A 4K36A 3E0IA 3A5VA 5LZLA 4BR1A 1V5XA 1VYRA 2QCHA 2DU2A 3W9ZA 3TW7A 3S8HA 1XBYA 3LCFA 3DENA 1EUNA 4OQVA 3PAJA 2NX3A 3IVTA 5KINA 2YZRA 4MFEA 3IIPA 3SFKA 3NZRA 1IXPA 1D3HA 2C19A 3W84A 4JYDA 1JCMP 3EKLA 1H51A 5DELA 2OCZA 3P74A 3M9YA 4I9AA 3HGJA 4JS3A 3LRMA 3B04A 4PEKA 2GJNA 4X22A 5G2WA 3QPYA 3C2RA 4LVDA 2VEKA 3GYEA 4BI6A 3S42A 1F76A 1OHLA 3QRHA 3NQMA 1I2NA 1S5VA 3EX6A 3G1VA 1SW3A 3NQGA 2V30A 1KW1A 3W88A 3LTPA 3NAVA 4XKYB 3TQKA 1K7FA 3M41A 4X2RA 1GWJA 2XFWA 3O05A 3NGJA 3IVUA 1H1ZA 2V2HA 1ME7A 1DJQA 1KM3A 1GT8A 3SI9A 4PL1A 3W70A 1KV8A 3CT7A 1PCWA 1IXNA 2C14A 4M6QA 4FX7A 2ZRYA 3G0UA 5FI8A 1WOAA 4KFPA 1X7FA 4HPJA 2GPTA 3W7DA 1SO5A 1TPDA 3QC3A 4C1KA 1L9WA 1MSSA 4P2VA 5HWMA 1ICPA 4HSNA 3TFCA 2Y85A 3M16A 1TPEA 2B7QA 4XTDA 5IBXA 1FCQA 2Z0IA 3TROA 4NT0A 4XWUA 2CWNA 2H3BA 5AYYA 4LVAA 1PVNA 2FPYA 4LVFA 5AC8A 3GXNA 4O19A 3K30A 3W6YA 4LRSA 5LNVA 2F84A 5LKYA 1S3HA 1SFJA 1UBSA 3S5ZA 5FEZA 3GDLA 2ALDA 1O4UA 3NQFA 4RV8A 2I14A 1TYGA 4CNPA 3BG5A 3JS3A 1RQBA 5LHFA 1PE1A 2VENA 1Q6LA 5BOOA 3IGSA 4N4PA 3EKZA 3P80A 1H63A 1W0MA 3FOKA 1FUYA 1XUUA 4FNSA 4W9TA 1ZFJA 3QSTA 5L9FA 5FESA 1ML1A 2P1FA 1WXJA 2ABBA 1SQ7A 1JUKA 3INPA 3W7RA 2C18A 1DJNA 2X2GA 5EKYA 1H7XA 1B4KA 5A8GA 5BNKA 4DELA 3UPBA 4OHQA 4BF9A 1BTMA 3UWWA 3R2GA 4ZL1A 1ZALA 2QCFA 5J5DA 4AHOA 5D32A 4IX2A 3BLIA 1U5JA 4N9EA 3USBA 1OFQA 3CWOX 1G4SA 3B05A 4NNBA 3W7JA 4C1LA 1KM1A 1AW1A 1AG1O 4LS1A 3PF3A 4RK8A 3PG8A 2Y6ZA 4QAIA 1IIHA 4N9CA 4GUIA 3NA8A 1QPNA 3FJ6A 1CI1A 2W79A 3BLEA 3L0NA 5F2GA 2RFGA 5I3HA 4TIMA 3PBUA 2HTMA 2ATSA 3TXZA 4EVZA 1KFBA 3MO7A 1EUAA 3WJYA 4IXXA 3NL2A 4HN4A 4H4IA 4A21A 1VCGA 2QCDA 4FB7A 3NM1A 2GQAA 3NQ8A 4PODA 2RDTA 2NWSA 1I2OA 4Z1AA 3HQ1A 5FF3A 1W1ZA 1KLYA 2BXVA 5EYWA 3GIYA 1X8FA 2OX1A 5F4SA 2PRMA 3E12A 1C8VA 1TJPA 1G7UA 5LHEA 3ABOA 1VYPX 1LRQA 3NVTA 3TH6A 1F74A 4BI5A 3IIOA 5LSMA 2J9XA 4U4MA 5KZMA 3NQAA 3QJAA 6TIMA 5HWNA 3EWUA 4MLRA 4AHQA 4IMFA 2VFIA 5K9DA 3ELFA 5D2TA 4M5PA 1RZMA 1ZAHA 2GQ9A 2QUUA 1Q45A 4HNNA 1GYLA 3G1YA 5CPLA 5D05A 2FLIA 3W85A 3W7HA 1TB3A 4MY1A 1U83A 2Y7FA 4MOZA 3DFPA 2EPHA 3EWYA 3WK3A 3LI0A 1F6KA 1NSJA 2BWGA 4OE7A 4YCOA 3C61A 3KAOA 4WY0B 4EWND 5I3KA 1TJRA 2DZPA 2WSQA 2V5LA 5K2ZA 4Y8FA 3PR2A 3W2UA 4WUIA 1ZAIA 3W83A 3PY2A 3W2NA 3TAOA 1AW5A 3LLFA 1GOXA 2VEIA 3OA3A 1F73A 3C2OA 3C4UA 3EXRA 3OIXA 4MFDA 4QQ3A 5HINA 1EWEA 3TJXA 2ABAA 4FF7A 3F4NA 2QCMA 1XDMA 4N9BA 1HO1A 1R2SA 2VOMA 4S2CA 5EPDA 1QOQA 1W3TA 3LTYA 4Z1DA 1FX6A 4M19A 1FQ0A 2ZBTA 4AF0B 5HR6A 3UXDA 4Y90A 2WNZA 2NXGA 5LNWA 4HKPA 2ZRXA 2CZ5A 1JCNA 1A5SA 3UWUA 5DN1A 2C15A 5FEXA 4Q32A 3N2XA 2ZZ1A 1VQTA 3MHUA 3RNDA 3CWNA 2Z2UA 2CU0A 4H3DA 1FCUA 1PS9A 1GG0A 2CLIA 5TIMA 2EF9A 1LYXA 3W7NA 1YXDA 1SZNA 3FKKA 4J9JA 1TPUA 4MLJA 3ABQA 1TTQA 4AHPA 1F5ZA 2JBMA 5G5IA 1K7XA 1YPFA 4ZVJA 3FA5A 2C3ZA 1LDCA 1W5MA 4P61A 2ISWA 4UFJA 2ISSA 4QNEA 2H6RA 4K39A 2O7QA 5BMWA 1LZOA 3FYOA 3P8IA 2IQTA 1HUVA 4FX6M 4IMCA 4O4WA 4K8HA 5D2XA 2PE4A 4UFLA 4E38A 4XUGA 5E1QA 1R46A 1W56A 4WOQA 4DPQA 4YXGA 1G4PA 5F4WA 1PV8A 2C13A 2Q3OA 1EP3A 1TTPA 4ZQNA 3S5OA 3DFSA 4Y9AA 3NPXA 4O54A 1L6SA 4UNKA 4O1BA 5CZJA 1X1ZA 3L5LA 1A5BA 1K8XA 4ZZ9A 5G1TA 3UPWA 1YTKA 2DZWA 3GK0A 2O7SA 2CLOA 3FIGA 1ME9A 3TSDA 1DQXA 4JY9A 8TIMA 3G1FA 1KFKA 1LBLA 1LOQA 2CZFA 3H53A 3CB8A 4K7YA 3NQVA 1BEUA 4A2RA 2X1RA 3LXBA 3MWAA 2A7PA 2V9DA 4JYFA 2E6AA 4UTWA 4UFHA 3GR8A 1H7NA 4AB4A 3RLVA 3NDOA 4JDYA 2VXNA 3NEVA 4LTSA 5CZ0A 1YYAA 2Y7GA 2OMAA 2AAMA 4ORMA 2F7FA 2QDGA 3DI1A 3EWBX 3SZ8A 4CQAA 4R7JA 4GXMA 3CLMA 5U4NA 2EKCA 4NUWA 4LU0A 2ZFAA 3G18A 3DFNA 2CLHA 1UUMA 3D0CA 3CIWA 1Q6QA 2HMCA 2CLEA 3UWZA 5D33A 3KFTA 4FX8A 3C56A 1BWKA 2TSYA 1GVFA 3DHDA 1G7VA 4NZFA 1G6CA 1W5NA 3CIXA 1O60A 4JTUA 2I9EA 1QR7A 2JKEA 2RKXA 5C54A 3PB0A 1FY6A 1LBFA 3H55A 2Z6JA 5AYXA 3NOEA 3W7CA 4OGZA 3EX1A 4TR9A 2HS8A 1V7YA 4O52A 4DO5A 1JUEA 1QAPA 1X1OA 1RD5A 3W3OA 2LLEA 1NF0A 4Y6GA 1ONRA 1R2TA 1F2JA 3MI3A 4IOTA 3HB9A 4DF2A 3GDMA 3IIVA 3QEZA 4JTHA 5G2IA 3GAYA 4TX9A 4RR4A 1QNVA 2ZRVA 4UNLA 1AW2A 4M7SA 4LRTA 1FDYA 2VFDA 3GKFA 3RFAA 2Y70A 3LCIA 1YLVA 3SY5A 3P5YA 1TO3A 2QCCA 1OVDA 4LVGA 2E6YA 4LV4A 1LOSA 1FWNA 3EWXA 2I1OA 3RF9A 4JX4A 5D37A 3BGGA 1GVOA 3LLDA 1EB3A 4YLWA 4ZQRA 3TA6A 2TMDA 2B4GA 3L67A 3NXFA 3TSMA 3L21A 1A5AA 3MUXA 3O63A 1SFLA 3QW3A 1JR1A 2ZA3A 3LHTA 4FIRA 3EX2A 4PH6A 2NV1A 3HJZA 4MYAA 5LNUA 1TV7A 1TREA 1RPXA 4ADUA 1SUXA 4ZMGA 1VJIA 1KBJA 5CZTA 3WJWA 2E5DA 5FF0A 2PRLA 5CZSA 3TFXA 1OX4B 4RZ6A 2RH9A 4HT3A 4OV4A 3S0CA 3DZ1A 3S9YA 4NJIA 4ADTA 5K7JA 2PURA 2YSWA 3ABSA 3PBYA 2A5HA 3BVJA 5K9CA 3FYPA 4PCFA 1VHNA 4A3UA 1LP6A 3KVMA 1G4TA 4KFOA 1KM0A 3OVQA 1QPRA 2B7OA 4O57A 4CLMA 1Q3NA 2BLEA 2QCGA 5KITA 4BWLA 3STEA 4NNAA 4BFAA 3R13A 3LHUA 3LERA 2OT1A 3H54A 1WBHA 4UTIA 1TMHA 1QMLA 3HPZA 5C5YA 2DZTA 4Z1BA 4Q33A 2QCNA 4XQ6A 3MP4A 2H90A 4LT9A 4NNCA 2D73A 2JKPA 2VFEA 3TIMA 2R91A 5D04C 3SW6A 5BMXA 3VNDA 1JRBA 1LLWA 4DQWA 3VE7A 1O5KA 1OFDA 3TC7A 3S5NA 4UIOA 3W87A 1FDJA 4ORIA 3JR2A 4WQ6A 3W1TA 1GTEA 3QPZA 3M44A 3M43A 3G1SA 4YL2A 4O13A 1WV2A 5HWJA 5DXXA 3TSBA 4Z0JA 2YFOA 1QWGA 4S1FA 1J5TA 3W1NA 3KVKA 1XFBA 5HUPA 3CTLA 4IQLA 3LM7A 4FEZA 4KKXA 4FHAA 4TU1A 4O53A 3DFOA 2ZRUA 1GPWA 4NQ1A 5H2ZA 2GOUA 2QF7A 4JTFA 1SO3A 1I2PA 2A0NA 4UTLA 1QO5A 2A4AA 5FF2A 3HOJA 3QYQA 2QCLA 3FFSA 2G95A 2NZLA 3PBWA 4BI7A 2X30A 2V81A 1NFBA 1FWRA 2J24A 2BSLA 1W3IA 2QJGA 4X9SA 5AN7A 3BW3A 1YTEA 2G96A 4X3ZA 2WSRA 1EP1A 2X16A 3MP3A 1HG3A 2ZZ6A 1F7BA 2ZCGA 4NJJA 3KVJA 3LRLA 1K02A 3TQVA 1VYSX 3N14A 5AHIA 4IUOA 3W22A 1FWTA 3HPSA 2YR1A 1H7PA 2W0UA 4NX0A 1LRNA 3L5AA 4K37A 2C6QA 3P7YA 1PIIA 2OJPA 3W7GA 4LUJA 3W86A 1JRCA 2R14A 3TMQA 3E96A 2Z6IA 1I4NA 1B4EA 1AL7A 2DZSA 4N9DA 2Y7EA 4UTTA 1H1YA 2HS6A 5AC6A 3RU6A 3HG3A 5EY5A 1UB3A 1OK6A 1IIGA 3SGZA 4RJEA 3DH7A 4M6PA 4E0CA 1NEYA 3TUUA 2ZRZA 2C0AA 3FKRA 3NR0A 3W1QA 3GDRA 1GVQA 3B8DA 3FS2A 3S1UA 3L66A 1CW2A 4PL2A 1LOLA 3ABRA 2TYSA 3Q2DA 1HTIA 4RXGA 1SW7A 4N02A 3G8RA 5DY3A 3G24A 4K8EA 3NZ1A 3PBVA 3M6YA 5CPOA 2YW4A 3QQ0A 3S5YA 2H3DA 1FCVA 4CCCA 4LC6A 1TPB1 3DFTA 3NL3A 4LUIA 5E0KA 1GQNA 3NG3A 1RVGA 5FF4A 4OT7A 4UMAA 2QCDB 4LY8A 2JK2A 1H5YA 3W2MA 1TPWA 2VC6A 1GVRA 1X6UA 4RZ4A 3ATYA 3PULA 3TAKA 5C2XA 4TMBA 2V8ZA 4MZ8A 3P62A 3CM4A 4AMAA 3BO9A 4QJ1A 2G97A 1P0KA 2NXIA 3MYOA 3O6CA 4O11A 3MW7A 3HG2A 2X1UA 3UD6A 4I7UA 1TRIA 4L4LA 1PHQA 3R8RA 3NQEA 3DGRA 1AK5A 1H61A 4CCEA 4A2SA 4UFMA 2PC4A 4OV9A 1BWLA 2YFNA 4CQ8A 3P84A 2YXGA 4JIPA 3MMTA 5G2HA 4CCDA 5CPMA 1K8ZA 1W5QA 2E77A 4JR5A 2FDSA 3W1MA 4GUGA 2ZQ0A 4NJKA 3DFQA 4QNWA 3B0VC 3MI6A 1H7OA 1DVJA
chains in the Genus database with same CATH superfamily
4QROA 3WF4A 5EMYA 1CXHA 1OZQA 1JDAA 3IJ7A 4UQ9A 2FVLA 3B4YA 2B31A 3LHYA 4JCMA 4OKDA 3GC2A 3T2OA 2PGWA 1OCNA 2YX0A 5C0QA 3W0KA 1G5AA 3SCVA 4GNJA 4MY8A 4J3SA 1W5OA 1DORA 1LWIA 1UP0A 3ARTA 4YVVA 3ZR4A 1TPVA 3QW4B 4IPPA 4WXYA 1V77A 2CZEA 1J96A 1VBHA 4CNTA 3VKJA 4GY0A 4JTJA 1T96A 4WGHA 2YKKA 4O10A 1I1XA 3LENA 2INFA 1JVNA 1JI1A 1RUSA 1KD0A 2IQ0A 2E8YA 4D8AA 1A0CA 1KQZA 5MF5A 3MSRA 3R94A 1FKWA 1KFJA 4DAIA 1SMAA 3L5MA 4ML4A 1NF7A 2DJLA 2VZVA 4Q4SA 3EXTA 3LSBA 4WDXA 5E0FA 2BNJA 3BCJA 5AVNA 4JD4A 1J0KA 4CD4A 1YDOA 4L9XA 2A6NA 4PE8A 3TW9A 4ACZB 4OIFA 3IPWA 5CC7A 2OB3A 4DYKA 2WHKA 3MA8A 3O1NA 1XKJA 2FZBA 1YNYA 4FI4A 1TX0A 3EWCA 3PZMA 3P8JA 2J9YA 7REQB 1EJ7L 2XJ7A 3GTHA 2EJ1A 2VRKA 3KOWA 1AQFA 3W76A 4PUUA 4ZXLA 4PZVA 3VI2A 4PCPA 2QJHA 1H60A 2DIJA 3UWYA 1RAKA 1X6NA 4Q6XA 4G6CA 3PN8A 3AJXA 2RJGA 2XVGA 4Q8UA 3KDNA 1DXIA 5BRQA 4R7OA 3KX6A 4S3EA 4MG4A 5CPQA 1JULA 4I9MA 3DDMA 3PUOA 3S6OA 1HJVA 2FGZA 2WZMA 2PSNA 2NXHA 2Y63A 1RHCA 1O5RA 2WB5A 3HV8A 1FHUA 2ALRA 4JIEA 1AH3A 4WY0F 1KXQA 4RXFA 1DJIA 2O9OA 4LUTB 4Y96A 1J10A 4X9YA 3GDTA 3UYIA 3CS2A 4WRHA 4UNIA 1Z6KA 2G3IA 3P61A 3AIRA 4RE3A 2XZ9A 1WQ5A 1S5TA 1B9BA 4JTIA 5IBXC 3HFYA 4EAYA 1BKSA 1MI3A 4QDPA 3OO2A 9XIMA 4ONVA 4FPSA 4IJBA 3EAUA 4PYSA 2BODX 4HNUA 1J93A 5G4EA 2PFHA 3KRZA 3VU2A 2YYTA 1I8JA 4WOZA 3KOYA 3L0GA 4AUBA 1R86A 1TQXA 2ZUNA 1ZB5A 1VJSA 4FR1A 3LEPA 4Z08A 3S1WA 4M6VA 2KX9A 4OBTA 3WBYA 2B7NA 2AGKA 5HATA 3CJPA 4FIQA 3IS4A 1MFVA 4XAFA 3U2ZA 4UTHA 3U8GA 3U2EA 5DCBA 4KWWA 3VKCA 1HF6A 4HPXA 1LJYA 1I6NA 1R0MA 4P8WA 4NF7A 1OABA 1GPFA 1IT0A 3N4AA 2XM2A 2HK0A 2G0WA 1W1TA 1N8WA 1QO2A 4GIAA 3A24A 4D6CA 2WW5A 3IGUA 3QOMA 1UZ4A 1ZRQA 4O8AA 1X98A 1CX9A 2IPGA 1TJ0A 1DWAM 1KV5A 3WFAA 2GQ8A 4RZ5A 1TV8A 3UNTA 2D69A 2Z7GA 3L2LA 2XG9A 1P6CA 3CPGA 6XIAA 1MZRA 2P10A 5AHLA 1FWEC 1J0HA 4EXBA 1DJYA 3ARZA 1FTXA 2TAAA 4LV9A 5IM51 4H8HA 5HNUA 1N7KA 3I65A 5CJMA 4DPPA 4Q7BA 4C7FA 1VBRA 4WF7A 3MWCA 4KRZA 5EBAA 3PZTA 5A95A 1HJUA 3LB0A 2J8FA 1JI2A 3DAQA 2BTMA 2GDQA 3WMSA 4PTMA 3PB2A 1OF8A 3C52A 1UMLA 1H0IA 4UQDA 4H83A 1JZ2A 2MUCA 4DUXA 3FLUA 3W7KA 1XYBA 3GVGA 1DE6A 2NUWA 4JGDA 1THFD 3C6CA 4PMNA 1ECEA 4YS1A 1V0KA 3WF0A 1HJSA 1A5CA 2A85A 2A3EA 3VNYA 2Y8VA 1NARA 1XLGA 3WJXA 5HJLA 4Q8TA 3LMYA 1YXCA 2OVLA 3D3AA 4ZOBA 1UKSA 3URNA 4W87A 4ZQMA 3WL0A 3IGXA 4LB3A 4QS5A 4YNGA 3N2MA 4XD5A 3KVLA 3GRIA 3N6HA 3VNJA 2I5QA 3A9BA 1SSDA 4AX6A 4LAUA 1B9ZA 2ZZ7A 1GVEA 2ZZ4A 4DJFD 4C6NA 3L4XA 3MI2A 1UQYA 4EXQA 3M0KA 2CC0A 4L1WA 1P6BA 2YDAA 2QT3A 1FDZA 4CKQA 1RR2A 4LB4A 3EPMA 1QDSA 5EBUA 3TYEA 4HMDA 5M03A 3UJSA 3FA3A 2RDUA 3QF0A 3ID7A 3FXYA 5HNRA 2VHLA 2FTPA 3S4TA 1JUBA 2OWXA 4W8AA 3PNZA 4RDWA 2X8RA 3NOYA 1WKDA 4FNUA 1JF5A 1KFLA 4DI9A 1D3GA 1O68A 3KRUA 1OFEA 1TCDA 1NDVA 2EPKX 3IANA 3PPGA 3N11A 2D0HA 4POCA 3E2RA 3WMCA 1Y0EA 4GRSA 3W73A 2P53A 4C1NA 5AC7A 4G1KA 5MKGA 4HHPA 2A7RA 3OOQA 1R3RA 2WZIA 4RE0A 2KZHA 1GJUA 1OD8A 3UGRA 1Q7ZA 3USZA 5DRCA 2ATMA 5I0DA 1CXLA 3AICA 3HURA 2WLYA 1RD6A 1TTIA 3PZVA 3G3MA 3VD5A 2XIMA 3MJYA 2QNEA 3U48A 1E72M 2YCJA 2ZVIA 2VC9A 2QPXA 4JTGA 4H6KA 3SUVA 1E0WA 2DW7A 4ECLA 2QLYA 1AQHA 3A5FA 1IV8A 3SBFA 2PWGA 4GGHA 4ML9A 2VDGA 3I7SA 1FP8A 2VWSA 2CNCA 2CZDA 1J6PA 4LAZA 4B5XA 3HQOA 3KHJA 3BMXA 4UMBA 3ARYA 1TWDA 3NQBA 1E0UA 2REQB 2AL2B 2IPFA 4NILA 2Y61A 3WDQA 4B4FA 1E15A 1TWSA 1E73M 5KZDA 3OBKA 4FSAA 4DRSA 4UTKA 4O1AA 3MUCA 2Z2AA 1OYAA 2QEZA 4MGGA 1YTDA 4QGCA 2J27A 3L0KA 4GQRA 4TMCA 5A8OA 4Y8EA 3VGBA 3LHVA 1TA3B 2GVYA 4PUNA 1XI3A 4WDUA 5A8PA 3BGAA 3RGTA 4QXIA 2NQLA 1FCBA 5TQLA 4EP8C 2FB2A 1BF6A 3VVGA 4ATDA 1B90A 2ZX8A 1RP8A 4GUFA 3CHDA 4WDTA 3HG5A 3DKLA 5DCEA 3OVRA 3RUBL 4NI3A 1Y7VA 5DEZA 4GO8A 3T44A 2GDUA 3U7VA 2JKAA 3I7QA 3DEQA 2EJAA 2OTDA 2EHHA 2NLIA 3UBPC 1VIWA 3NIYA 1JDDA 6XIMA 1JJKA 1L8PA 2PWFA 3T07A 1SSGA 1DOSA 1A47A 1W3LA 4WEVX 3WG6A 1M5WA 3SY1A 2Y7DA 2G3JA 3F4WA 1JCXA 4M81A 3UERA 4AZIA 1O1HA 1FXPA 3AIQA 1RCOB 4GD0A 3PC0A 1JPIA 2DY3A 4RCXA 3M7SA 4AX7A 2J78A 4CQDA 4ZO8A 3TN4A 1NTHA 4WXZA 5I24A 4J3ZA 4D72A 5EFFA 4GLEA 3ZFHA 1GHSA 4HTYA 4GJ1A 2OT0A 3WH9A 1XPYA 3KE0A 4H9XA 4H2CA 4M7TA 3NQ6A 5HULA 2YB4A 1UW9A 2I5GA 5D38A 2DQXA 1Q2RA 3BAJA 2XISA 5XIMA 2IUZA 3BLKA 5LYRA 1OSEA 1ZBKA 4V1YA 1VLIA 3C2EA 1I2RA 2W66A 5F1VA 1LWJA 5C7VA 3QY6A 4MPQA 3DGBA 4X0NA 3PTQA 4A8LA 1M6JA 1Q6OA 3II1A 3N6QA 1EEPA 1CNVA 1W91A 4ES4A 2ZX6A 3TEVA 3M0YA 3MDUA 2Z26A 4D2JA 3GAKA 1ADOA 4UR7A 3R7MA 2JGYA 4WGXA 1KFEA 2OOFA 4JTSA 5LNSA 4AAJA 4XTIA 1E6QM 4CD8A 3MDWA 4DEFA 3ZJ7A 2KAUC 4LUYA 1UKQA 1TUFA 2E5CA 3MBFA 1NDZA 3LZ5A 3AWNA 1O12A 5FJTA 4JEQA 1XIBA 4DJFA 3V35A 4CN4A 3WQ8A 4NU7A 4UR8A 3G1AA 1QNRA 1S39A 2P88A 1HJXA 3A4WA 2HVMA 4NRSA 1W9VA 4BKNA 1AH4A 1Q6RA 3I6RA 1T8QA 1GOIA 2WANA 3MCOA 1MUCA 1PUDA 2W6RA 3EWWA 1GVSA 5HMSA 4HU3A 1CGUA 1H41A 1CT5A 3LHZA 3VNIA 2XIJA 4NXSA 1DWGM 1PEZA 1M03A 1ITXA 3VAVA 2PTXA 3LCLA 4DX3A 4F2BA 3O06A 4GC3A 4S23A 1WXZA 2V5KA 1WUFA 1UKPA 3ZLFA 5AZ0A 1DIKA 1S2WA 2V69A 1UUQA 1XG4A 4FLSA 4BS0A 4C6OA 1MZHA 1KCKA 1OEPA 2FPTA 2WZTA 3GM8A 2E9MA 4BEQA 1K70A 1LTDA 4JIQA 2H8XA 4XZBA 1ZL1A 4L80A 5CZKA 2O56A 1KLZA 3WBEA 3F4CA 4U33A 3TW6A 1S5MA 3DFHA 2Z7KA 3UCQA 3DG3A 2XUCA 4C6BA 4IXHA 3FJLA 3N34A 1EP2A 4Q4QA 3VDCA 3WF1A 1XFCA 3LYEA 3OW1A 2DSUA 3ITYA 3B06A 4U2ZA 3GDKA 2J7FA 3E02A 2E7FA 4LQ1A 4YCPA 2CHNA 1M65A 3KBMA 4GCAA 4KBXA 3ALFA 5AZ1A 3SUTA 3VPLA 2FIQA 3CBWA 4FNPA 3WIJA 1KXTA 5HNNA 4HIBA 1XC4A 2P50A 4REQB 1XBXA 2YBUA 3C2FA 4JQAA 3R8GA 2Q02A 5BROA 1G69A 1DKWA 1IEXA 3W28A 1O5QA 3M5YA 2V2DA 3KBJA 1HP5A 3BXWA 2DP3A 1E51A 1GYMA 4DIAA 3LV5A 2ZUSA 5REQA 4ROQA 3MZ2A 3BARA 4IQJA 2GL5A 3I3DA 4EE9A 3O3RA 2QIIA 3UF9A 1RQHA 1Z41A 4E8GA 4W85A 1Q65A 3A5VA 3ITOA 4BR1A 1KXHA 2DU2A 3W9ZA 4R3UA 3NVDA 4S3AA 4OQVA 3PAJA 3IVTA 5KINA 1Q13A 3KCJA 5I7GA 3VMOA 3CUZA 1IXPA 1D3HA 3WD1A 1JCMP 4PTVA 3EKLA 5DELA 2HXTA 3M9YA 4WVXA 4IIDA 3TN5A 4JS3A 4RNJA 3AYTA 2GJNA 4BJHA 3MMUA 3QPYA 2FZ8A 1UA3A 1OHLA 3WBAA 1A0DA 2BS9A 2WXDM 4C6CA 1S5VA 1GOKA 2C1GA 3G1VA 4KETA 3IJ6A 1SW3A 3PANA 4QLKA 1KW1A 2E4TA 3W88A 1U22A 1NELA 3FW6A 3M41A 3KS6A 2E25A 1GOQA 3PNUA 3W26A 4HU8A 4RE2A 4ROPA 4ZSUA 4TX8A 2W92A 4TVDA 1NIUA 1RALA 3W70A 1PCWA 4M6QA 2WVUA 4W7VA 4QCFA 4M56A 3W7DA 3PBGA 3QC3A 4P2VA 1MSSA 5HWMA 4WKFA 1US3A 1TPEA 1EGVA 4H7ZA 1FCQA 1XLFA 3ERPA 5AYYA 3UJFA 4LVAA 1PVNA 2FPYA 3GXNA 1GQKA 1DWJM 3WLPA 5LNVA 1JPKA 1JAEA 1S3HA 1SFJA 4FOUA 1C93A 3S5ZA 1EC8A 3NQFA 1TYGA 3JS3A 1RQBA 4B2DD 1U5HA 1VP5A 3VIJA 3PZQA 3R0KA 4X63A 3ZMRA 1NY1A 2YA0A 1W0MA 2C91A 2ZDSA 4HHMA 4FNSA 4W9TA 1ZFJA 4GIEA 3QSTA 5L9FA 1UZHA 1X39A 3GBDA 4H7CA 5A8GA 2QDDA 1HGYA 3FN9A 2VGGA 1BTMA 2PUZA 1A5UA 4UOJA 5M3WA 1F6YA 1UZDA 1U5JA 4XZMX 3CWOX 1G4SA 3B05A 2OZTA 3BURA 4Q4MA 3W82A 2Z1XA 1BQCA 3LQLA 4BQ3A 2VD9A 1K8CA 2BOGX 1RY0A 4C5YA 1IIHA 1BTCA 1WE5A 4N9CA 3QLLA 1UWRA 4TIMA 1X96A 2HTMA 3VNLA 4EVZA 1XJBA 1IR2A 1EUAA 1ZGDA 3NL2A 2XIIA 2R1KA 4HN4A 1VCGA 2QCDA 3BQ6A 4J3WA 4DBUA 4PODA 4MNMA 1J2BA 2ZADA 5FF3A 1KLYA 2BXVA 3LLXA 1V02A 1Z89A 1XHGA 2VZUA 2VRJA 2PRMA 3APGA 1C8VA 1G7UA 3ABOA 5LSMA 2XWEA 2J9XA 3NQAA 1KRMA 3EWUA 4LGXA 5CAHA 2PDJA 3ELFA 4J3XA 1Q45A 2FLIA 3W85A 3AHZA 4MOZA 2EPHA 3S46A 1ISXA 3SCOA 3DHPA 1OC6A 4YCOA 1Q6DA 1E56A 3KAOA 2DZPA 4K8GA 2V5LA 4PMJA 2VCCA 3PR2A 3BZGA 3PY2A 3OZOA 3LLFA 1EWEA 1S46A 3GTNA 3RCNA 4JQ3A 2ABAA 1EF2A 3UR7A 4N9BA 1R2SA 4CEUC 5EPDA 1YBQB 4INFA 5M17A 4M19A 1SM9A 2ZBTA 5HR6A 3UXDA 2GK1B 1MQRA 2WNZA 3VCCA 5JIWA 3TLLA 2XGIA 4F0RA 4HKPA 3CUXA 1UD8A 3T0AA 4IMAA 2XVPA 4KWSA 3WBWA 4BZYA 4XUYA 2HCVA 1VQTA 4FZIA 3CWNA 4JTQA 1XGDA 2G4FA 2HNHA 2EF9A 2DUXA 3WEMA 3VNKA 4AY8A 1F5ZA 2JBMA 4TV6A 3QR3A 3PZOA 4ZVJA 2ADAA 4P61A 3T8LA 1XD0A 4ZOAA 2ZXQA 3H26A 3WELA 4R27A 4K1GA 3ITTA 2H6RA 4PRTA 4DM2A 3T81A 5XINA 3RRAA 3CAWA 4HCHA 3P8IA 2IQTA 5B7YA 3NZPA 3VDGA 3SJNA 4IMCA 4K8HA 2HJPA 4C6KA 3WMBA 1FVPA 3GC5A 4XUGA 3QN3A 5CBBA 4WOQA 2AOSA 4YXGA 1G4PA 5F4WA 1KCLA 1TTPA 1OGGA 4ZQNA 4Y9AA 4O54A 4LUSA 4QG8A 1X1ZA 3F7JA 4NAEB 2WHJA 3B8TA 2GJRA 3ZJ8A 3GD6A 4H00A 4JL2A 3HV9A 4YYFA 3FIGA 4Q8WA 1Q2SA 1NQ6A 4GXPA 1EO5A 2CZFA 4IL0A 3BUVA 3QQWA 3S2JA 1B0IA 1J79A 3BDKA 1W9PA 4E4PA 3MWAA 4LBRA 4JYFA 3ECQA 2WCSA 3W25A 1KWGA 3GXIA 4AB4A 2VXNA 3NEVA 5GJPA 1YIXA 3DC0A 3MSYA 4F2TA 1EX1A 1F4HA 2OSXA 2F7FA 2PAJA 4HVXA 1EGZA 2DQWA 2EKCA 3GH5A 4NUWA 3Q45A 2NQ9A 3AUOA 2ZFAA 5A8QA 6REQA 5A2AA 4G9PA 3URQA 1CXEA 1ZJBA 5JUVA 2X09A 4FX8A 4MM1A 5FL1A 1WO2A 5CAKA 3WUGA 3HM7A 4V2XA 5IRPA 2GSEA 3AXHA 4RNIA 3CIXA 1O60A 2BOEX 5HNTA 3VMNA 2JKEA 4J1OA 4PB5A 2VCAA 1FY6A 3NOEA 3BOFA 3W7CA 2I57A 3EX1A 4LYRA 4TR9A 5RUBA 2HS8A 3CH9A 1TVPA 4DO5A 1RD5A 3P3BA 4MJ4A 2CITA 1FFQA 2J7DA 2QIWA 3RHGA 4IOTA 4DF2A 1XCXA 3QEZA 4GVFA 4FAMA 1QNVA 2GSJA 4B2DA 3CAVA 3UFYA 3CQKA 3OU8A 4LRTA 2VFDA 3GKFA 4BQ4A 2AQOA 3CL6A 3LCIA 1D7KA 1YLVA 2QCCA 4JL1A 4LV4A 1CXFA 3VO0A 3WLSA 2PDKA 1LOSA 2DV0A 2FKPA 4AG0A 5EFDA 4JX4A 5D37A 3L4ZA 1O7AA 3BGGA 2AMXA 1WDRA 1KCXA 2B4GA 1M68A 2AGTA 3UGVA 1KR0A 3MUXA 4IPNB 3O63A 2D2HA 1W9UA 2EPMX 2ON3A 3KL3A 3EX2A 1B1YA 2NV1A 4M8UA 3KOXA 1TV7A 3VOHA 5G4HC 2DSKA 2GLKA 4ADUA 2A79A 2PI6A 3MSGA 3VOJA 2YBTA 3WLKX 2PRLA 3TFXA 1BGAA 2QYGA 1VFUA 3FK4A 3S0CA 3DZ1A 2Y5JA 2PURA 3THUA 3ABSA 2CZVA 1HKIA 4JPGA 1XRTA 3BOXA 1LL6A 3PBYA 2A5HA 3CASA 2QULA 4A3UA 1BSLA 2XDFA 3OVQA 3S6TA 3UR5A 3LA4A 5JQ9A 2G4JA 2V3DA 3TOYA 4FS9A 1MDLA 4TXEA 3STEA 4BFAA 1HKMA 4FA3A 1XIFA 2OT1A 4UTIA 1WBHA 4Q33A 3AHYA 3T2PA 3WDRA 2H90A 4B3ZA 2VFEA 3TIMA 2UBPC 3QPEA 5BMXA 1PX3A 1IHIA 1O5KA 1TWIA 4IFKA 3TZNA 4UIOA 1XYZA 4H7VA 4Q4PA 3W1TA 3M44A 3K4AA 4O13A 5HWJA 1F3TA 4Z0JA 1TR1A 3W1NA 3D46A 3ZT5A 4Z42C 2GQ3A 2WNWA 5HUPA 3EKGA 4KKXA 3T05A 1Y5VA 4IJRA 1W3KA 3DBNA 3DFOA 3FX4A 5FJOA 5FA5A 1VBUA 4Q8MA 3RM4A 1QUMA 1SO3A 2Y5SA 4GCXA 1I2PA 3NXLA 4UTLA 2PDWA 2A4AA 3H7RA 1UWUA 8XIMA 3HOJA 2D3NA 3FFSA 3QR0A 1Q66A 4BI7A 2X30A 2J24A 4AQLA 3QLDA 1XLKA 1WDPA 2BSLA 4E8DA 2QJGA 1VFSA 1YTEA 1OIFA 4HOZA 3TWBA 2HPMA 1F7BA 2PC8A 4NJJA 3S9IA 4DZ5A 1V6XA 1QK2A 1VYSX 3A47A 4OZOA 3ZQ9A 2W63A 4I8YA 3UZWA 4V15A 4LALA 5ABFB 3MMDA 2DVTA 2OJPA 3UVAA 2FZNA 3EWDA 3ZSSA 3H8AA 3ZLHA 1KFWA 1C8YA 2QJNA 3O6AA 2ZUMA 4FR6A 3TMQA 1QI4A 1I4NA 2QXWA 4DUVA 5C2CA 1IIGA 3VM7A 4RJEA 1EIBA 4H9VA 4D8ZA 3FKRA 3NR0A 1GVQA 4OBRA 3R79A 3FS2A 4F9DA 2XH7A 4XO7A 3S1UA 4XD4A 1LQAA 3AS3A 1LLOA 1LOLA 2R6OA 3ABRA 2TYSA 3BJFA 5HQMA 5LXXA 4L4OA 4RNFA 2UY4A 4EX4A 2P76A 1XIDA 3NZ1A 4IF2A 3PBVA 2IS7A 3GQYA 4LC6A 4DJFC 1RVGA 2J13A 1YX1A 4KCWA 2ANUA 4NAFA 4WSKA 1B54A 2DDXA 3R1ZA 4LY8A 4AZ6A 1H5YA 1A4MA 3W2MA 3KW3A 3SB0A 1X6UA 3BMVA 3ATYA 3TAKA 1R3TA 4GINA 2V8ZA 2VVNA 3P62A 2DVUA 4AMAA 4Q6JA 4QJ1A 3I3EA 1OCQA 5FJPA 3MW7A 2X1UA 4I7UA 4R85A 3R8RA 1MVYA 3NQEA 3VKDA 4MB4A 1XLMA 5JBFA 4PMYA 7TAAA 1RLCL 3DG7A 4OV9A 3P84A 2YXGA 5G2HA 4QP0A 4JR5A 5M5DA 4GUGA 4Q22A 3LN3A 4QNWA 3V1HA 1DVJA 4KGLA 2E67A 2VI0A 3Q4DA 3C3UA 3LTSA 3UNDA 5FL0A 1OX5A 2QQ6A 2V67A 4P7RA 4PC8A 3ISIX 1JQXA 3W37A 4P5UA 1KM4A 2RJHA 1R3WA 1Z48A 5I6SA 3CB3A 3ZJ6A 4IMDA 4LVBA 4MZ1A 3NO1A 3BH4A 2XFFA 1VR6A 2OXNA 1OFPA 3N73A 4JTEA 4B91A 5D30A 1TE1A 2NT0A 3GYCA 3V16A 3PJWA 4DAFA 2GGHA 2FQIA 4O1DA 1TPC1 3VKKA 4GQBA 3FDGA 1KCZA 1VEOA 1TRDA 4LOCA 3PS7A 4DJDD 2VZOA 1ONEA 1DBTA 3XIMA 3GTXA 3GX9A 1GQJA 4OVXA 1RA5A 4Q3MA 1F05A 4J2MA 1TWZA 3C3NA 4FF5A 4HSOA 3UZYA 2QMJA 2P0OA 1L6GA 2CLKA 1VBGA 1VPYA 2BHZA 4AWUA 1JDFA 4V27A 1TG7A 3SEPA 1UBPC 2C7FA 3A23A 1OG0A 3K2GA 3H21A 3BANA 1S2AA 1F3WA 1AFSA 4JOMA 4IH3A 4JXCA 4JTTA 1ZBWA 2HK1A 4AD1A 2XH0A 3U57A 2GGJA 3UP8A 3FV9A 3G0SA 1TV5A 2PDHA 3MTWA 3VIIA 2WNNA 1U33A 4MY9A 4XSMA 1OX6A 3ARQA 4H8NA 3O15A 1R9ZA 1C3FA 1RK6A 2BVWA 1S1PA 3C2YA 3A4XA 2J7HA 1E6XM 1F07A 1VFFA 3N18A 1BRLA 1JZ7A 2NWRA 5BCAA 1RCXB 2H8ZA 2QAPA 5D2YA 1OBAA 3WEOA 3B0XA 2INEA 3TYCA 2VZTA 4L4PA 3TLQA 1R30A 2ZC8A 2VRQA 5HANA 1EJRC 2V5BA 1SJCA 2EG7A 3EMCA 4DLMA 2OKTA 1E4MM 3QH2A 5DFAA 3RO6A 5C9RA 4H2HA 5AB3A 4GZEA 3DYMA 4R5EA 2FH8A 1CB7B 4I5UA 3N9KA 5I02A 1TVNA 1XLEA 3AO0A 3S1XA 4EPDC 5KZEA 4DNHA 3PPHA 3LK6A 1OK4A 4I5XA 2PZNA 4JX5A 2YYUA 2EPNA 3CZJA 1UP3A 4GUJA 1IQ8A 4W84A 2ZX9A 2XSAA 2ZTKA 4GYFA 1EBGA 1HO4A 2J8TA 1U1JA 2V6AA 3WQEA 2WQPA 1AD1A 3KEHA 3CEUA 3UA4A 1HVXA 2CLMA 5AFDA 4QBXA 3C0QA 1UQZA 4MKNA 3VOGA 3LY0A 1R7OA 4C6QA 1X1NA 2V0TA 3OZMA 2PDPA 4AIUA 4AEOA 2PODA 1J0ZA 4S3JA 2CBVA 9RUBA 3WDJA 1S38A 3B03A 3MKVA 1LQ0A 4ICCX 3LX9A 4PB3A 3OHMB 1RBAA 3LGDA 2J62A 5BOEA 3GNDA 2QUTA 2HVOA 2PGRA 4PEEA 1I45A 3IEBA 3QFWA 2WWCA 4Z2GA 3ITGA 1F3EA 1QASA 3H6OA 1Y5XA 3VKAA 3O6YX 1EZ2A 3EB2A 2Y89A 4FXJA 3AZSA 3O6DA 5CLWA 5KZ6A 4NJGA 3RK8A 4DJED 1UASA 1PX4A 2Q09A 1KRAC 1A5MC 1GEQA 4N0RA 3BW4A 4NZ4A 2CW6A 2X2YA 4C6DA 3KOZA 5FJIA 3VIPA 4XV0A 3W7IA 4ADSA 2HISA 4PRWA 4IGMA 1YE4A 1AA1B 3NL5A 3AXMA 4G8TA 5DF0A 2VVSA 1W2VA 4M0XA 3KWXA 3SUSA 3QV9A 1MXGA 1G94A 4N6EA 2PCEA 3G1HA 1IWBA 2JIEA 1K8YA 3T9PA 4ASTA 2WWDA 4X61A 1TPH1 3M07A 1KKOA 4L64A 2ASHA 4J7RA 1U30A 1ZNNA 3CUGA 4A8NA 5A6KA 1BYAA 1ZAJA 2FFCA 1WA3A 2OSYA 3RR1A 1ZBVA 2FVMA 3ABXA 2XPKA 2QGHA 3FCPA 1RV8A 1SW0A 2G50A 4DBDA 1OYBA 3APTA 1K9EA 1QI5A 2C0HA 2OFJA 1DHKA 1IEWA 5EMJA 4GVGA 3MC5A 4K68A 4ZFCA 5I2UA 1L6YA 3LBMA 1ISVA 1NQKA 3G1RA 3WQCA 3W2LA 4PBGA 4KWVA 3XINA 2D1ZA 4S2BA 4Y9NA 4UFIA 2PWEA 1G9HA 2BBFA 3WK1A 2CETA 5D2VA 2O9TA 4NYYA 3QM3A 1TZ7A 4UCGA 2XN2A 4ZTYA 4JN6A 4O50A 3CUHA 4PFMA 2G8ZA 3CV2A 1WX0A 4UZUA 1H11A 1BSIA 2JEPA 4I6KA 4XKYA 3O0KA 1FWSA 1XICA 1HL9A 4GJIA 4WJ8A 1V6WA 1LUCA 4ZB0A 1IZJA 1GZJA 3PM6A 2DZUA 3TK7A 3KLLA 2Y4SA 2JFEX 1B57A 4KQNA 1EYEA 2FTYA 3RMJA 3HGSA 1ODUA 3DECA 3V1PA 3WLTA 4DJDA 3KZSA 1NJJA 1UWIA 3W2KA 4K38A 1W8GA 2BG5A 4NY2A 4UQEA 4GMEA 4JFSA 3H4WA 3IVSA 1JF6A 3L68A 3PTKA 1ZCOA 3AS0A 4GYJA 4AWSA 4LC8A 5DLCA 2XM1A 1YNQA 5FEPA 1P0EA 3W7MA 4U3CA 2F6XA 3G22A 5KTLA 5JVLA 3TDFA 4A35A 3HGRA 2YOCA 2GJPA 1EJTC 4UFKA 1M9HA 1FWWA 1P7TA 2F6KA 2YB1A 2PB1A 3P2VA 3HF3A 1VEPA 1XLCA 4C6JA 1B31A 5H91A 4DF0A 3WQ6A 3VIKA 1XYCA 3IIZA 2OGJA 1H4PA 3PZNA 3M47A 3FEMA 1GOOA 1L6FA 1RQEA 3TC3A 2J7BA 1DWHM 1VC4A 3TYDA 2YXOA 1IR1A 2J66A 7ENLA 1ODZA 1ESWA 2ZVRA 2D23A 3ABZA 3GNNA 5EMKA 3AISA 2DT1A 1DXEA 1Y8BA 1AL8A 3N9SA 4H8UA 3U5YA 3MV11 2XFRA 2E8ZA 4PTNA 1PDZA 4H8VA 5LGXA 2PDNA 1HX0A 3B9NA 3VGHA 1PCKA 3ME3A 3GC4A 5L6UA 1DWIM 1W37A 3GSMA 3E9AA 1ECQA 1GJPA 2QGYA 1VCVA 5AHNA 3VDAA 4HNLA 1XQLA 5F4XA 1T8XA 1A3HA 1YDVA 5EMMA 1GZGA 3OEXA 1KTBA 2JGQA 2NUXA 4DZIA 1AJ2A 4O0ZA 4OU1A 1Z9AA 4YTUA 3QZAA 2VFHA 4M1BA 5AECA 2NSXA 1EJXC 4GC4A 4I3GA 1VCFA 4JTAA 1M7PA 2G3FA 2EAWA 3OGVA 4XBJA 1WKYA 2FGLA 4OECA 1FRBA 3HGOA 1YADA 1I60A 3TONA 2QAFA 1BYBA 2X1IA 3HTWA 1A80A 2CEQA 2WNQA 3U6WA 1C8QA 2WVTA 4FNTA 4B90A 2B0MA 2DUZA 2UWFA 1MQQA 3ANYA 3I6TA 3MU7A 1QTWA 3WQWA 2XSXA 2NV2A 3HIJA 4FLOA 3EPOA 5LA2A 3SN1A 4O28A 3L9CA 4B9YA 4ENLA 1PAMA 3CV6A 4AF0A 1NWUA 5AHFA 5CBIA 5CSUA 5HQLA 3O7UA 4D1JA 4UWMA 4E4FA 3GU2A 4IGSA 3GH7A 4KF1A 4GY7A 3N15A 1S1RA 3SCUA 1MQPA 2Z27A 2Q8LA 4X2PA 3P82A 3C0JA 1PKYA 1XX1A 3ITXA 4DJEA 1UD6A 5D02A 1H5VA 1B30A 2PDBA 1F8MA 5I77A 4DZAA 4KRTA 5K4ZA 1Z44A 3IJIA 1SZEA 3BLLA 4JEJA 4ZQCA 4B4HA 5EB8A 2HXUA 2PMQA 4JKMA 4CQ9A 1KGWA 5LIYX 1UOZA 3DFYA 5K4XA 2QDHA 3Q58A 5DY2A 3BG3A 2V2CA 4W89A 2QUVA 5F2MA 2WSYA 3GBEA 2PTWA 5D03A 3PFRA 4LXFA 1IT7A 4PFHA 1X8CA 3NPWA 4IM4A 1R7AA 4KWOA 4C90A 3RRXA 4QITA 3WYZA 4G7EA 1WUEA 3N19B 4TO8A 1V6VA 2XN0A 3SRKA 4LNYA 3WK2A 3GTIA 3WBXA 3LZ3A 2Z4GA 4RDVA 4JIRA 4LYQA 1EGMA 3KCLA 3W7LA 3AJ7A 3PVFA 3ZM8A 3POHA 1KC7A 3G1DA 1E5NA 1UG6A 4KEMA 1GVIA 3H12A 1TVLA 4GWEA 1CGYA 4WCJA 3VTRA 2Y8KA 3UJ2A 3E38A 1X38A 5DBUA 5C6MA 1DQWA 3PSWA 1KRCC 3U5UA 3LHWA 1TFVA 1V6TA 3CHVA 2FMNA 3PUEA 2PDFA 3DHUA 1KM2A 1B3VA 3FGCA 3DUGA 1FWJC 3H24A 5J5RA 2X7WA 2GJLA 3U0HA 1L6WA 4LJ3A 1XL9A 4FALA 2DSZA 4RDZA 3B9OA 3CU2A 1QT1A 1QOPA 1BYDA 4LNCA 2DJXA 3A9IA 4YTSA 3VK5A 2A21A 4QSFA 4S3BA 1XG3A 1IXQA 2VYOA 2EPOA 3W1LA 5CGTA 4Q7IA 4NXKA 4IGHA 3M0LA 2CESA 3MJMA 4MWAA 3OP2A 4NZ5A 3I68A 5IXEA 4TX6A 3WDHA 4TTGA 4IPJA 3NQ7A 3BLDA 2ZZ5A 4ZE5A 3KBWA 4XX6A 3ZVHB 5LGZA 4Z2IA 4XAGA 4M6UA 4AZCA 1YXYA 2AMGA 4GBDA 3BAKA 2HE5A 4DI8A 3F5JA 3FVMA 3F1QA 4HQVA 4Z0SA 1PL9A 1VS1A 2VD8A 3GXMA 1XCWA 3FHQA 4WLCA 4GE8A 4BK9A 1RJQA 2WQDA 1G0CA 1G01A 3G6LA 1XISA 3UWQA 1E6NA 1VFLA 1PKNA 3A12A 3K13A 3DESA 1HP4A 3UESA 4L1GA 4WSJA 1CCWB 4LWWA 1K4HA 4AZHA 1VKFA 3C0LA 1EA0A 3BCDA 1UHVA 1YRRA 1C9DA 3CLWA 4L7ZA 2J79A 1OFOA 5EGRA 4I9JA 5GNXA 4DYEA 2ISVA 1H7RA 5AC5A 2D24A 2VX6A 3EOOA 1IT8A 3STGA 3BQ5A 1Q7QA 3PBMA 4CCZA 3UCCA 4DHGA 5C9UA 2BV9A 1WZLA 1EUNA 4LAOA 2NX3A 3R4IA 4MFEA 3NZRA 4LEFA 3W84A 1ZJHA 3A3XA 1V6YA 3HGJA 5ABEA 3FNDA 1SVDA 3CNYA 1JL8A 1UJQA 4LVDA 3GYEA 1F76A 3QRHA 3RYSA 3DCPA 3W38A 2V30A 3F2BA 3IJLA 3K1DA 3NAVA 3A13A 4I90A 2CHRA 4IP5A 3N2CA 3RPMA 3O05A 1YHTA 1H1ZA 3AZTA 2Z28A 3WLHA 1GT8A 4P8XA 1KR1A 1KV8A 3CT7A 4WKAA 3QY7A 3H23A 5CH9A 2ZRYA 3HU7A 1P0BA 3V0TA 1WOAA 3AYVA 2ZUVA 2BDQA 1X7FA 1PWMA 1E70M 1TPDA 1L9WA 1KRBC 1ICPA 3IJ9A 3BOLA 2WCGA 4TOQA 1F9CA 1W9XA 4HSNA 3WQVA 3TFCA 1R3SA 1MW0A 2P3ZA 4XTDA 3QR1A 4NT0A 4XWUA 2H3BA 3WO8A 1M41A 3SCQA 4J40A 4O19A 3K30A 4LRSA 2X05A 2PU1A 1UBSA 4DZHA 5CJNA 2ALDA 1O4UA 5HK4A 2O4QA 4C1NB 5C70A 1W2PA 3TZFA 2RGMA 1ONXA 4J5NA 5I79A 4N4PA 3P80A 5MKGB 2VGFA 1H63A 5JXQA 2VGBA 2OYKA 5FESA 3FSTA 2H9AA 3W7RA 4UZSA 3U7BA 5I06A 1H7XA 1B4KA 2L5HA 3SN0A 4BF9A 3ZXWA 3GXDA 3UWWA 4ZL1A 3HN3A 1ZALA 1IE7C 4AHOA 3BLIA 3USBA 1CTNA 1DJWA 4C1LA 3GU1A 3ES8A 4D6JA 1EF3A 1FHVA 2PWVA 2R1PA 4GUIA 1Q6GA 1QPNA 1CI1A 1TZZA 2X40A 2J47A 4L6HA 1QHPA 4N42A 3GW0A 1OD0A 3WNLA 4L5ZA 4H4IA 4FB7A 3NM1A 1SJAA 1C90A 1I2OA 4Z1AA 3BAYA 3CTTA 2P8BA 3HQ1A 1KNWA 4B9ZA 5BWAA 4PBEA 2ODOA 5EYWA 2IPWA 5T8GA 1X8FA 2ZUUA 5F4SA 3E12A 1LT7A 1TJPA 4BI5A 1VYPX 1LRQA 3IIOA 5KZMA 4QE1A 2J25A 1E9YB 2VFIA 2OOGA 2XGZA 3GNRA 3NGFA 5K9DA 1HKVA 4NZ1A 1M3UA 3CV1A 1RZMA 1FWFC 3AIWA 3TN6A 1ZAHA 2QUUA 1VF8A 4PCNA 2OEKA 2VP8A 5HMEA 3ZO9A 3QXBA 1TB3A 3W7HA 2QHAA 3CZLA 2CXGA 3WK3A 1ITCA 2BWGA 2J7GA 3EDKA 3ANVA 5BXTA 4NZ3A 3N29A 2VR5A 5K2ZA 1ZAIA 3W83A 3NURA 4LBSA 5A8MA 4AU0A 2BGSA 4B5TA 3TAOA 4W88A 3LPPA 3TR9A 3VZXA 3OIXA 1UPMB 4MFDA 4NRRA 4WIWA 5ABHA 5JU6A 4GI6A 1XYLA 2X42A 3OBEA 1TIWA 3F4NA 2O9RA 1XDMA 1HO1A 1QOQA 1W3TA 1Q5MA 1UR9A 1S2CA 3N17A 1V8EA 3E74A 1S5NA 4W5UA 4AISA 4XZLX 3D47A 1XPGA 2HBVA 1JCNA 3GG0A 2GUYA 3BMWA 1V93A 3MHUA 5FJJA 3P93A 1FCUA 1PS9A 3MSDA 5H1WA 3W53A 4E5TA 3CZ8A 3FKKA 4J9JA 2GUBA 4MLJA 4F0KA 3MT1A 5G5IA 1K7XA 1YPFA 3FA5A 1LDCA 1Q6FA 1QWKA 1W5MA 3L12A 4ZB5A 5FJRA 2ISSA 1UC5A 4QNEA 5BMWA 2O7QA 4F66A 2VM8A 2WVVA 1LZOA 3VX1A 3I10A 2FTWA 1TMLA 1QI3A 2OELA 1QPKA 4HU4A 4M51A 4Z1YA 3GDBA 1RP9A 4IIGA 4O4WA 4XAYA 5D2XA 4C6MA 2Z2BA 3HQPA 4JIIX 3LBOA 4E38A 2V3GA 2Y8UA 3IJQA 1W56A 4DPQA 4IUGA 1PV8A 3VGGA 1HIZA 4GH3A 4UNKA 4NAEA 1V02E 4LPCA 3COTA 1BF2A 4U31A 2WM1A 1K8XA 1WDQA 1W1PA 1JGMA 4JFTA 5G1TA 3S2MA 3UPWA 1P48A 4D6DA 1IEVA 1ME9A 3RU8X 3GY1A 4JY9A 8TIMA 4ERIA 1KFKA 1LBLA 3CB8A 5FCZA 4K7YA 3ZIZA 1BEUA 1UKOA 2Z1WA 2A7PA 2V9DA 3LNPA 3A4AA 3GR8A 1XLDA 3RM9A 3T4WA 3UG8A 4DJDC 4HNCA 2OMAA 3DI1A 1E55A 3EWBX 3AHTA 3IJ8A 2VQTA 1D8WA 2D2JA 2VX5A 3DFNA 3CIWA 5LIXX 1DE5A 1Q6QA 2Z1SA 1VB9A 1E4IA 3C56A 1YPXA 1O1ZA 1OWQA 2O4MA 1GVFA 1G7VA 4NZFA 1G6CA 1W1IE 1W5NA 1J12A 3ARPA 3NJ3A 4JTUA 3VINA 1QNSA 2RKXA 5C54A 3PB0A 1JIBA 3NDYA 2PP1A 4IP4A 1XLIA 1V7YA 4PSPA 4O52A 4TTUA 1JUEA 1QAPA 2HPIA 1EPVA 2A3BA 2LLEA 2PTYA 5ENLA 4Y6GA 4I9TA 1R2TA 3MI3A 3HB9A 2IKJA 3GDMA 3HPAA 4CNUA 3WNMA 2AAAA 2ZRVA 3WFZA 4UNLA 1AW2A 3KBNA 1FDYA 4HOXA 4HSHA 2Y70A 1A5OC 2WC4A 1UR3M 3K4WA 3P5YA 1CYGA 4HHLA 4HYVA 5J04A 1QOXA 1FWNA 2Q6ZA 3EWXA 4HPNA 4MB1A 2QF8A 1RCQA 2J8GA 3FDKA 2YJQA 1EB3A 3SDOA 4ZQRA 1E6PA 4J3TA 1QXLA 2OLAA 4MHBA 3ORWA 5M1TA 2J74A 1EJWC 1E3XA 1VAHA 4H6QA 2ZA3A 1CB2A 3WLRA 1UH2A 4MYAA 4C60A 4KEUA 5LNUA 1D2KA 3WL1A 5E9AA 1RXOB 2Z1VA 3RXZA 3S3GA 1RPXA 1ISZA 1E9IA 1U1HA 1VJIA 1BQGA 2WKLA 3VNMA 5CZSA 3THDA 1GZ1A 1JD7A 5REQB 2VNCA 1CIUA 4HT3A 4QRNA 2CHOA 2NVAA 4CQBA 3S9YA 2AQVA 4ADTA 2EPLX 1RJRA 1UYQA 2EEXA 1BVWA 3AOFA 3CV7A 4HBKA 5K9CA 3KTXA 4PCFA 1VHNA 3OZYA 3KVMA 2DT3A 3WQGA 2NW0A 1KM0A 1QPRA 4H41A 3CGTA 4O57A 2PPGA 4CLMA 2BLEA 4GZ7A 1K9TA 5KITA 4QQUA 3LHUA 3LERA 3HFTA 1TMHA 1QMLA 5C5YA 4AYSA 1UWTA 1XDJA 2HQAA 1PZ1A 1VENA 4XQ6A 3RX3A 2YDRA 2D73A 2JKPA 4F79A 2GVEA 2XIOA 3SW6A 1A5NC 1JRBA 1UP2A 1VD6A 1J0YA 3VE7A 1WNOA 3S5NA 3W87A 2OLHA 1FDJA 4ORIA 1EXBA 1EC9A 2DZBA 4ZXOA 1WV2A 1EC7A 1GKPA 4DWSD 4URIA 4HP5A 5HJYA 2WMFA 2BVTA 1MXDA 3CTLA 3LM7A 1BAGA 3LSCA 3LPFA 4YHEA 4W5ZA 2W4XA 2X0SA 4O53A 4H1ZA 2ZRUA 5I09A 4DJEC 4HZMA 4DUOA 5CC6A 5H2ZA 4JTFA 4EAMA 1QO5A 5FF2A 1E4LA 3QYQA 3ARRA 3PBWA 1W17A 2V81A 3RJXA 1KO0A 2ESCA 5AN7A 6PTDA 2VOTA 4EANA 4F8XA 3V18A 1EP1A 2OEMA 2UY2A 3MP3A 1HG3A 1BG9A 5CBJA 2ZZ6A 1H2JA 2Z00A 3KVJA 1K02A 4GVHA 5AHIA 1FWTA 3HPSA 1H1NA 4NX0A 3L5AA 2EKGA 4K37A 4IIBA 2WC7A 3UPMA 1XSKA 1PIIA 3WCZA 5C71A 1Y65A 4XK2A 2DGAA 3QBUA 5GNZA 4B5VA 1OQFA 1J5SA 3EBVA 5FOOA 4N9DA 4D8LA 4UTTA 3B8UA 1H1YA 3RU6A 3WH6A 1OK6A 2QVHA 3PTMA 3RX4A 4MPKA 3SGZA 2XH2A 3DH7A 3R10A 4M6PA 4E0CA 1NEYA 3IACA 3W1QA 3GDRA 2PDIA 4BQ2A 3EOLA 1WXYA 1JYWA 3GVQA 3WQDA 1HTIA 2VR2A 4AWEA 5A94A 4N02A 4U10A 3W01A 1MW2A 1ITQA 3BAWA 4PRRA 4UQBA 4GYKA 5BZAA 3N04A 3QQ0A 3TCSA 4CCCA 3KWSA 2OO0A 3TYAA 4YWSA 1TPB1 3DX5A 1C92A 1UMYA 2BASA 1GQNA 3NG3A 3DYOA 5FF4A 4DBSA 5DMNA 2QCDB 4GKTA 3GW3A 4YPJA 3RLGA 4JFUA 4PUEA 2BP1A 3ZZ1A 4AD5A 3MYOA 3QKZA 2EQDA 3B40A 4YTTA 4L4LA 1H61A 5E6YA 1PTGA 1UH3A 3N13A 4ZR8A 1BWLA 2YFNA 4JIPA 1JFXA 2W3ZA 1K8ZA 4F40A 2IQDA 3W1MA 4MWAC 3DFQA 3FA4A 3QV6A 3QV8A 1CWYA 3TQPA 2ZC1A 3LBCA 3UG4A 2GUUA 1WYIA 1XH1A 3OVPA 3WX7A 2WMGA 2VZSA 3TTYA 3BZJA 1I9CB 4LW7A 3KLKA 4JZ5A 3N12A 1POJA 3G8EA 3PG9A 3VFLA 4MKVA 1C91A 3ZWSA 1IGSA 5T26A 2Z1BA 3PJUA 2CERA 3AS1A 3BE7A 3PP7A 1XYFA 1QFEA 3O16A 7PTDA 2OSWA 2VC7A 1JCYA 3NQ2A 3TKFA 3DYPA 1B3YA 2C16A 3R5EA 2E40A 3CL7A 4MDOA 1T99A 2E1DA 2W9MA 4BF7A 3BTNA 3P67A 2GDVA 1DJZA 4GZIA 1ZENA 1CZ1A 4QE5A 3E0VA 2FZ9A 3GB6A 5LNRA 1QRQA 3A22A 1M01A 4UTUA 4CVUA 4S3GA 4JTCA 4FNRA 4HB7A 2QUNA 3JZEA 3OLDA 4D71A 3ZS4A 3BV4A 3ARXA 3K5XA 1CGTA 1P1XA 2ZZ3A 2OWWA 2EGZA 4MJZA 1DV7A 5AHEA 3B0YA 3M1ZA 3B0PA 3BAIA 2RGLA 2PLJA 4Z2JA 1JG9A 1RVKA 3PZ9A 2EO7A 1FHDA 3VDHA 2W27A 4O18A 3IIXA 3STCA 5KSWA 3STFA 3U4FA 5D8WA 2YGYA 1V3KA 3AFBA 3WLMA 4CEXC 1JNDA 2Z1KA 2G5WA 2R1NA 3OB8A 1MEIA 3GIPA 4LUSB 4C7GA 1H0GA 3FSUA 3BLFA 2PP0A 4Q8QA 2QS8A 1S5WA 4XKMA 3OLIA 1UIPA 1I2QA 2DSWA 1GKQA 4XSLA 1VPXA 3DOPA 3M7WA 4QFUA 4ZBCA 4XVDA 4PB4A 1ZZMA 3E1F1 4QISA 3JU2A 3GZ3A 1WB0A 2IKHA 2QMKA 3MYPA 3HJEA 4O17A 4B5UA 5BXRA 1ZP4A 2UV8G 4UOZA 1KTNA 3TTSA 2OQLA 3SCPA 1WAUA 3MANA 5CGMA 4Z1CA 3H2AA 4FXSA 4A29A 2ONEA 1AJ0A 3TNOA 3WFLA 1BFNA 4J28A 1VFTA 4QEHA 4R53A 1SJBA 4EPEC 3S2NA 1EDGA 1P6WA 3W1XA 1GONA 2DT0A 4DWSA 3UR2A 2HE8A 2OO6A 1W32A 1DIDA 4DUWA 2PGEA 4UTMA 4YTRA 1O94A 1PTAA 2CLFA 2Y88A 6REQB 3MV01 3WN6A 5CSSA 3ITVA 4GACA 3MUZ1 3U3HA 5I3JA 3DBPA 5CC3A 4IMGA 3W7QA 5HMDA 5GVJA 1ZQ5A 4JAWA 4RZBA 6ENLA 4WHBA 2JF7A 3JVAA 4CNOA 1PYMA 3L23A 2X0HA 3T09A 3MP5A 1KM5A 2NUYA 1SR0A 5LIKX 3M5XA 3TOPA 1W5PA 4S38A 4EPKA 2QUMA 3I7RA 2FJUB 3UXKA 1NAL1 4O0KA 4N4QA 2XIBA 3VCNA 5A2CA 4U5IA 1OCJA 1PHWA 1H49A 1MMFA 3SRHA 2WMJA 3ATZA 4CGTA 3JW7A 3BPWA 3GXPA 3V0SA 1D3CA 3CC1A 2JE8A 3NPUA 3ZVIA 2IKIA 3PUDA 2WMIA 3UCDA 4V1XA 1NWTA 4GYPA 4Q8PA 1R47A 1JZ6A 3RCYA 3UJRA 3AYSA 4HOWA 4BF5A 4LCQA 3B97A 3EX3A 4O1EA 1FWIC 3Q67A 5D8ZA 1PDYA 4R7WA 3CZEA 1UWQA 3N25A 4YIWA 2ZUWA 2V5CA 3QVQA 5CC5A 3U2OA 4HZ6A 2Y2WA 1JCJA 4RLIA 4HN8A 1A3WA 3H4GA 3HMJG 3TVAA 2BMBA 3M5ZA 1RSCA 4AXKA 3BC9A 4YU1A 5C9WA 4ZCWA 2Z24A 8XIAA 2RHGA 4CU7A 1SPQA 2X41A 2DORA 3CQJA 4IHCA 4MKSA 1ICSA 4NYUA 3KRSA 3L2IA 3TWAA 2IMRA 4K6AA 1REQA 3LPOA 3BICA 5I3DA 4YVPA 4NP7A 4E4UA 2OYMA 4NKCA 4HNOA 4AYGA 1JYVA 1XBZA 1VFMA 1HFBA 3VZYA 3SECA 2VDHA 2WSPA 4IISA 2QZRA 4FNQA 4HHHA 4W7WA 5A6MA 1XW8A 2X1SA 4QG6A 3GFXA 4HMNA 2QV5A 1A5LC 1QU4A 3WJZA 3T0BA 2XVNA 4UUIA 3ZSTA 4UC5A 4K7VA 1SZFA 3UJEA 5E93A 3LCXA 5DANA 3A64A 4R34A 2DZVA 2P0IA 2CBJA 2CPUA 5CLTA 4MUPA 2BZNA 4JTKA 5DXYA 4EF8A 1ALDA 4D9PA 3SUWA 2YCLA 1NFPA 5I3GA 1CBGA 1YE6A 2ZE0A 1XKYA 3LS9A 3VABA 3P5ZA 4NZJA 1DXFA 3CH0A 1R2RA 1K4GA 3NL6A 1T6MA 1POKA 4P7QA 1MRQA 5DCDA 1GNXA 4D6IA 4JKLA 4QSHA 1EQPA 3WNNA 3HG4A 2HWGA 4A22A 4XZ9A 1EEXA 3MCNA 2GJXA 3SQSA 1ME8A 1KBIA 4HPGA 2PWUA 1VEMA 5AY7A 1MFUA 2RAGA 5HR7A 2GVJA 3SY8A 3EB3A 3W1AA 1NOUA 5D9PA 1BVNP 4L65A 2VURA 3AXIA 3EYPA 2CBIA 4W86A 3PSVA 2BGNE 3ARVA 3QGAC 1LLZA 2ZA1A 2ZA2A 2G3NA 3QV7A 4N7QA 1UA7A 5FEWA 4P8UA 1XIJA 1ZY9A 5IDIA 3MKKA 4FXFA 4MF4A 1J18A 2JALA 3L7RA 1OC5A 1QJWA 2O9PA 1E6SM 2FZMA 1NU5A 3LOTA 3ZWTA 3LV6A 1ZS2A 3GUWA 5AYIA 2E6FA 5A6AA 4S3KA 4PUWA 3YPIA 2XZ7A 2YL8A 3KBVA 3DXIA 3QHMA 2HBXA 1D7FA 3PTDA 1V51A 4E6MA 5EL1A 3QTPA 1KM6A 4NHVA 4JN8A 1GQIA 1JPHA 3BG9A 2NQZA 4S39A 1T0OA 1R8LA 4GBUA 4YYCA 4EIVA 1EO7A 4M82A 1VZWA 2CLPA 1E9LA 2E5BA 5A69A 1C29A 3KOFA 1W8SA 4ZOCA 3EZ4A 4QIUA 1KKRA 4ZO9A 4B92A 1IF2A 3KRBA 4XIAA 4GI4A 2FPVA 3G0XA 3W7EA 2C1HA 4A4AA 5ABTA 3M0MA 1QPOA 3QMSA 2HROA 3LGGA 5IHSA 2ZZ2A 3P0XA 5F2IA 5FF7A 5D9MA 2FVKA 1ZLPA 5AYBA 4F2UA 4FLRA 3BSGA 2GFTA 2E09A 1J8VA 3BJSA 1L0PA 4HZ8A 1FWDC 3MB9A 4HD5A 2CLLA 4MYXA 1VLWA 3ENLA 1MO0A 3CHFA 2BB0A 4CD6A 1BPLB 3LQGA 4KESA 3VD4A 4GKLA 2PTZA 4DXKA 4KRUA 2D3LA 3TTQA 1EX5A 4QM1A 5I07A 3CT2A 2OLSA 4GFIA 1V3HA 1J11A 4OWGA 5CSRA 2PWHA 2QVNA 5HA7A 4WY0A 4IZGA 1DQUA 1HGWA 3CMGA 2QW5A 5DQPA 3FAWA 1LF1A 3TQ0A 3EEGA 4DO4A 4WD0A 4KGJA 1BGGA 4GH1A 1JDEA 1U1UA 1W31A 4NSBA 4DB7A 2VX7A 1XGEA 1S2VA 3IJDA 1FOBA 3TJ4A 4G1NA 3RITA 3OTRA 1PXGA 3THQA 3C2VA 4O16A 2OG9A 3XISA 4UMCA 3IARA 2PDGA 3GG7A 3SQLA 1A50A 4PA8A 4AEFA 7ODCA 1AQMA 2I7GA 3Q37A 3P60A 3WQFA 3FJNA 2FMOA 3SGUA 1GKRA 1XLHA 2E0PA 4RX0A 4CNNA 5ABGA 3SR7A 4TV5A 5CGQA 2Y62A 4O1CA 4KPLA 3DHFA 4MVAA 3BLOA 1ZJAA 3N4FA 4XB3A 3PFMA 1DJHA 3UEQA 4Q4KA 2ZDRA 3PJXA 1Q4NX 3W1RA 1EIXA 3GNXA 3BJTA 3LCGA 4AD0A 4AIEA 3WF3A 2PEVA 1V79A 3H7UA 1ZBCA 2D0FA 3EWZA 4DNMA 3EDDA 2GYIA 5CG7A 2QKFA 3LU2A 2VL4A 4GISA 1GTHA 4IWWA 2QPSA 2WK2A 2YA2A 4A3RA 2CKSA 3FXGA 4MTVA 1CECA 1XIHA 3M5VA 1VRDA 4QS6A 1AVAA 1QCWA 2ZTJA 3H2EA 1BRLB 1XIGA 5AKQA 1HL2A 2Y24A 4PSRA 2C1IA 3LD5A 1M7JA 1B3OA 5FKYA 4MJMA 3OG3A 3SJ3A 2NX1A 4UTJA 3DU0A 4KCTA 3WUEA 1RPKA 3KTCA 3VE9A 3UZJA 4OOUA 3REQA 3IRDA 2FYMA 4FK9A 3DKJA 2VELA 3Q94A 3WLLA 3W23A 1ZPTA 4WX2A 3T55A 2XWDA 1Q6CA 1J6OA 3BK0A 3GKAA 4JKKA 3M0HA 5DMMA 4ALDA 5E5CA 1XF0A 4JQ4A 5JMUA 1TJ2A 4PGLA 4AWTA 1WOBA 4NX5A 4PUKA 1H7WA 4HJWA 4ZO7A 3TV8A 4FP1A 1TSIA 1DJGA 1SU5A 3UQNA 2O92A 4A3YA 2YCKX 1PZ2A 3ZT6A 1SR9A 5BXSA 4C6FA 3AHXA 3VFCA 1PKLA 4DYJA 2QJIA 1PBGA 4HA3A 3EXSA 2R8WA 2WZEA 4DO6A 3B0UX 5IFTA 5GPRA 3R12A 1P4CA 4U2YA 2Q01A 5DT5A 2X1TA 6A3HA 1DL3A 4PTDA 3A21A 4O15A 4UTTC 1ZJIA 3CQHA 3GNOA 3ONBA 2TPSA 2VEPA 2A7NA 4G7FA 3F5LA 1S2UA 3W07A 2YDQA 2V63A 3MHGA 2W67A 4YTQA 4XAZA 1T41A 3L4UA 5I3IA 3NQCA 1AD4A 4IIFA 4U28A