3G24A

Crystal structure of the mutant d70n of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIANFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 81
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g24A00
1SW3A 3STCA 5U7SA 2QAPA 4JX5A 4RR4A 3ABOA 1TPDA 2QCGA 3RMJA 4ADUA 3TNOA 1DBTA 3N2XA 3QMTA 5L9FA 4Z1BA 1QPNA 4LNYA 3HGOA 3O63A 2GQ9A 4K39A 5AYZA 2G95A 1SSGA 5DELA 2QJGA 2VC6A 2WPBA 4PFMA 2LLEA 1N55A 4S2BA 1TTPA 1GWJA 1XDMA 4JTHA 1GYNA 4XKYB 1QOQA 3G8EA 3H55A 1ALDA 1UUOA 5FEPA 5CKSA 1F2JA 4UTKA 1LLWA 1W0MA 4LUJA 2A7PA 3LRMA 2CLIA 3C0JA 4O1AA 3G8RA 1TV8A 2HMCA 1SZEA 3BLIA 3OIXA 3N3MA 1NVMA 1GOXA 1W56A 3PWAA 3I7QA 2Y61A 2ZA3A 1KA9F 1LBLA 4HNUA 2JKPA 3QMRA 2CLMA 3FEMA 3W7LA 2NZLA 5DBTA 3C6CA 1ZJIA 1VPXA 2ZTKA 2GPTA 3ZFHA 1NEYA 3R5EA 1QR7A 3G1VA 2DP3A 3DFOA 3W7OA 3DFTA 2CWNA 3HGRA 4O19A 3PC0A 3R13A 1NFBA 3FJLA 2R8WA 2QJIA 3DFNA 4IJBA 2A4AA 4OBTA 3L68A 4WOQA 5D05A 4QISA 5FF7A 3W9ZA 3IEBA 4DO5A 4ZQPA 1TREA 3YPIA 2GQ8A 2E6FA 2NV1A 2QCCA 3LTPA 5C6MA 5HMSA 2CLHA 1WXJA 4WZHA 2IQTA 4NUWA 4ONVA 4JIPA 2J27A 3RNDA 2WJZA 4ZQRA 2Z0IA 1OK6A 2CZ5A 4XQ6A 2Y7GA 4ORIA 3EKLA 3TK7A 1TRIA 2VEKA 3NEVA 1OFAA 1V7YA 3I68A 2A6NA 1GTHA 1RD5A 4LVDA 1RQEA 4FEZA 3W7DA 1PCKA 4BI6A 1PVNA 2CLLA 2EGZA 4N9CA 3GZ3A 3B0UX 3GK0A 4PA8A 2OJPA 2E09A 3S1XA 2DU2A 3S0CA 4AMAA 4EF9A 2B4GA 5BMWA 1TPUA 3I6RA 3LLFA 4UTWC 2JK2A 3NQDA 4K7YA 3F4WA 4FF7A 1TQJA 2V82A 3LOTA 1XFBA 1YTDA 4CCDA 4O12A 4BFAA 2OT1A 4R53A 2X1RA 5HUOA 3RU6A 3K30A 1SR9A 4IMCA 5D04C 5AN7A 4K36A 3V1PA 5HUPA 4JTUA 4WD0A 3MI3A 2Y70A 3MHGA 1TV7A 1ZAIA 2ZA1A 2VFFA 1UASA 1I4NA 2BZNA 5CPNA 3W7EA 3UXAA 2H6RA 2QAFA 5EL1A 1T0OA 2Y7DA 3KVMA 1F05A 3B06A 2FTPA 6ALDA 4IMEA 4XWUA 1E51A 2QCEA 2VEIA 4OV9A 3IRDA 2DZTA 2JKAA 4RLIA 5LHEA 1KFEA 2PRHA 3VKJA 2G96A 4NXSA 4O15A 3N9SA 1MEIA 4N4PA 2F7FA 4RXFA 3M43A 3G1FA 3W07A 3AJXA 2Q3RA 4HIBA 2ATMA 1K02A 2WSYA 3WK0A 2Y85A 3C2EA 1EP3A 4O11A 3A23A 3BW2A 3S5ZA 1EEPA 3E02A 3TV8A 1DORA 3I7RA 3B4UA 3LHZA 4LC6A 2V2HA 3A22A 4NJGA 5FESA 3GDKA 1BKSA 5HWNA 1X7FA 1A5CA 1YADA 5HQEA 1OX4A 3S42A 4KFOA 3NO5A 4UTTA 2CLEA 1EB3A 3SY5A 1TV5A 5G2HA 1H7WA 4LUIA 1W5QA 1KM2A 1H63A 3LHYA 4ZMGA 1XC4A 3O15A 4DXVA 5AC6A 2FJKA 5G1YA 3W7PA 1LBFA 3EX3A 2DJLA 4AF0A 5K4XA 2O7SA 1RVGA 1KM3A 3M6YA 3N34A 1EX5A 1B3OA 3C56A 1W37A 2BWGA 4IMFA 3G1XA 3S5OA 1EP1A 4JYEA 3LV5A 1T96A 3BLFA 4LVAA 1PS9A 3EWZA 4LV4A 2Z6JA 3BW3A 4RX0A 4Q4KA 2XFWA 4O17A 1WOBA 1LORA 3NQ7A 1IF2A 2E5DA 1OFEA 1TSIA 1R46A 4QAIA 2YYUA 4NNCA 1WBJA 3OEXA 3O8AA 1TPB1 4M6VA 4AF0B 3G1DA 5AYYA 1L6WA 4DO6A 3M16A 4K8HA 3Q94A 1IGSA 1KLZA 3G24A 4YL2A 4YCOA 4IXXA 2A7RA 2YFOA 3ZWSA 3NNTA 1UUMA 3Q2DA 4HSOA 4N9DA 1UBSA 3GLCA 5DLCA 4BWLA 2FPYA 4EOUA 4QSHA 2ZA2A 3FLUA 1D9EA 1QO5A 1LOLA 4GUGA 1KFBA 1X8FA 1EWEA 4GRSA 4O28A 4S2CA 1Z44A 1S3HA 3M7WA 4Z0JA 3HB9A 3TUUA 2VEPA 1I2NA 2ISWA 4WXYA 1AMKA 4A2SA 2UV8G 2C19A 2CLOA 2YSWA 5F1VA 4POCA 4U4MA 2A2IA 3GXNA 3W7KA 1JRBA 4YCPA 4NJIA 2YYTA 2ZRXA 3GXTA 2H8XA 4UC5A 3DGRA 3GAYA 4ADSA 1KV8A 3W2MA 4WY0A 3PY2A 5D2YA 5G2WA 4UNKA 3GKAA 1A53A 2E1DA 4FO4A 1K8ZA 1XBYA 4MY9A 1QDSA 3CEPA 3P80A 2NX9A 3RF9A 1EPXA 4CNNA 1G7UA 3TC6A 3EX6A 1F5ZA 1TPWA 4LTSA 5KMYA 4M6QA 2NUXA 1ADOA 3NQEA 3P62A 4JYFA 1OFPA 1WA3A 4O18A 3ANYA 4NZJA 2TMDA 3EWXA 4L4MA 3KAOA 4C1KA 3USBA 5HJLA 2C14A 4O53A 4MY8A 2QCFA 3BK0A 1KFJA 2YW3A 3DI1A 3NG3A 1FDYA 3M5ZA 2DJXA 4WOZA 1YTEA 5KINA 1YXDA 4D2JA 3DKLA 3LCLA 2E5CA 3L5AA 3TCEA 4QJ1A 2QEZA 5HWJA 2XN2A 3BV4A 4IMGA 1NSJA 4DBEA 4WJEA 3HPSA 2YPIA 4Z1DA 3FKKA 3M5YA 4FNPA 4UFKA 4Q32A 2NXIA 3FYPA 1JCXA 5FEZA 1DJQA 5EBUA 4MJMA 1XI3A 4PEKA 2VFGA 4XBSA 3MP5A 4XTDA 3P8JA 3STGA 2DZVA 5K9XA 5DCEA 5H91A 3PG9A 5TIMA 2EKCA 3W88A 4CQAA 1LROA 4M5PA 2ZBTA 2B0MA 4Z0SA 4DPPA 3UZJA 1O95A 3SJ3A 3W1UA 1GVOA 4OE7A 1HFBA 1FY6A 3WJSA 2X1SA 1SZNA 3SGUA 3S9YA 4NXKA 2V2CA 4MUZA 2YGYA 3CPRA 1DL3A 2YCEA 4PODA 4TX9A 1H7PA 5G1TA 4UNLA 2HS8A 1FCQA 1HO4A 4UTTC 1FWTA 4A22A 1I2QA 4JEQA 2CLKA 5G2IA 3TJXA 4X2RA 3MBFA 4E2DA 5LHFA 3L65A 1SZFA 1WX0A 4RZ5A 1HL2A 4X9SA 1Q45A 4LVFA 1ICPA 4EF8A 2ZZ1A 1G6CA 4DF2A 2C18A 1W3IA 3GX9A 3IV3A 4UTIA 2OMAA 4GUIA 4JYDA 2VELA 5HR6A 2QUUA 4JTJA 3ZS4A 2QCLA 1TTQA 4FX6M 2RH9A 2QUTA 3WJXA 4EIVA 3NM1A 3W7QA 1GG1A 4FXRA 3TMQA 3P8IA 3W23A 1KM1A 1R47A 1JR1A 1A5AA 1OF8A 1KW1A 2FFCA 1K8XA 1W54A 1F74A 2DZUA 3HG2A 4X22A 1QAPA 2Q8ZA 2TPSA 4MPQA 2V2DA 5L6UA 4MLJA 3BG3A 1DV7A 1EP2A 1FCBA 3SIZA 1J5TA 5AC8A 3GAKA 5FEXA 3HGSA 1YLVA 3LHUA 3CM4A 3NZRA 3HGJA 3EWUA 3W1LA 2QJHA 3QSTA 4IX0A 3RK8A 4BWLC 3SR7A 3H54A 3P82A 4Y96A 1FWWA 4U28A 2Y6ZA 2Z2UA 2ALDA 3HIJA 5EMUA 2NWSA 1H60A 3MW7A 3PVFA 4R33A 1O60A 3C3NA 1N7KA 4I9AA 3KRZA 1ZFJA 2CZDA 3CT7A 4FNRA 3BARA 1K3UA 3NAVA 1C8VA 5DY2A 3GDRA 3HJZA 1DKWA 1GVQA 4JICA 5D2XA 4A3UA 3DH7A 1JCLA 2PRLA 2V81A 3QW3A 3NVTA 1IXNA 3DZ1A 4LVGA 3HO8A 4AWSA 1XXXA 3NA8A 4JTGA 3Q58A 1H1YA 5CSRA 5F4XA 3KVJA 4JS3A 2C16A 1MEHA 3I65A 1FXPA 1OYAA 3D0CA 2BTMA 1ZENA 1SO6A 1SU5A 3NQ8A 2OX1A 1X1OA 1BWKA 5KTLA 3B03A 2TSYA 1IIGA 2J9XA 1OG0A 1I2PA 2VFEA 3MI6A 4QM1A 5DBUA 3SSJA 1XDLA 3NL3A 1S5WA 1K7EA 4N6FA 3M9YA 3OVRA 2I14A 2GJNA 4ALDA 3HMJG 3HF3A 3TMLA 1W5MA 2D73A 5D03A 4O1BA 4IOTA 2PURA 4O10A 3R12A 3EXRA 4LS1A 3LBCA 2X30A 4RZ4A 3FS2A 1Q6OA 3NQFA 3MYPA 4JTKA 1O5KA 1VR6A 3HOJA 5A5WA 1OFQA 3JRKA 2FQIA 1I2OA 1H61A 1GTEA 1YPFA 2WNQA 3GDLA 4WQ6A 3HG3A 3FOKA 2CFFA 2GVJA 3SI9A 3VNDA 3BGGA 1F6PA 2WNNA 4FXSA 1HO1A 2EF9A 4ORMA 3LCWA 4IX2A 1TMHA 2BLEA 3BPWA 2O7QA 2B7OA 3B0PA 2OT0A 1LLZA 1FWRA 2A85A 3VE7A 1LTDA 2F84A 3W70A 3QQ1A 3SGZA 3W7NA 1U83A 3GVGA 2XN0A 3W7MA 5HULA 3OA3A 4MFEA 5KZEA 5I3GA 3GDTA 4OGZA 1OX6A 3W2JA 3PULA 2ZZ3A 5FF2A 1DQXA 3QFEA 3UWWA 1FWSA 1LRNA 4AHOA 1L2UA 3W1MA 4QITA 3N9RA 2P10A 3PB2A 3ZR4A 4G1KA 1L6SA 1FWNA 4M19A 4JTSA 1P0KA 3W7JA 3LTYA 1G4EA 3IIXA 4FX7A 3KXQA 4YMZA 3BO9A 5K9DA 1QNVA 4CNPA 1A5SA 1PHWA 1LP6A 3STEA 1TO3A 3TSDA 4WY0F 1ZY9A 1YXCA 4UR8A 4LRSA 1PL9A 3G3DA 4GFSA 1MEWA 3A9IA 3GNDA 2RKXA 3NQAA 1FQ0A 3N2MA 3NQ6A 5TBOA 2H3BA 5AB3A 3A5VA 3MP4A 1GJPA 2A1YA 3TH6A 3S6DA 5G5IA 1AL8A 3TU9A 4BI5A 1JRCA 3CIWA 4PCFA 2QCNA 3W7CA 2ZRWA 4UTLA 3N73A 2X1TA 3FJ6A 1JQXA 3DENA 3IIOA 1GT8A 3O6DA 1IXQA 2YDAA 1KM0A 3FYOA 1VCFA 3C2VA 1V5XA 4JX6A 4NQ1A 4JIQA 3UNDA 5GVJA 1SO4A 4TR9A 2QCDA 4NZFA 4N4QA 1F76A 4NVTA 2OZ0A 4UFJA 5LSMA 2ATSA 1SUXA 2H90A 3DKJA 1H5YA 4AB4A 4BF9A 3MHFA 1VJIA 1YXYA 1DJNA 3WK2A 5F2GA 1TPEA 1N8FA 3F1QA 5E93A 1GYLA 1GVFA 3P5YA 1RV8A 3UPBA 3C2RA 3KHJA 3N19B 1C29A 5AHIA 3W22A 4JY9A 1ICSA 1ZAHA 4K6AA 3NL5A 4NJKA 3M47A 2B7NA 5D02A 1H1ZA 2QCDB 3W1QA 3MO7A 2R14A 3TX9A 2CZFA 3PBWA 3P74A 4RV8A 5EY5A 1ZNNA 4FNTA 5D09A 3UY8A 5LNSA 1OHLA 1WYIA 3EEGA 3NQCA 2J9ZA 2ZZ5A 1SZGA 3P81A 1PIIA 3FIGA 2EPHA 5G4WA 4E0CA 3L2IA 4HHPA 2E6DA 4AEOA 2GJLA 2ISSA 3S5NA 3PM6A 3NZ1A 1JCJA 1TTIA 3L66A 2Z1BA 4Z1CA 4Q33A 3W87A 3A5FA 1TPH1 3KVKA 2DZWA 3RLUA 5E0KA 3JR2A 3P67A 1VCGA 4TMBA 1OX4B 4RK8A 3DHFA 4S1FA 1QPOA 1I2RA 1XKYA 3DAQA 4LWWA 5HINA 3P7YA 2CU0A 1TJRA 1GEQA 4LRTA 4PL1A 4LT9A 2ZZ2A 3EXTA 2CW6A 5BRBA 5F4WA 3EWYA 3HPZA 3KOFA 5CPOA 2QDGA 3W1NA 1O5XA 2NX3A 4HKPA 2NXHA 3G3MA 4CQ9A 2ZZ6A 5F2LA 4ZQOA 1JCYA 4FX8A 4IMDA 3NL2A 4GUJA 4MZYA 4DELA 3W71A 1WQ5A 5TQLA 4GC4A 3W73A 4MFDA 2ZZ7A 4JTEA 3TFCA 4CCCA 3LHVA 1IXPA 4XZ9A 1FXQA 2Y7EA 4JTIA 4IQLA 3LXCA 1QCWA 5AHNA 3U6WA 1AW2A 4XUGA 5BMXA 3TW7A 4UFIA 1H62A 3UD6A 5BW6A 1DOSA 2H8ZA 4M7TA 1Q6RA 1LOSA 2C13A 3S1VA 2QF7A 2AQWA 3B05A 5IBXA 3LTSA 3HG4A 3TKFA 1AG1O 3UZ5A 2QCMA 4Z1AA 1WBHA 1AW1A 2A0NA 4FNSA 3QQ0A 3M5VA 1TCDA 1G4PA 5J5DA 2Y7FA 1TJPA 5ABTA 1VCVA 1R2RA 8TIMA 1I8JA 1ONRA 3NQVA 4JR5A 4K8EA 2JGYA 3QMSA 1D3HA 1TPFA 5C54A 4RJEA 2JGQA 3QRHA 5DXYA 5AHFA 3KX6A 1I45A 4FHAA 3GKFA 3W3OA 4BI7A 2QUVA 3TQVA 3UPWA 3TAKA 1XUZA 4O52A 3QPYA 3BW4A 1TPC1 4FIRA 5FEWA 4A21A 4O4WA 1TYGA 5U4NA 4NJHA 1LYXA 3W7IA 4O1CA 1GVRA 5AC7A 3UYCA 1FX6A 3TXVA 4WY0B 1SPQA 1FCUA 1WOAA 2WQPA 4N6EA 1VYRA 1YDOA 3L9CA 2GOUA 1FBAA 1CW2A 1VC4A 1H7OA 3QJAA 1MSSA 1NF7A 3KRUA 1F7BA 3AO0A 3O16A 2RHGA 3TDFA 3UY7A 2V5LA 3TSBA 3CWOX 3IIZA 1SQ7A 3O6CA 3W1TA 4MKNA 3PR2A 1H51A 5EPDA 2BXVA 4E2BA 3DBPA 2HS6A 4AHQA 5C2XA 3L21A 1KBJA 3L0NA 4UMAA 5K9CA 3U8GA 1VLIA 2VXNA 4MJZA 2ZRUA 1KTNA 1ZALA 4IUOA 3ATYA 1PV8A 1W5NA 4XBKA 1HTIA 3IGSA 3EX4A 3T4CA 2VFIA 1VYSX 5AYXA 1H7XA 4RKAA 1AL7A 3UWVA 5MHBA 3IVTA 3W83A 4RZ6A 4IWWA 3PUDA 3CB8A 5EA9A 4DF1A 1ME9A 4Y8FA 1U5JA 3LERA 1TQXA 1G69A 4UR7A 2P0OA 4JY8A 5CZ0A 3LCGA 2NV2A 4LY8A 5T26A 3PUOA 3PAJA 1OFOA 4GWEA 3W7GA 2A6LA 2QR6A 3CHVA 1F73A 3RFAA 4YWIA 1LRTA 2E68A 3EWWA 5I3HA 2G5WA 4UTMA 3THAA 7TIMA 1AW5A 2PC4A 4UTJA 3LHWA 1K8YA 2FB3A 3DU0A 1PE1A 4AHPA 4HNVA 3NQMA 3LI0A 4E38A 1VH7A 4EWND 1P5BA 3NL6A 1XBXA 5IM51 2P1FA 4QNWA 4CQ8A 2Y63A 2J88A 3LDVA 3G18A 2FLIA 2V8ZA 3L0GA 1OFRA 3QZEA 2AGKA 2NX1A 1G67A 4Y90A 4HNTA 2CLFA 2NLIA 4O14A 1VLWA 4KFPA 4PC8A 4R7JA 3N14A 3W7HA 3NOEA 1VYPX 4LVBA 3NDOA 2TYSA 4RCXA 5J5RA 4LC8A 1YTKA 3ABRA 3W2NA 5AFDA 3TR2A 5KZMA 1VHNA 3GYEA 1JUKA 4ZQMA 1BEUA 5K4ZA 2WNZA 4LW7A 2Y88A 1DHPA 4O13A 4K38A 3L0KA 2H3DA 2FB2A 3BVJA 1ZCOA 4MYAA 1LM1A 3IVSA 4O0ZA 5D2WA 1FDJA 4MLRA 5HR7A 4I7UA 2VOMA 1P1XA 1SSDA 3W86A 2ZFAA 1KFCA 4JDYA 2QCHA 2B7PA 5DCDA 4O0KA 1OYCA 1DQWA 2A21A 3M44A 4UUIA 4ADTA 1Z42A 4UXDA 1OJXA 3CU2A 1H50A 4LV9A 5KITA 4HNNA 4AWUA 5KZDA 4XKYA 1GZGA 1TRDA 2ZDRA 4N02A 2X16A 1GQNA 3INPA 3S5YA 3LB0A 1Y0EA 3TSMA 1VZWA 4MZ8A 3CQ0A 3B0VC 2WV8A 1SO3A 5IBXC 3T55A 1OK4A 3W2LA 4NNAA 3W85A 4XTIA 4JX4A 4LU0A 4Z08A 3EWBX 4KWVA 4DEFA 3QH2A 1KFKA 1X1ZA 3WK3A 4WUIA 3QEZA 3UXDA 3TXZA 4OQVA 3TE9A 1LBMA 3W72A 1M7OA 2Z6IA 4O4VA 3MYOA 3PS7A 3LXBA 4B5NA 5BOOA 3P84A 3STFA 3SFKA 1KM4A 5AHLA 4ZL1A 1TB3A 5DY3A 3WJWA 4WXZA 3U2OA 3QF0A 1UJPA 1VHCA 1JUBA 1PCWA 1M5WA 3NPVA 3O1NA 3NYZA 5FF3A 1Q6QA 1KTCA 3PBVA 1KM5A 1VRDA 3DI0A 3C61A 3FKRA 1OF6A 3S1UA 1B4EA 3W1XA 4JD4A 1XM3A 4O1DA 4ZVJA 1FDZA 3KVLA 1LRQA 4FB7A 5LGZA 1ZHAA 3NQGA 1K7XA 4JNMA 3NXFA 1YPIA 4CLMA 3UWYA 5K2ZA 3A24A 2C15A 3G0XA 3LI1A 2J9YA 3DFSA 4ICNA 4FIQA 5EKYA 4N9EA 4RXGA 2XN1A 3DHDA 3OG3A 1UCWA 1M7PA 2HSAA 3W7RA 4C1LA 1CI1A 1OFBA 4GNJA 1JVNA 4JXCA 5CZJA 1O4UA 2RDUA 3C8FA 3I7SA 2E6AA 3CIXA 1J2WA 3QC3A 4MOZA 4TU1A 3TIMA 3W75A 4A2RA 1WV2A 4O50A 1R30A 4L4LA 4N2YA 3NGJA 2WKJA 1Z48A 3LCXA 4JGDA 3ABQA 5K7JA 1QOPA 1F6KA 2ISVA 2C6QA 2WSQA 2YR1A 3ZWTA 1WAUA 3NR0A 3LLDA 3PBUA 4X3ZA 1J4EA 1W3TA 1QPRA 3WK1A 1PHQA 5LKYA 5HNRA 3PUEA 1YDVA 3FFSA 3GR7A 3BLEA 3W2UA 5F2IA 2W0UA 4JTTA 1XBZA 4O54A 1Q3NA 5CG7A 3W1PA 2RDTA 4UFMA 6TIMA 1SW7A 1W5PA 1MXSA 3UWQA 2VENA 3NPXA 2E6YA 2PE4A 4GUFA 4MIMA 5K3VA 3S8HA 3KFTA 5D37A 3W84A 3LHTA 4IXHA 1G7VA 1T8XA 3E0IA 4MZ1A 3TA6A 5AOUA 5SWUA 3CEUA 3EXSA 2W79A 3P60A 2DZXA 3E9AA 3LCFA 4NU7A 1S5TA 1RPXA 2EHHA 2GQAA 4GUHA 4NX0A 3NQ2A 1A50A 3L67A 3PF3A 4KFNA 5HWMA 2JKEA 3KRSA 1EIXA 4DQWA 4M7SA 3TJLA 3CLMA 1VGAA 2W6RA 2FIQA 3C4UA 3G22A 4DPQA 5BNKA 4Y9AA 4AWTA 1O94A 1S5VA 2YXGA 5CSSA 3IIPA 4WX2A 2GUUA 5CZTA 3MMTA 5DXXA 1IIHA 3HQ1A 4TO8A 1EUAA 1W5OA 3H53A 4UMBA 1XBVA 3QSRA 4P2VA 1XCFA 3C2OA 2CZEA 4HT3A 3WJZA 3MWAA 2RFGA 3SZ8A 4OU1A 2Q3OA 1KV5A 1QPQA 2A5HA 3LXAA 3SW6A 4PL2A 4GBUA 3WJYA 3W74A 4LS2A 3VFLA 3L5LA 4UTUA 1JJKA 3QM3A 2I9EA 3R2GA 4NNBA 1H7RA 4Y6GA 3TFXA 1EWDA 5D2TA 4YLWA 3PBYA 3O05A 3CTLA 1FUYA 3G1HA 2VFHA 1RQHA 4OHQA 2HTMA 1VS1A 1XL9A 5LGXA 3T40A 1W3NA 4OV4A 5LNWA 3MP3A 3C2FA 2Q8LA 4JTLA 4HSNA 4QQ3A 2PCQA 3EX2A 4ZZ9A 4JTFA 3V75A 3A21A 3SECA 1FCVA 4ZQCA 3W2KA 2V30A 3DXIA 3M0ZA 1QWGA 2V5BA 3PG8A 3NM3A 4H4IA 1Q6LA 2QDHA 3OHIA 3W76A 4TMCA 1EA0A 1X6UA 5FF4A 4CNOA 4BR1A 4DO4A 3HG5A 2WSRA 4MY1A 1ICQA 3ELFA 3DFQA 4FNUA 1R2TA 4O57A 3IIVA 4UMCA 3TC7A 4IPIA 4H6KA 5E1QA 4A29A 2VKZG 5CPLA 5F1UA 4QIUA 4H3DA 1NAL1 5FI8A 5C5YA 5H2ZA 3LX9A 3LBMA 5F2MA 2R91A 2KZHA 4P61A 2OCZA 3BGJA 2YW4A 3F4NA 1MO0A 2AAMA 2YX0A 1G4SA 1OABA 4AVFA 1KTBA 1W1ZA 3MBDA 3T7VA 4W9TA 2X1UA 4OWGA 4MYXA 1KM6A 2ZRZA 1KLYA 3QYQA 3TAOA 3CWNA 5FF0A 3LM7A 1Z41A 1W8SA 3JS3A 5I3IA 1M6JA 1HG3A 1B4KA 3TW6A 4AAJA 3W1RA 2C0AA 4J9JA 1KFLA 5F4SA 3C52A 3LCHA 3EKZA 3P5ZA 2DZSA 1D3GA 1OX5A 1EUNA 4AH7A 4PTNA 3NPWA 1B9BA 3IVUA 2ABAA 1JULA 3ABSA 4R34A 3G0SA 1BTMA 3WFAA 4UFHA 3T44A 5I3FA 1TPVA 3ATZA 2X2GA 2ZZ4A 4TIMA 1TIMA 2FPVA 1GG0A 4NT0A 1L6YA 3QPZA 1ML1A 3LRKA 3OVPA 2Y62A 2YZRA 5LNRA 4DF0A 3GR8A 2A7NA 5KSWA 5C55A 3GB6A 3M5XA 1HUVA 3E49A 2FPTA 3O6YX 4I7WA 1QMLA 1OYBA 4AXKA 2YFNA 4CCEA 4JDBA 2VFDA 2ZTJA 3MUXA 4BK9A 3O06A 3EB2A 1SO5A 3TROA 5CZSA 5EYWA 1ME8A 2C3ZA 2FDSA 3HPXA 1T99A 1QO2A 1DVJA 2I1OA 4DBDA 1RQBA 1G4TA 4JN6A 4I7VA 5CPMA 3MI2A 3B8DA 5AHEA 2NUWA 2J24A 1K7FA 2NUYA 3E12A 3BG5A 3UWZA 2E77A 4YXGA 1ZAJA 1CX9A 5D32A 3GDMA 1MZHA 5CGQA 1UB3A 3OBKA 5AHMA 2DORA 3PSWA 2VEMA 3W6YA 4O16A 1GPWA 1JCMP 3OVQA 5I3JA 1GVSA 1VQTA 1OFDA 3LRLA 3BG9A 2WOQA 2ZRYA 3IGXA 4UIOA 3RLVA 3GXPA 4LS0A 5LZLA 1XUUA 3G1YA 1RR2A 5A8GA 4M6PA 1THFD 2WO5A 2EAWA 2E5BA 4EVZA 5LNVA 1YYAA 2G97A 2DZPA 3M1ZA 1YDNA 1K03A 1TTJA 3S1WA 3O07A 3VI2A 5D38A 3IGUA 2J6XA 4KWWA 4UTWA 3FA5A 1P0NA 2V0TA 3E96A 1WDWA 4K7VA 4MVAA 1LDCA 3UWUA 1P4CA 1SFJA 3M41A 1IXOA 3G1AA 1JCNA 2ZCGA 3R8RA 4LOCA 5D30A 1QFEA 2QKFA 1JUEA 2C1HA 4GJ1A 3Q37A 4N9BA 5DN1A 3PB0A 3W1AA 4PH6A 1LZOA 3F03K 3G0UA 1SFLA 4OT7A 3L5MA 2ABBA 2TRSA 3UQNA 4IGHA 5LNUA 1H7NA 2ZRVA 3NPUA 3VE9A 3G1SA 3VCRA 1KBIA 3T78A 3TQ0A 3LV6A 3HBLA 4UFLA 4K37A 4GE8A 2BSLA 3GIYA 3QW4B 3THQA 2GVGA 3PSVA 1SW0A 3B04A 1ME7A 4NX5A 4GXMA 4UTHA 1JQVA 1LCOA 5D2VA 1RZMA 2RDWA 3EX1A 4FNQA 1L9WA 3GNNA 4O8RA 2NWRA 2GVLA 2NXGA 3CC1A 3LCIA 4ML9A 2B7QA 2R94A 2Y89A 5G4EA 2ZYFA 1C9DA 1LOQA 1A5BA 1AK5A 5DCBA 3P61A 5I3KA 1B57A 2BX7A 4HPXA 4NJJA 1OVDA 2PRMA 1BWLA 1NF0A 3LGEA 3MJYA 5D33A 4ZQNA 4HN4A 3R89A 2ZQ0A 4HPJA 3MHUA 4UCGA 2V9DA 3DFPA 3TQKA 4IPJA 4QNEA 4KKXA 1W31A 2JBMA 1R2SA
chains in the Genus database with same CATH superfamily
3KBNA 3STCA 3BXWA 4JX5A 3ABOA 1EKOA 3MUIA 4YTRA 4PTDA 1LQ0A 4JQ4A 1V0LA 1KR0A 3HGOA 4LNYA 2GQ9A 1PUDA 1RPKA 4K39A 7A3HA 2QJGA 3H2OA 5LXEA 3H7UA 4DVOA 3JU2A 4PFMA 2LLEA 4XKYB 2DSZA 5CC3A 3V7PA 4UTKA 1W0MA 2V3FA 2YCLA 1TV8A 4BQ3A 4QJ4B 1MFUA 3UZZA 2E0PA 2FZ8A 1JZ4A 3BLIA 1JNEA 5A6TC 4KRUA 1UD3A 1NVMA 2ZX5A 3PWAA 3R11A 1LBLA 2XVPA 5CGMA 3DG7A 2NZLA 3R8HA 5DBTA 4U3CA 5AYBA 3IPWA 5DF0A 3TEVA 3R5EA 3DFOA 3GUGA 3LENA 3DFTA 2OWCA 2DSVA 2QJIA 4KCVA 3NTYA 4LYPA 3GQYA 3L68A 4WOQA 3IGHX 1CENA 3EB3A 3RHGA 5LIXX 2Y2WA 1UZ4A 3OA5A 1TREA 1R9YA 4DWDA 2GQ8A 3H23A 3G77A 3LTPA 4AFYA 3SSZA 2CLHA 3LPGA 1Q6FA 2W9MA 2IQTA 3RNDA 3PBMA 2Z0IA 4AD5A 2YL9A 4M8UA 4H8NA 2VEKA 1XLHA 2A6NA 1GTHA 2J7CA 1C3FA 2PDGA 1RQEA 4AD3A 3DYPA 4YVVA 1XQKA 4BI6A 3AMLA 3BJSA 1FWDC 1W91A 3T0TA 3B0UX 2OOGA 2ESCA 4PA8A 1B3WA 2E09A 3WQ6A 3GHRA 3S0CA 1MDLA 2B4GA 2WVUA 4NYYA 5DX7A 4FF7A 5PTDA 1TQJA 2V82A 3LOTA 4R53A 2WCAA 1MNZA 1OM0A 2QMJA 4ZOAA 2YB4A 3B8UA 5HPOA 5AN7A 4GABA 5CEWA 3UFYA 4FR6A 4CUCA 5AZ1A 1B1YA 1TV7A 3T4WA 3WLPA 1XLEA 1EO5A 2ZA1A 1I4NA 1PJ9A 4XG1A 2H6RA 1T0OA 4KWSA 2CBIA 1P48A 3VKKA 3ITVA 2QCEA 3H2EA 3BSGA 1U1JA 1S3TC 1RBOB 3IRDA 2JKAA 5HQMA 2IUZA 3N6HA 4NXSA 1F3XA 2WAGA 5E6YA 1OC7A 3E38A 3VX1A 1GVYA 1Y5VA 4XD3A 1E43A 4RXFA 3L4UA 3G1FA 2Q3RA 3WK0A 2Y85A 4PMXA 3GUWA 2VD9A 1UA3A 3QN3A 1DORA 4OFCA 3B4UA 4HCDA 2D0HA 1UP0A 4JTRA 1BGAA 3LHZA 4LC6A 2GDUA 3MA8A 5FESA 3E1F1 2WC7A 4KQNA 3W25A 3A3HA 1YADA 3B9AA 4LY4A 2IXUA 4GQRA 4UTTA 1KXTA 2OSYA 1TV5A 1QW9A 5M1TA 2QV4A 3LHYA 1XC4A 4DXVA 5G1YA 4RPQA 4TXEA 4OKDA 2DJLA 2HE8A 4LGXA 1FWFC 1B3OA 3MUCA 3C56A 1B0IA 2WC3A 4JYEA 2W62A 3LV5A 1T96A 2O56A 3BLFA 1UD4A 3EWZA 1M9HA 1DXIA 2CBUA 4NIRA 1HT6A 4RX0A 1V79A 5AYIA 3FSUA 1IF2A 3SEPA 1A0EA 4HPNA 1OGSA 2DSUA 7XIMA 4GYKA 3JZUA 3UVIA 2L5HA 1TJ2A 3O8AA 1C8XA 1MW2A 4AF0B 4AC1X 3Q94A 1IGSA 1KLZA 4V28A 4EANA 3ZWSA 1KKRA 1QI2A 1UUMA 1I6NA 3L4YA 4KGLA 5DLCA 3KTXA 3CYJA 3OO2A 1H2JA 2ZA2A 4L1GA 1D9EA 1QO5A 3VIKA 1LOLA 1TVPA 3PJTA 3SUVA 1EWEA 1ZL1A 3AWOA 1S3HA 1U2YA 2WHKA 4Z0JA 4AC7C 2O9OA 3WMSA 1HJVA 3HV8A 5JIPA 4KCWA 1I2NA 1KCZA 1RH9A 4MTVA 5LA1A 2CLOA 2JEQA 2WJDA 5F1VA 3WF1A 5IRPA 3EPOA 1XYFA 3NZQA 4PMJA 4MJ4A 4H9UA 1PDZA 4YCPA 4NJIA 4ZEPA 3ZLGA 2ZRXA 2H8XA 3DYOA 2J66A 2WM1A 4J27A 3PY2A 4RPPA 5G2WA 1AA1B 3QPEA 4MWAA 3ARSA 4MY9A 1QDSA 1VAHA 1K9DA 3RF9A 1LJYA 1XPGA 2W67A 1ELSA 2HK0A 2J13A 3K4WA 5KMYA 4BJHA 1KCLA 1XLCA 4M6QA 1VFLA 2ZXBA 2NUXA 1IWBA 2WK2A 4JYFA 3SB0A 4IQEA 3ANYA 2TMDA 4ZFCA 5A2BA 1QBAA 3EWXA 4C1KA 4NAFB 1WPCA 5HJLA 4O53A 4PRTA 1KFJA 1QI4A 4GY1A 3CGTA 4WIWA 4WOZA 1YXDA 1RJRA 3O9NA 3DFYA 3E5PA 4DBEA 2PDPA 3M5YA 4WKFA 4AUBA 4Q32A 1JCXA 5FEZA 1DJQA 5EBUA 3EOOA 4PEKA 3SCRA 2VFGA 4CNUA 3VNJA 3GC5A 4XBSA 2VI0A 1E70M 4B9ZA 5K9XA 3TYDA 4U5IA 5DCEA 5RUBA 3E2VA 1NFPA 5TIMA 3W88A 3O6AA 3DN5A 4Z0SA 1DXEA 4LCSA 4F0RA 2NQ9A 4MNKA 4OE7A 3G6LA 2XM2A 1UH4A 2X1SA 3H4GA 4AYGA 1TMLA 3AIUA 3SGUA 4C65A 4PYSA 4DAIA 1H1NA 3ZVHB 2DVUA 2WKGA 1DYSA 1TWWA 4PODA 3LGGA 4KEZA 4LUSB 1VBUA 1H7PA 4A22A 1I2QA 1D2KA 1PIFA 1U1HA 3BANA 4X2RA 1ZBWA 1V3HA 3AS2A 4H2CA 5LHFA 3L65A 1XLFA 3NZPA 7TAAA 4RZ5A 3NJ3A 4LVFA 5I09A 2ZZ1A 1G6CA 2I5QA 2FGBA 2QYGA 4UTIA 3AU2A 4Z2LA 2BG5A 1Z69A 2ZADA 4NZ1A 4DM1A 4H9XA 2QCLA 1X6LA 4FX6M 3WJXA 3W7QA 1GG1A 3BAWA 2WZMA 1N8WA 3W23A 1E4IA 1R47A 4JQ3A 1WZMA 1M04A 4E6MA 3HG2A 3GC2A 4U33A 1TA3B 3BG3A 4ZGYA 2WBGA 4ZB2A 2QUMA 3UEQA 3LHUA 3CM4A 2E4TA 3CV1A 3ARRA 4XZIA 3N4FA 4E4UA 1PYFA 1BF6A 3RK8A 3H26A 1NARA 2Z2UA 4QX4A 9CGTA 4ERIA 1H60A 3PVFA 1UWSA 4LUTA 3C3NA 4I9AA 4L4OA 3LA4A 4Q7NA 1ZFJA 4EKJA 3BARA 3L4WA 3EOUA 4PE8A 4KEVA 1X39A 3GDRA 4A05A 3WLOA 1DKWA 4A3UA 1JCLA 2V81A 4KF1A 3AXMA 3AIBA 2YKKA 1ISVA 3QOMA 5T8GA 2P3EA 3LBOA 4JS3A 1AVAA 2WM0A 1FXPA 2G3IA 4XO7A 3II1A 3L12A 3UCDA 1I2PA 4QS5A 3SSJA 2BV9A 3NL3A 3OGSA 4KRZA 3KLLA 3OVRA 1LWHA 3HMJG 1WE5A 1XWYA 3CQJA 4UTFA 4H00A 3WF0A 4L1XA 4O10A 3EXRA 1QATA 1XS2A 4LS1A 2X30A 4KPLA 1VR6A 5E09A 3HOJA 3VIHA 2FQIA 2VQTA 4QCEA 5CSUA 4R85A 4ICMA 3GDLA 2G3JA 2V5JA 2XZ7A 2GVJA 4E8CA 1F6PA 4GC3A 4FXSA 4ORMA 4IX2A 2BLEA 3BPWA 1RCXB 1UKOA 5D4YA 4D6HA 2OYKA 1LTDA 2YJQA 3GVGA 3AYSA 3OA3A 1C8QA 3M0JA 3RR1A 3OLEA 1QBBA 4HA1A 1OX6A 1JXJA 3QFEA 3B0YA 2VR4A 2OOFA 1FWSA 3OJGA 1D8CA 4ICCX 1PTGA 1GGOA 1L2UA 1EBHA 4QITA 1HJQA 4LEQA 4JN7A 5IXEA 1FWNA 4IISA 3BZJA 3W7JA 3AMKA 1G4EA 3IIXA 4HMDA 3T2QA 1OEPA 4YMZA 1GHSA 1PX4A 2XUCA 4FLQA 4J3WA 4CNPA 1GW9A 3ERPA 1A5SA 1PHWA 3M0YA 1V03A 1EPVA 1MMFA 1ZB5A 4W87A 3T2OA 1PL9A 4GFSA 3NQAA 1FQ0A 2G3MA 3NQ6A 3CUXA 2A1YA 1S2UA 4PUUA 3AJ7A 1NWSA 2I9UA 2IXVA 2QCNA 1A5MC 3KOXA 4L7ZA 3UJ2A 4AZCA 3T42A 3O6DA 4JX6A 4DI9A 4P8XA 2QS8A 3IJQA 3W81A 4H01A 1OC6A 2MNRA 2O9TA 4BQ4A 5AC5A 1EO7A 1F76A 2OZ0A 4UFJA 4H9MA 3NSNA 1H5YA 4BF9A 4HU3A 1V0NA 1CXKA 4GVFA 3F1QA 3GS6A 5E93A 4AD1A 3CQIA 4C6QA 3H70A 3C2RA 3KHJA 5AC4A 1I9CB 3VC6A 3UP8A 4LYKA 3QLLA 4JY9A 3W82A 1ICSA 2X41A 2J7DA 1A4LA 3E0LA 3VD5A 3V0SA 2AKZA 2O9PA 3TX9A 4AY1A 4Q8VA 4RV8A 3P74A 4IF2A 1WYIA 4CQCA 1LQAA 2ZZ5A 3BLKA 5FSDC 3PFMA 3H21A 3ONCA 4IH3A 4BQ5A 1PIIA 1WO2A 1KQZA 1IZKA 1ECEA 3CS2A 2ZE0A 1FP8A 1MZRA 4OECA 2GZXA 3S5NA 3QR0A 1TTIA 3L66A 1LT7A 3W87A 1UWIA 2F9RA 2DZWA 5E0KA 3P67A 4TMBA 1OX4B 2XVNA 3USZA 4HA4A 1QPOA 1XKYA 3OZOA 3ID7A 1W6TA 4J1OA 2XG9A 2BDQA 2GSHA 1YNYA 3EXTA 1F4AA 3RO8A 5F4WA 4ZTXA 4HU8A 4BZYA 5CPOA 4NF7A 4DHGA 5A3HA 1PYMA 2NXHA 3H24A 1T40A 4G6CA 5A6BD 3KOWA 2ACUA 3E2SA 3G3MA 2REQB 1SM9A 2ZZ6A 5F2LA 1JCYA 1V77A 4IMDA 4NI3A 3WLNA 3NL2A 4NASA 2HXUA 4QG8A 3GYCA 4GC4A 2ZZ7A 2BY2A 4W93A 1E0VA 2NQ5A 1M7XA 2I57A 3ARZA 3TN6A 3AZRA 4JTIA 1XSIA 1EYWA 4E3TA 4JOMA 3TA9A 4ECLA 1QCWA 3U6WA 1B3XA 3LGDA 4E8GA 1AD1A 3GVWA 4LQ1A 4XUGA 5BMXA 5HK4A 1H62A 1DOSA 2H8ZA 3TYAA 2QF7A 3ITXA 1AODA 2PSNA 1VFOA 1CXEA 1GOWA 3OHMB 1G4PA 5J5DA 3S4TA 3TTEA 3OLIA 1VCVA 8TIMA 1ONRA 3AFBA 4LYRA 4AD4A 4DJED 3QMSA 1D3HA 5JBFA 4RJEA 2C1IA 3DCPA 4D6JA 4LPCA 1UQYA 2BOEX 1DJIA 3GKFA 1XLAA 4HP5A 3I3EA 2VWTA 5T9CE 1JPKA 1XPYA 4CN1A 2WVSA 1YMYA 1ODUA 3BW4A 5FEWA 1FTXA 1VB9A 3MJMA 5U4NA 1UC4A 4NJHA 1GVRA 5CPQA 3UYCA 1FX6A 1I1XA 4URIA 4WY0B 3GG8A 2WQPA 3AIQA 1YDOA 4XKMA 4O0QA 2UWFA 1GKPA 1CW2A 1QNOA 1VC4A 3W0KA 3QJAA 4EP8C 1F7BA 2RHGA 1F3WA 2BHYA 2CETA 2V5LA 4NSBA 4DJDA 7REQB 2PAJA 4ZXLA 3ITOA 1QNSA 3PR2A 1H51A 4JNZA 1BYCA 2FGLA 4E2BA 3UXLA 3DBPA 2HS6A 2UY4A 4J35A 3MV11 4HSHA 1HJUA 2X7VA 4V33A 1VLIA 2VXNA 4MJZA 4QFUA 1U5HA 1YBQA 1PV8A 1JZ8A 1HTIA 3EX4A 3T4CA 4HOWA 1HJWA 2IKHA 3KOZA 1DWAM 4RKAA 1AL7A 2GLKA 2PDHA 4E4PA 3CB8A 3VNKA 4DF1A 1E6QM 4GZIA 4JFVA 2P0OA 4JY8A 4QAWA 4RE2A 2BOFX 3WLSA 3WUGA 1W2PA 5T26A 5DMYA 4JKMA 1GOKA 1F73A 4UTMA 4GQ0A 1G9HA 7TIMA 4S3JA 4UTJA 3GTIA 1K8YA 3DU0A 4P7LA 5I6SA 3MMDA 1FOBA 3EYPA 3DEQA 2WWDA 3NQMA 3ZOAA 4E38A 4LB3A 4EWND 3SADA 5REQB 4L6HA 1VKFA 1XRSA 2J8TA 5HAOA 2J88A 4YIWA 3L0GA 3WQ8A 4IGMA 1G67A 3AU6A 2WLYA 4PC8A 1A0CA 1VLWA 4JKKA 1PXGA 1POJA 1EX1A 1EC7A 4E4FA 4W8AA 4S3BA 3VOIA 4HPGA 4Q4QA 3W2NA 1E6SM 5KZMA 1VHNA 1E5JA 4RNHA 4N0RA 1BEUA 1CGVA 3IACA 4LW7A 4XZLX 2PUZA 1DHPA 1OIMA 3N6JA 4O13A 3L0KA 4DBUA 2H3DA 2FB2A 3RGTA 4HMNA 4MYAA 1V6WA 3PZNA 2YDRA 4O0ZA 4AX6A 3EDKA 1TX0A 3CIVA 3IV8A 1GQKA 4I7UA 3VZYA 1S2TA 1P1XA 3SCVA 4B16A 2YLAA 5A1AA 1SSDA 2PWEA 2J25A 1KFCA 3WQWA 2B7PA 5DCDA 3DGBA 5C2GA 1OYCA 3ZLFA 1VJSA 2AMXA 4PBFA 1CB2A 5E9XA 3F4VA 3KS5A 3CO4A 3WIJA 3FK4A 4YYFA 4MZ8A 3CQ0A 1SO3A 4JFSA 5IBXC 1QI5A 2DY3A 3W2LA 4Z08A 4DEFA 3QH2A 2VUYA 3WK3A 4WUIA 3CJPA 3DECA 3T1GA 3DC0A 3QEZA 4AW7A 4G5DA 3HQNA 3A13A 1M1BA 2CERA 3CAQA 3BQ6A 2XIMA 3V5OA 3AXIA 5AHLA 5DY3A 2ZUTA 5BROA 1ZQ5A 1VHCA 3VM7A 5B7ZA 2DZBA 1PCWA 5C71A 4S3AA 3B9NA 3AQUA 3NYZA 4YTSA 1KTCA 2GGHA 1KM5A 3T0DA 4R5EA 1B4EA 4JD4A 3ZJ6A 4O1DA 3U4FA 2XTKA 1FDZA 3KVLA 4FB7A 3NQGA 1RA5A 1NOWA 4PTMA 5K2ZA 3G0XA 2C15A 6PTDA 4HPHA 3LK6A 4DJEC 5C9RA 5EKYA 4LFYA 4IZGA 2HSAA 3W7RA 2PS2A 1U30A 5FSEC 1TFVA 1VFTA 1DWJM 1LLOA 4JXCA 1K6WA 1O4UA 2RDUA 1YNQA 1FVPA 3C8FA 4R7WA 4FA3A 3I7SA 3CIXA 1J2WA 3TTYA 3W75A 4A2RA 2PI6A 1R30A 3U4AA 1Z48A 1R7OA 2YCKX 1ADSA 3P2VA 2BNJA 2OFJA 2AKMA 3K46A 4X3ZA 1T8QA 5CBIA 2XIOA 1QPRA 5ECVA 5LKYA 4J7RA 3WFLA 3GR7A 1F6YA 4HVXA 3W02A 5BCAA 4JHOA 5DMNA 3P0WA 1WZLA 4Q8NA 3N2OA 2PWGA 1YW1A 3EMCA 3FVMA 1XIEA 3A9BA 3WLIA 3UWQA 2XPKA 1EQPA 1QNRA 5K3VA 1O7AA 1C9WA 2Q6ZA 1KBKA 1G7VA 3SCPA 1RXOB 3E0IA 4MZ1A 5AOUA 3EXSA 3VIJA 3E9AA 1S5TA 5C70A 2EHHA 2GQAA 4PUDA 3PF3A 5A2CA 1V02E 4PB3A 5HWMA 2JKEA 4DX3A 1EIXA 4DQWA 1NOUA 3GTXA 4M7SA 1RP9A 2UBPC 4BEUA 3TJLA 2V5CA 2W6RA 2FIQA 3PJUA 1UWTA 1SR0A 4NY2A 2DVTA 2R1PA 2ZDSA 1HZYA 1S5VA 3IIPA 1AQMA 3VC5A 2GUUA 2GJXB 3OVGA 3A4XA 4MB1A 5DXXA 2PGWA 1EUAA 1R3TA 5M03A 4P2VA 4WDWA 5ABFA 3LMYA 2CKRA 2GK1A 1XGDA 2CZEA 4PFHA 3CHDA 3MWAA 4LCRA 2RFGA 4Q4RA 4G7FA 1ENUA 4LH8A 4PL2A 2OELA 4LS2A 3VFLA 3W28A 3TZFA 4MGGA 2POTA 3LPPA 3R2GA 4B15A 4Y6GA 3O05A 3POCA 1XL9A 5LGXA 3ZM8A 3T40A 1E4LA 3MP3A 3DIPA 4MM1A 3C2FA 4JTLA 4HMCA 1KRAC 4HSNA 2PCQA 5CC7A 3EX2A 3N4AA 3AC0A 2IKGA 3SECA 1ZCCA 3WY1A 3CTTA 4H1ZA 1QWGA 3KS6A 3OHIA 3W76A 2PPGA 3AXHA 2CHOA 3K8MA 1AJZA 2GWGA 4H9YA 2WSRA 4MY1A 3ELFA 4HK7A 4ACZA 2BVWA 3IIVA 4YN5A 5CJNA 4A29A 2Q02A 1MW1A 1QRQA 5A94A 1A49A 1W9XA 3K4AA 2WMKA 1XIGA 2C91A 4CN6A 2HDJA 2KZHA 2OCZA 4J2PA 3GU1A 3AUOA 2JEPA 4YHEA 4A6GA 1DIDA 2V69A 5TNVA 3TAOA 2INEA 2W3ZA 1W8SA 1UP2A 2ISDA 3N18A 2C0AA 3VDGA 4GI6A 5IOBA 5F4SA 1RCQA 3C52A 3VNZA 1RK6A 1A3XA 2J8FA 1UR3M 1FWIC 3V1HA 4UBPC 1VBRA 1B3ZA 2ABAA 4D6GA 1JULA 1J0YA 1BTMA 1K9FA 2EG7A 4GCXA 1VBJA 1EEXA 2HROA 4NT0A 9XIMA 4JTAA 3GW0A 3LQGA 4AD0A 1W1TA 3D3AA 3UR8A 3W53A 3GR8A 1J9YA 4H2HA 4Y9NA 3CPGA 2PBGA 3ME3A 3GB6A 3V18A 2FPTA 2PTXA 3P6LA 2IW0A 4I7WA 3I6EA 3QR3A 5A6JA 3M6DA 1JFHA 2YFNA 2ZTJA 3B4YA 4BK9A 4Q7IA 3EB2A 5I78A 1UOKA 5EYWA 3B8TA 4GYPA 2CLPA 4WKAA 1WKYA 4WGHA 4DBDA 1RQBA 3QBUA 2Q71A 1CT5A 4I7VA 4HNCA 3MI2A 3ARPA 2Z26A 4BEQA 2PWVA 2J24A 2VRJA 1EH9A 1WDPA 3NO1A 1K7FA 3BG5A 4IM4A 1B3YA 3REQB 1F61A 3TTQA 1ZAJA 2DIJA 1CX9A 1PZ3A 3TQPA 3AYRA 5AVHA 4DYEA 4PRRA 1WDQA 4PTXA 3W6YA 2Y5EA 3GHTA 4BKNA 4GJJA 4YVXA 1M01A 3Q45A 3BG9A 1RBAA 4LS0A 4WCJA 1XUUA 4UQCA 4Q8MA 1JCTA 3B8WA 1UMYA 1Q65A 5A8GA 4JIRA 1CBGA 4IICA 1UPMB 3VD7A 2E5BA 5LNVA 3UVAA 3KBJA 2GVYA 4JBRA 2DSWA 2KAUC 5D8WA 3O07A 1EIBA 3WQPA 2P76A 5GNZA 4KWWA 3EAUA 3FA5A 4DXKA 2CWXA 3E96A 4K7VA 3UWUA 1SFJA 4OOZA 2FJUB 3HPAA 3MY9A 5JBDA 1IXOA 2PFHA 1UMLA 5KZ6A 4XSLA 4Z42C 3KWSA 1JD9A 2C1HA 1TIWA 4GJ1A 3VDBA 5DT5A 5GNXA 4PH6A 1W1A1 2AOSA 1SFLA 2WANA 4LCQA 3CMJA 3LN3A 3VE9A 3G1SA 4UOZA 4D6DA 1KGUA 5TAOA 1KBIA 2QW5A 1F9CA 1SJCA 3GVQA 4PBEA 2VL4A 2QF8A 3T05A 1W3JA 2BSLA 3GIYA 3H4XA 5E0CA 2GVGA 1SW0A 3B04A 1YKWA 2OGYA 4L9ZA 3GTNA 4HN8A 2RDWA 3B40A 1NFGA 3AOFA 1QT1A 3PPHA 2WCSA 2YL8A 3MQTA 4CD4A 2Y89A 1T6MA 1A5BA 1TWZA 3P61A 4S23A 3VYLA 5D33A 1MFVA 1FH9A 2R82A 4AWEA 1F3TA 3Q65A 1YQ2A 1R3SA 4UCGA 5G1MA 2V9DA 4QNEA 1TR1A 1IZCA 1W31A 3BGAA 3OZMA 2NQHA 4GO8A 3LU2A 5BXPA 3K1GA 3CUJA 3U5YA 1T5AA 3RMJA 4ADUA 1DBTA 2B81A 3RU8X 4B5VA 4Z1BA 1E3XA 4CD7A 4Z2KA 4HTBA 4NAEA 4PMZA 5DELA 4HB7A 2VURA 4XZMX 1NU5A 2VC6A 2BY1A 4S2BA 1TTPA 1XDMA 1X38A 3WX7A 5FEPA 1QI3A 4D6CA 4WJ8A 3RX3A 3C0JA 4O1AA 3G8RA 4W88A 2HMCA 1MNSA 3CQKA 3IUDA 3N3MA 1E1CB 4YJ5A 4US6A 5DANA 1W56A 2DQWA 2Y61A 1E4MM 3FXGA 3UR2A 1RALA 3QMRA 3FYYA 2PODA 3FEMA 2QPUA 1XLKA 2H9AB 1ZJIA 2ZTKA 4P8UA 4HCLA 2PWHA 4DM2A 4FLRA 1KO0A 1P7TA 4ACYA 4PMUA 3TNBA 3HGRA 1BVWA 3PC0A 5A6KA 5IFPA 4OBTA 5D05A 4TX8A 3WENA 2Z27A 3W9ZA 1W2VA 3IEBA 4ZQPA 2E6FA 4PMVA 1V8EA 3LZ3A 4NUWA 5H8PA 4JIPA 2J27A 1OK6A 3WYZA 2CZ5A 2I5IA 2E1WA 1TRIA 1OFAA 4GJIA 4LVDA 1ZLPA 3EWCA 2MUCA 2DUXA 4TV6A 2CLLA 2EGZA 4PUEA 3GZ3A 3GFYA 2ZUNA 3MANA 4GYFA 3LQLA 1AUSL 4HOZA 1LL6A 1Q7QA 1UKQA 9RUBA 2XFYA 3F4WA 2P53A 3ITGA 1MXGA 4O12A 4BFAA 3W27A 4D6IA 1Q2SA 2X1RA 3MZ2A 5TF0A 1SR9A 1SVDA 4GZ7A 4IMCA 1OIFA 4K36A 1O1ZA 5M17A 4PCPA 4HZ8A 2OVLA 3PN8A 3MI3A 3FVDA 3SRHA 1K6AA 1Q8AA 1V3LA 1XSJA 2VFFA 1UASA 2BZNA 3AUJA 3W7EA 5EL1A 5IDIA 4A8IA 3F2CA 3TC3A 1F05A 2FTPA 3VOGA 1S1RA 3TN5A 6ALDA 4NG3A 2F6XA 2DZTA 1TX2A 5LHEA 3VKJA 4DN1A 1NP0A 1ZGDA 1G1YA 3C3UA 1EBGA 3WQOA 4EXBA 3H2FA 1MEIA 4XZHA 2OXNA 1IYXA 2FZ9A 1K02A 3ZVIA 1VIWA 1TV3A 3HU7A 3S5ZA 3R25A 4J3SA 4GXPA 3A22A 1ZRQA 1BKSA 5HWNA 2GYIA 3A4JA 1R3WA 2VDGA 1A5CA 5HQEA 1NY1A 3AMDA 4KFOA 2YBTA 3NO5A 2PMQA 2O9RA 3SY5A 5CPSA 1KM2A 3AIEA 2IPJA 4FLSA 4KWUA 1HKWA 3CLWA 4US5D 4ZMGA 1VPQA 5AC6A 2FJKA 5FJOA 1UD8A 3W7PA 1MWOA 1LBFA 2VQUA 4C6PA 3EX3A 4AF0A 1RVGA 1KM3A 3L4XA 1XF0A 2BWGA 1EP1A 1WKEA 1IR2A 2O4MA 4LVAA 1PS9A 4LV4A 3SM0A 1Q63A 3WD3A 4KESA 1LORA 2E5DA 3VIMA 4Q8UA 6XIAA 4LXFA 1R46A 3VNIA 1W3KA 1BQGA 2E3ZA 4QAIA 1DWFM 4NP7A 1NP2A 1T7LA 4M6VA 4DUXA 3G1DA 2ZUWA 1EGMA 3M16A 4YCOA 4IXXA 2YFOA 4QE5A 3NNTA 1V0KA 1UBSA 2RJGA 2FPYA 2VRKA 4GFIA 4V2XA 3HJEA 1KFBA 4GRSA 2HVMA 3SRFA 2C79A 1XH2A 3TUUA 2VEPA 3MS8A 2ISWA 4F0HA 2QDEA 5I07A 1E55A 1Q2RA 2A2IA 1W1YA 1UR4A 1JRBA 1JZ6A 4GH1A 1E3ZA 1F8MA 3W4RA 4UC5A 3DGRA 3GAYA 3FCPA 4IHCA 1KV8A 3T08A 3W2MA 4ADSA 5D2YA 1W32A 1A53A 2E1DA 2TODA 4FO4A 3S9IA 3CEPA 4AMCA 2XVKA 2NX9A 2VWSA 4CNNA 1ZSXA 1DEDA 1O12A 3TC6A 3EX6A 3S2NA 3FDGA 1TVLA 1S46A 3M0VA 3URQA 1PDYA 2PZ0A 3PNUA 3NEHA 3CZEA 3BJTA 1ADOA 3NQEA 3P62A 4RV3A 3SUSA 6A3HA 4EE9A 3QC0A 4I6VA 1EC9A 1MXDA 2C14A 5IDZA 2QCFA 1W9DM 2YW3A 3NG3A 1FDYA 4F48A 4TVCA 4D2JA 3LCLA 2E5CA 5D9PA 2DQXA 3DX5A 1QHPA 2QGHA 1G5AA 3KBVA 2QEZA 2J7HA 1CECA 1NSJA 4GY0A 4MDPA 4DI8A 3HPSA 4Z1DA 2WPGA 2PGFA 1WAWA 1NDZA 4I9TA 3WBEA 3P93A 3VX0A 3ZVHA 3A3WA 2QV5A 3IWPA 1WDDA 3STGA 4CQAA 1LROA 1R3RA 3CUFA 1UR0A 1SGJA 3O7UA 3WH5A 2XSXA 4Q6JA 1JF5A 3WJSA 1SZNA 4S3FA 1V6XA 4F4RA 1Z7AA 3OLDA 3PZ9A 3S9YA 2Y8KA 3UG3A 4B5SA 2AL2B 1UZDA 4NXKA 3VOFA 1DL3A 1FA2A 2YCEA 2ZWYA 4D8ZA 4IQDA 3ZXWA 5BWFA 2HS8A 2F2KA 1FCQA 4C6KA 1FWTA 3TJIA 2CLKA 2PF0A 1E71M 1JGMA 3WMLA 4HA3A 5FJPA 3MBFA 3BAYA 2ODOA 1JEZA 1OC5A 3QHNA 1Z89A 1H0IA 3WG6A 3AS0A 4QRNA 1Q45A 4MNJA 3OW1A 4EF8A 5FJIA 1JPMA 3R1ZA 2VZSA 3IV3A 4Y9PA 4GUIA 2VELA 5HR6A 1V51A 1S5NA 4B91A 1DWGM 3CUHA 5LA2A 3TJ4A 3NM1A 1CGXA 3WQVA 4FXRA 3PZMA 4A3HA 1KM1A 1H3GA 4DWSD 3TP4A 1A5AA 4XD4A 2VC7A 2WMGA 2VDIA 1YHTA 3COTA 4AEEA 1K8XA 1IEXA 2BGQA 2NSXA 1QAPA 2V68A 4GACA 4MB5A 3IAPA 5HJYA 3WD2A 3QHOA 1R3YA 1UWUA 4GBDA 3MPGA 1CB7B 1O1HA 5CCZA 3PTMA 1J5TA 4AXNA 5JU6A 3GAKA 5FEXA 4XV0A 4G2DA 1YLVA 3HGJA 5JBEA 5I02A 2WVVA 4MJ2A 4M24A 5EMMA 3DYMA 3H12A 2D2JA 4IX0A 3SR7A 1CYGA 3H54A 4U28A 2ALDA 4K1WA 2HJPA 3HIJA 4PMOA 5E0FA 1O60A 2OEMA 1PKNA 8RUCA 2CZDA 3CT7A 3ONBA 2OWWA 3NAVA 1C8VA 3ECQA 5DY2A 1WUEA 4Z2HA 1A5UA 1GVQA 2ZC1A 1JZ2A 1F07A 1J6PA 3VILA 2ZX8A 3SCQA 4DBSA 1IXNA 2YA1A 4LAKA 4QLKA 4C6FA 3DZ1A 3FAWA 3CK5A 5F4XA 3NSMA 1OYAA 3D0CA 4ATDA 3FXYA 2BTMA 1SO6A 5HNTA 1X1OA 4KGJA 3B03A 1OCQA 2TSYA 3MZNA 1IIGA 1OG0A 4C91A 3MI6A 2BMBA 4ILSA 4N6FA 2G4JA 3M9YA 4C5YA 2ASHA 2D73A 5D03A 2GGGA 4JZ5A 4FPSA 2PURA 4B4HA 2YL6A 5A95A 3DHUA 2DH2A 3JRKA 4TV5A 9XIAA 1A5LC 3CB3A 4UOQA 1I2OA 1H61A 1GTEA 1EOMA 1V4YA 3N2BA 3OG2A 3AIRA 4XAZA 1VJZA 3FOKA 1BVNP 1E0XA 2CFFA 3VNDA 5M2FX 3BGGA 3EZ4A 3E3HA 2ZX9A 4LF2A 4C6DA 4H9VA 2J8GA 1BTCA 1KGWA 3B0PA 2OT0A 4IIGA 1J0HA 2A85A 1QPKA 3SAZA 3WNLA 1QJWA 2VO5A 3W7MA 4MFEA 3APYA 3GDTA 4OGZA 3QLDA 2A3CA 1A5KC 1IHIA 3THDA 2FZBA 2ZZ3A 1DQXA 4GQBA 3UWWA 1LRNA 3WQ4A 3QV7A 1DE5A 1BFNA 3URAA 3UERA 3N9RA 1XLDA 3NVDA 1CXHA 1LWIA 3BC9A 5HANA 4Z17A 1RJPA 4M19A 1P0KA 4UB9A 3UA4A 3OB8A 1WDSA 2QMKA 4FX7A 1F3EA 3KXQA 3BO9A 5K9DA 1TZ7A 1QNVA 3STEA 1TO3A 4WY0F 3HMCA 1YXCA 2XGIA 2YXXA 3G3DA 3MKCA 1MEWA 3AMCA 1VFUA 3BURA 5TBOA 4IIEA 3MP4A 3RM9A 3TH6A 5I79A 3EEZA 5JQ9A 4ZTYA 3W7CA 2ZRWA 3N73A 3R8GA 3IIOA 3QY8A 1GT8A 1IXQA 5IHSA 1KM0A 3C2VA 4NQ1A 1L6FA 3H4WA 1TWSA 4HZ6A 5EFFA 3VOHA 2DPEA 5LSMA 1JL8A 2H90A 5BRQA 2DT0A 3HFYA 1H49A 1JNDA 3CH0A 1YXYA 5E9AA 3HM7A 2Z1SA 3APTA 4ZXOA 1GYLA 2P5NA 4YU1A 2PWDA 4PEEA 4RNIA 3DOPA 1ZAHA 2HWGA 1BG9A 2VCAA 5D02A 3H2MA 2QCDB 3W1QA 3MO7A 2R14A 2CZFA 3PBWA 5EY5A 3KM8A 1ZNNA 5LNSA 4PUJA 1OHLA 5H8MA 3NQCA 4L9XA 3ZR5A 1XYLA 4IJRA 1SZGA 3HTWA 3WH6A 4DWSC 5G4WA 4E0CA 1GQJA 8A3HA 2GJLA 4R27A 2ISSA 1HKJA 4IPLA 1DJWA 1QNPA 2Z1BA 3QTGA 2XIIA 3BLLA 1QXLA 2BXZA 3OTRA 3JR2A 4H9ZA 4RK8A 5DFAA 3DHFA 3MMWA 1I2RA 2P88A 3WUFA 3H7RA 3MMUA 5HJXA 1DJGA 3WLJA 3PZOA 2OZ3A 1TJRA 1ZS2A 4LRTA 4PL1A 5LIWX 5BZAA 2CNCA 2G3FA 4R88A 3AXKA 2JFEX 2YL5A 3E2QA 1ITQA 3KOFA 3RDKA 3GH4A 3GHSA 1TELA 1I0DA 2PWUA 2Y8VA 2NX3A 4HKPA 1ESWA 4CQ9A 4Q8QA 4FX8A 4B2DD 3N17A 3TFCA 4CCCA 1XICA 1EQCA 1X1NA 4XZ9A 4XZNX 2BHUA 2Y7EA 4AY8A 3PK7A 4IQLA 1MUMA 4LJ3A 1HKVA 3BCJA 4W4QA 3WNOA 5HATA 4XAGA 2XM1A 3MSRA 4W7VA 3UD6A 1AH4A 2P3ZA 4R3UA 3B05A 3BCDA 1MQQA 5IBXA 3TKFA 4Z1AA 1AW1A 2A0NA 3M5VA 2QJNA 2Y7FA 1MQPA 4JTQA 5ABTA 3RJXA 1R2RA 2PWFA 1I8JA 4JR5A 3FX4A 5A6AA 4K8EA 1HVQA 2OZ8A 5C54A 4MADA 3C2YA 3QRHA 4CQBA 3KX6A 5CJMA 4XX6A 4MF4A 1XRTA 4JKLA 4BI7A 3MTWA 4E3VA 3EA2A 1XUZA 4O52A 4HBKA 4FIRA 3SRKA 1FFRA 1E40A 3AYTA 1TYGA 2IPFA 3CBWA 1LYXA 3W7IA 4O1CA 1E9IA 5AC7A 1OGBA 3K5XA 3WLTA 1WOAA 1VYRA 4ROPA 4MWAB 3RJYA 2GOUA 1FBAA 3CMFA 1NF7A 3KRUA 4PSPA 4HTYA 3AO0A 3OU8A 3TDFA 1IT7A 2DT1A 3CWOX 4DJEA 4QDWA 5J8LA 5D9NA 4PTWA 3CO8A 3RO6A 3P3BA 3O6CA 3N04A 4MKNA 3ENLA 3L21A 3WF3A 1RLDA 5K9CA 3ZSTA 4CU8A 1VP5A 4PZVA 4GO9A 4GZEA 4ZOEA 4IPNB 1GOIA 1L8PA 4HZMA 1CXIA 1H7XA 1REQA 5AYXA 1CIUA 1S2CA 3UWVA 1XKJA 4RZ6A 5EMYA 5EA9A 3ITTA 2GGIA 2PDNA 2Z4GA 1TQXA 2DSKA 3D46A 5CZ0A 4F9JA 4LBSA 3SQSA 4LY8A 2J7FA 3PUOA 3N4EA 3PAJA 4Z2JA 1GZJA 3RFAA 4YWIA 1BVZA 2G5WA 3THAA 3FGCA 1LUCA 4O1EA 2FB3A 1J5SA 2VYOA 4AHPA 3MSYA 4QTGA 1ISYA 3GTFA 2E7FA 3NL6A 3EWDA 1HVXA 5IM51 4QNWA 3CZGA 4PMYA 2E25A 4H6RA 3AHXA 5H6HA 2FLIA 2VT0A 4IP5A 3S83A 1OFRA 4HNTA 4TUFA 4LAUA 2NLIA 4O14A 2XH2A 4GI9A 3W7HA 1VYPX 4LVBA 1HP4A 1YTKA 3ABRA 1K9TA 3TR2A 4ENLA 2GFTA 3GYEA 2WMJA 3VO0A 2GUYA 2Y88A 4AZIA 4Q22A 3T8QA 4L65A 3AHYA 4Q8PA 2J74A 1IZJA 2VHLA 4MUPA 4KCTA 2X42A 4MMWA 1DJXA 2V5DA 2I17A 1KWGA 4MLRA 3ZT6A 1LL4A 3RRAA 3WNPA 4WKHA 2ZFAA 2QCHA 3PJWA 2V6AA 5CPTA 4F3HA 2A21A 3WH9A 4QLJA 2OR2A 1J12A 4C6EA 5KZDA 3CHCA 1TRDA 3BLOA 4N02A 3ITLA 1JAKA 3S5YA 4IPPA 1AQHA 3TSMA 5MKGA 1VZWA 1ZBKA 4QDPA 3LY0A 2EBNA 1OK4A 3ZT7A 3W85A 2GOKA 4XTIA 1BGGA 4RUBA 1XLMA 4LUTB 1KFKA 1UP3A 2XHYA 3O3RA 3UXDA 1E5NA 3ZJ7A 2IQ0A 4OQVA 3TE9A 2AMGA 3FJNA 3WDIA 5BOOA 3P84A 1ITUA 1XYMA 5FCZA 2HRWA 4FZIA 4WXZA 3U2OA 1MYRA 3QF0A 3UJEA 3BL3A 3OGVA 1R3VA 3PBVA 1VRDA 3DI0A 3S1UA 4YHGA 2NQJA 1LRQA 4GYPC 1ZHAA 3N12A 1K7XA 4JNMA 1YPIA 4DNMA 1LL7A 1RY0A 4Q4MA 2OSXA 2XGBA 1H0GA 1CI1A 2J4GA 2EPKX 4L9YA 1JVNA 2ZC8A 3MV01 3HA1A 3S5SA 2E6AA 4MOZA 1KRBC 3IJDA 4L4LA 5CQ1A 1PZ1A 2IPGA 1DE6A 4JGDA 4G7EA 4KMQA 5CC5A 2QIWA 1EJ7L 1PEZA 3C8NA 3VGGA 4P7OA 3VD4A 3NR0A 4IG2A 1J4EA 5BWAA 4NZCA 1Q6GA 3URBA 1YDVA 4E8DA 1EXPA 3VAVA 4I8YA 3TLQA 1RVKA 3WNNA 3LNMA 5CG7A 1M3UA 4UFMA 1W1IE 4QDMA 6TIMA 1SW7A 2WMHA 2ZIDA 3BMVA 1MXSA 5B7YA 1V0MA 2D3LA 5DT7A 1NWRA 1HGYA 3W84A 1RSCA 3B9OA 2OTDA 2HVNA 3FSTA 1HKKA 2E9MA 2GJXA 3FNDA 1N82A 3TA6A 1UZHA 3FAXA 1ISWA 1RPXA 1GK8A 1X8CA 5GNYA 3NQ2A 5G4HC 1QNQA 2XH7A 2XVGA 2W63A 3KRSA 5H1WA 1GVIA 1W9VA 1XJBA 3BSMA 3M0KA 4XAPA 2PBOA 2ADAA 3C4UA 3GFZA 4KRTA 2YXGA 3WD1A 4KETA 1M65A 4F2UA 1IIHA 4AZCB 4BA0A 4QBXA 2CKSA 3VZXA 3C2OA 3KBMA 3WJZA 4DUWA 3IK2A 2Q3OA 4D8AA 3OBEA 3SW6A 1QVBA 3WJYA 3PZVA 5I23A 3PZGA 2FYMA 1VFMA 3QM3A 3GXDA 4NNBA 2E9BA 3G1HA 4PMQA 2HTMA 1XFCA 1TKKA 4JPGA 1LF1A 5E70A 2Q8LA 3A47A 3VFCA 3V3WA 4ZZ9A 4JTFA 3V75A 1EHNA 1FWEC 2CZVA 3ANVA 3A21A 1FCVA 4ZQCA 2V5BA 3PG8A 4IGSA 3W29A 3ZMRA 2QDHA 2OO0A 2AQVA 2VMFA 1EA0A 1JDDA 5A8MA 5FF4A 2J47A 4BR1A 3GO2A 4D9PA 5D9OA 3KDOA 3ABZA 1SFTA 1NDVA 4J3VA 3PPGA 4MG4A 1XLIA 4UMCA 2GWNA 3TC7A 4IPIA 4UCFA 2VGFA 3UW6A 2GVEA 1NAL1 5CAHA 5C5YA 3F5KA 5F2MA 2YW4A 4ZODA 3F4NA 4HNLA 1JFXA 1G4SA 4AVFA 1W1ZA 1HGWA 4OWGA 3VDAA 4MYXA 1KM6A 5FF0A 2R1MA 1OADA 4G8TA 4C6JA 3GVVA 2XVLA 4HCHA 1HG3A 4RL3A 4C6IA 3BLPX 4GGBA 3OQEA 3QZAA 4JIHA 2D24A 4E2OA 3EKZA 4GXWA 4QR6A 4AH7A 1B9BA 3V0UA 4ZR8A 3VIPA 3ABSA 4J3XA 1S39A 3N9KA 4OVXA 3T44A 4L1WA 3T07A 3ATZA 2ZZ4A 1TIMA 3CL6A 3PZTA 4L56A 1JG9A 3QPZA 3VIGA 3OVPA 2Y62A 3E74A 3LNPA 4DF0A 3GHUA 4JNYA 5KSWA 4UQBA 1R86A 3M5XA 3M64A 3ALGA 1O5RA 1B2YA 5JUVA 1XYCA 2EJAA 2O55A 3O6YX 2XIQA 2VFDA 4IIFA 3DHPA 3TN3A 2DDXA 3BSHA 3O06A 4JCMA 4WLCA 5CZSA 5A8OA 4C6OA 2R9RA 2PDCA 1T99A 1QO2A 1DVJA 2I1OA 1JZ5A 4KIEA 3BUVA 4H41A 4JN6A 1W3LA 5CPMA 3RR4A 4REQA 4QXIA 4J2MA 4UZSA 3UXKA 2OLAA 2F61A 2E77A 4TVDA 4JQAA 3GDMA 1XINA 3LMZA 2DW7A 3PSWA 2BY0A 2WJFA 1JCMP 1HXJA 4XAFA 3XINA 4GVGA 4PMRA 3G1YA 2QIIA 1WDRA 3WNKA 1THFD 3AMGA 1ZUAX 1Q66A 2G97A 3WCZA 4AQLA 4BS0A 5M5DA 3UZYA 3RXZA 4D6FA 1EZWA 3NDZA 3SN0A 1V3MA 3CQHA 1K03A 1TTJA 1VENA 4UQ9A 3VI2A 1NQKA 3DERA 5D38A 2J6XA 1YBQB 3OZPA 4IGNA 4WR3A 2V0TA 3OODA 1G01A 1LDCA 4INFA 2RUSA 3M41A 1UBPC 2X7WA 4L4PA 1UKTA 3VGEA 4AVOA 2CEQA 2ZCGA 2Z1VA 3GWQA 5HMDA 2G8ZA 3SUUA 4N9BA 4H8HA 3PB0A 1UIOA 3F03K 3V5FA 3N13A 3ABXA 2ABBA 2NQZA 2WSPA 1UH2A 4IGHA 4MHBA 3T78A 3HBLA 4UFLA 4K37A 1E0TA 4GE8A 4MAVA 3I4EA 3CZJA 1J11A 4NX5A 4GXMA 1JQVA 1LCOA 2AAAA 4D72A 4KT2A 5EMKA 2GVLA 3CC1A 1JYXA 4ML9A 2B7QA 1M41A 1OWQA 4GVHA 3TYUA 1AK5A 1JPDX 5LXXA 1B57A 1PKMA 1Q8JA 4C7GA 1U5VA 4PTVA 2BGSA 4JAWA 2PRMA 3LGEA 3MJYA 2VC9A 5TD4A 1ZPTA 3N2TA 3DFPA 3GVRA 3L7RA 5D9MA 2WC4A 1IT0A 4Q8WA 4RW5A 3GNPA 1AD4A 1SW3A 3ZIZA 2QAPA 2JQXA 3CZKA 2QCGA 2YZ5A 4AZBA 3MO4A 3N2XA 5L9FA 2PLJA 1SJBA 1NELA 5EB8A 1QPNA 3RPTA 1SSGA 1KR1A 3K1DA 2CCRA 2EQDA 4IJCA 1N55A 1GWJA 1GJWA 1GYNA 3SCTA 4FI4A 1QOQA 1V02A 2E40A 3B97A 1ALDA 1F2JA 5AECA 3AXXA 2OLSA 4LUJA 3LG3A 2A7PA 2CLIA 4KW2A 4RZBA 5CXPA 3E6EA 2WHLA 4Q3MA 2VX7A 1SZEA 3K13A 3OIXA 3SY1A 1IV8A 1RLCL 3MC5A 1XD0A 2YB1A 3ZT5A 3I7QA 4P5UA 2ZA3A 3QQWA 4HNUA 3W37A 2CLMA 3W7LA 3C6CA 1VPXA 2GPTA 3CZ8A 2A79A 1NEYA 3MKVA 3APGA 3G1VA 1R9ZA 4Q4OA 5BYWA 3W7OA 2CWNA 4O19A 3R13A 2JIWA 3FJLA 2FGZA 2R8WA 4G1NA 3DFNA 5C7HA 1IEIA 4J3ZA 3KTCA 4QISA 5FF7A 4DO5A 5FJTA 4EAYA 2NV1A 2QCCA 3CH9A 1WXJA 3UU0A 4WZHA 1Z8AA 2WJZA 4ZQRA 1W1PA 2VGGA 1BWVA 4ORIA 3TK7A 4GHRA 3NEVA 1XGEA 4C6NA 3I68A 2BGNE 3IJ9A 4Q8OA 2VD8A 4WVXA 3SURA 2FHCA 3RYSA 2VR5A 4N9CA 1X7IA 3JZEA 3GK0A 1JDCA 2DIKA 1XYAA 3S1XA 3V16A 4AMAA 3C0LA 3MUY1 3UF9A 4W8BA 1TPUA 4QEHA 2V67A 3I6RA 3LLFA 4UTWC 1WKFA 3NQDA 1QHOA 3NZGA 4K7YA 4U5KA 3H2NA 1EDGA 1XFBA 4CCDA 3VKBA 2OT1A 5HUOA 3EPMA 1I1WA 3GD6A 1RJQA 5DO8A 3RU6A 4QG9A 6REQA 3VTRA 1JZ7A 3CAKA 3O0FA 5D04C 3ITCA 4B5TA 3BOXA 3EKGA 3V1PA 2BOGX 4JTUA 4WD0A 2ACRA 2D2OA 2PP3A 2Y70A 1ZBCA 3WLLA 1ZAIA 3CASA 3UXAA 2F8QA 3HZ3A 2UZ9A 3KVMA 3B06A 4IMEA 4LAOA 4XWUA 2VEIA 2VOTA 2HNHA 3T0CA 4JHMA 4RLIA 5GJPA 2G96A 1RY8A 4O15A 4LBRA 2PU0A 3P14A 3CHFA 2XH4A 3FV9A 2F7FA 3AIWA 1CPUA 4AU0A 1R6WA 1BLIA 2ATMA 2WSYA 3C2EA 1EP3A 1Q4WA 4O11A 3A23A 3BW2A 2R1KA 4HMEA 3DFHA 3I7RA 1G0CA 4B4FA 1XQLA 2QZRA 1NIUA 4NJGA 3GDKA 3NGFA 1X7FA 1B54A 4S39A 3MDWA 3QGAC 3HV9A 4S38A 3S42A 2VJXA 3ARXA 1V93A 4AIOA 1M03A 2PLKA 2HVOA 5ABFB 1H7WA 1C7SA 2GK1B 5I77A 3U0HA 4H83A 4NL1A 4LUIA 1W5QA 1PTAA 2BVDA 1H63A 1A4MA 3VGBA 3O15A 3ZYZA 3W6LA 4DNHA 3URNA 5HQLA 2O7SA 1XDJA 1YPXA 1NH6A 3M6YA 3IS4A 1W37A 4X61A 3G1XA 4UQAA 3S5OA 4YTQA 3NUKA 4PUWA 4DRSA 3FEQA 4S3CA 4XUYA 5CBBA 2Z6JA 3BW3A 2FTWA 3CXOA 4Q4KA 2GUBA 4AZ7A 1MRQA 4W86A 3T81A 3NCOA 2HISA 1TSIA 4DJFD 1NWTA 1W8GA 3BTNA 3K4DA 2YYUA 3GIQA 2NT1A 1WUFA 1UC5A 2DVXA 3GU9A 5AYYA 1P0EA 3KHDA 4US5A 4K8HA 4YL2A 3TCSA 2A7RA 4WSHA 1EDQA 3SIMA 2RJHA 3Q2DA 4HSOA 3VKAA 4EAMA 2OO6A 4ACZB 4EOUA 4FF5A 3LD5A 2TAAA 4D8LA 4GGHA 4WK9A 4HJFA 4QSHA 1S5MA 3FLUA 2Z28A 4M56A 4GUGA 2J62A 1X8FA 4O28A 3MB9A 1CGWA 3M7WA 4CEXC 5C7VA 3SCSA 3VK5A 2PEVA 5A2AA 1EGZA 1XLBA 4WXYA 4A2SA 2BBFA 4ERAA 2IMRA 4HK6A 4CN4A 4U4MA 4DUVA 3UG4A 1EJVC 1V6VA 4LAZA 4AIUA 4XSMA 2YA2A 1H41A 1X96A 2YYTA 4P7NA 3ZLHA 3WH8A 2BB0A 1WZKA 5JXQA 3NSXA 2FZDA 3H8AA 5CBJA 2EPLX 3RCNA 3GKAA 3PP7A 2GJRA 3WZ0E 3M0IA 4ZO7A 1EZ2A 1GYMA 4I3GA 3W01A 2VEGA 2YA0A 1F5ZA 1QTWA 4LTSA 4MDOA 3M07A 3SCOA 3GM8A 3OPSA 5IFTA 1YEYA 2ISFA 4O18A 3H22A 4NZJA 4L4MA 4JFUA 2DT3A 3USBA 2CXEA 1GEHA 2VX4A 4MY8A 3BK0A 4KIRA 3DI1A 4FSAA 2FVKA 2D1ZA 3GU2A 2DJXA 3M5ZA 4Q4PA 2FVLA 1CGYA 3I3BA 4HJWA 1ZBVA 3L5AA 4QJ1A 5HWJA 2DEPA 4IMGA 4DAFA 2VCCA 3SQMA 1A0DA 4LB4A 4FNPA 2NXIA 8CGTA 4AG0A 1XI3A 4ATWA 5KETA 3S2JA 4TTGA 3LM3A 3P8JA 1XV8A 2X2YA 3OZYA 4PSRA 2DZVA 3N1AA 3CAWA 3CV2A 3GTHA 1WXYA 2EKCA 1BQCA 1H4PA 5GJMA 3SY8A 1BYAA 4JEJA 2ZBTA 2QVHA 2B0MA 1Q6EA 2UY3A 3MVIA 2WKLA 5EFDA 1FHLA 3UZJA 3HN3A 3W1UA 1JZ3A 1GVOA 5MF5A 1FY6A 3ARTA 1GKQA 1KRCC 3O0KA 2V2CA 2YGYA 3CPRA 3KZSA 4AZ5A 5G1TA 4UNLA 1HO4A 4ZO9A 2CESA 5G2IA 2PLCA 2ZUSA 1AJ2A 2VTFA 1X98A 4E2DA 1PWMA 1WX0A 1SMAA 1HL2A 4X9SA 4HGXA 2VX5A 3R0DA 2FDMA 1HIZA 2C18A 1W3IA 1HF6A 4JYDA 3UR5A 2QUUA 2GGJA 1E56A 4CVUA 3AYVA 4KS0A 2QVNA 3WDRA 2P0IA 3TMQA 3P8IA 1UG6A 2Z2BA 1OF8A 3K2GA 1W54A 2DZUA 1Q6CA 2TPSA 1WZAA 3BOLA 5L6UA 4MLJA 1PBGA 1DV7A 4IQJA 1EP2A 1FCBA 3GXFA 4IP4A 3JW7A 2Z1KA 3EWUA 3S2MA 4I5UA 3KRBA 2FH6A 2IQDA 4BWLC 4Y96A 1FWWA 4W7WA 4ZCWA 4GZJA 3MW7A 1UH3A 3CNYA 3BDKA 1HN1A 1N7KA 3SCWA 4DWSA 3M46A 3B9EA 1BYBA 4FNRA 4NZ3A 1XSKA 3ARYA 3HJZA 2FMNA 4DJFC 4JICA 1DJYA 1RUSA 4RE3A 3DH7A 2PRLA 3CHEA 5DQPA 4MAZA 3GC4A 4X60A 3NVTA 4W5UA 4QHRA 4AWSA 1D3CA 3Q58A 1H1YA 2YCJA 2PTZA 5I7GA 3I65A 2QHAA 3AALA 1ZENA 3NQ8A 4CD5A 3GXMA 1BWKA 2VC5A 5KTLA 3C5QA 3LPFA 3BAIA 1A3WA 2J9XA 8XIMA 3R4IA 3VMOA 4NAEB 5DBUA 1XDLA 3H6OA 1S5WA 1K7EA 3QKZA 3M0MA 3TOPA 2I14A 2GJNA 3HF3A 3TMLA 1W5MA 4O1BA 3M4HA 1P1MA 3R12A 3QY6A 3EMQA 4RZ4A 3FS2A 3H7VA 3MYPA 8XIAA 2G3NA 1OFQA 3TW9A 2HZGA 4RNJA 4C6LA 4PUKA 1EFZA 5HNUA 1R8LA 2WNQA 3HG3A 4UR9A 3SI9A 4V15A 1TJ0A 2RDXA 4OBRA 3F2BA 1JIBA 2EF9A 3LCWA 1TMHA 1DIOA 2B7OA 3MCNA 3RM8A 1P7TB 3WH7A 1DIKA 1LLZA 1FWRA 3KBWA 1AQ0A 2ACQA 3SRDA 5FD0A 1ONEA 3W70A 2EEXA 3QQ1A 5CGTA 3SGZA 3W7NA 2XN0A 5HULA 1EJUC 5KZEA 3NQBA 1OGGA 4J3UA 3SQLA 1MDRA 3PULA 5FF2A 3W2JA 3VCCA 4PUMA 4Z2GA 3KUMA 5CJ5A 4AHOA 1PZ0A 2VZUA 4XIMA 4CNTA 4OJYA 2P10A 5FJRA 1UIPA 1CDGA 1L6SA 4NILA 1PIGA 1N2VA 4Y9MA 3U2CA 3WD4A 4PUNA 3LTYA 3VIIA 5A8PA 3VD3A 3ZJ8A 3ISIX 3TSDA 4I9MA 4G56A 5E5CA 1UJQA 1JI2A 4XK2A 3A9IA 2QPSA 3GNDA 2WMIA 5BOFA 4IIBA 5HBFA 4FMVA 5G5IA 2Z2AA 1UWQA 3TU9A 1Z32X 1OG6A 3CIWA 4BF5A 4UTLA 3GG1A 1OY0A 4L61A 5IHRA 2X1TA 1JQXA 3DENA 1NJJA 2YDAA 3I4KA 1VCFA 1V5XA 5GVJA 4TR9A 1IGWA 1MI3A 1R3QA 2QCDA 3AICA 4NZFA 3FA4A 4N4QA 4Q8TA 4UOJA 2ATSA 4XBJA 1SUXA 4GIEA 4UZUA 2V63A 5DEZA 2W27A 1VEPA 3SN4A 1DJNA 5EU9A 3WK2A 5F2GA 1TPEA 1N8FA 1GVFA 3P5YA 1PTDA 5EMLA 3N19B 1XRVA 1M68A 1XYZA 1BSIA 3GNRA 4GIAA 3BICA 3NL5A 4NJKA 2B7NA 4TX6A 2QGYA 4FNTA 2A3EA 5D09A 4ZSTA 5C9ZA 4AZHA 1RAKA 3GH7A 4LF1A 5DMMA 3P81A 1Z6KA 4HHPA 2UY2A 4AEOA 1E9LA 3S6OA 4XO6A 1JCJA 3FDKA 1QW7A 4Q33A 5FL1A 4PBGA 1CGUA 1TPH1 3KVKA 2EPOA 3RLUA 1UROA 1GPFA 1VCGA 3VGDA 2CBVA 2PA6A 4S1FA 2OX4A