3G2BA

Crystal structure of pqqd from xanthomonas campestris
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
b'TISRDSCPALRAGVRLQHDRARDQWVLLAPERVVELDDIALVVAQRYDGTQSLAQIAQTLAAEFDADASEIETDVIELTTTLHQKRLLRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein D
publication title Xanthomonas campestris PqqD in the pyrroloquinoline quinone biosynthesis operon adopts a novel saddle-like fold that possibly serves as a PQQ carrier
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Biosynthetic protein
total genus 21
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05402 PqqD Coenzyme PQQ synthesis protein D (PqqD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3g2bA00
3G2BA
chains in the Genus database with same CATH superfamily
1MBFA 2EFOA 1RNLA 1X1DA 4RGSA 4RDUA 2YPRA 1IDZA 2WA0A 2DTZA 2F4IA 5C44J 4PUSA 5LHHA 3ML6A 3LMMA 1KU9A 2QBYB 3RKWA 1W1WE 3OY9A 2DT7B 2GIVA 2O03A 1U5TC 3OWTA 5TISC 4BQNA 2F5DA 3TGNA 5FKMA 2GZWA 2ZMEC 2OTLI 2GM4A 3H35A 3OSFA 5TJJA 3CCUI 2KIQA 2MABA 4IJAA 5HS8A 4ZZDA 1W7PD 4CH7A 4XK4A 1X1AA 2X1EA 2VJIA 3SDBA 1FSHA 2VC0A 2L0KA 2B9SA 3BG3A 1D5YA 2K02A 3LFKA 1LUJB 4IZZA 3GZNB 2VI6A 2K4BA 2W85A 1BW5A 2L9RA 5F0FA 2FRHA 5IYCJ 4UUTA 1UHWA 2VKHA 4S05A 1LDDA 1MMGA 4E7IA 4XICA 1YJNI 2V9PA 4V2FA 2I10A 4PGGA 3AAFA 1BR4A 3PQKA 2NVXJ 1D0ZA 1HDPA 1Z7UA 5CVIA 3F6OA 1SFXA 5M3FJ 2YU9J 1OMIA 1RKTA 2EZLA 3FHZA 2LOOA 3DP7A 1F9NA 2LP0A 3SFIA 1LB2A 5FD5A 4N9HA 2DMTA 5DM6F 1S5LC 1SFEA 2VE9A 1E3PA 1WCMJ 2MA3A 2PEXA 2V1UA 3L2QA 1BR2A 3ZGKA 3EPZA 3OSGA 1V4RA 1APLC 4OOIA 2WWYA 4XLNF 2LKPA 2VL8A 3CJTB 3W3CA 2G7HA 4P1WA 4KN7X 4OMZA 3IKVA 4C3IJ 3MMYB 1YIOA 4FISA 1H88C 3S16J 3MCZA 1FIPA 2VQGA 4G12A 1R5GA 1MNDA 2P7VB 2QZ8A 3OOPA 1JUMA 1LNWA 2L4MA 3GO5A 5LEJA 2WAFA 2F5CA 4QSHA 2IS6A 1G3WA 4GRIA 4AUXA 2X48A 4LIVA 3WTUC 3CF5F 4JX4A 3WTSC 1VNDA 1WSUA 2LDUA 1AKHB 4MNUA 3W6VA 2D2WA 3U9GA 2PMHA 5E3NA 1G2HA 1I50J 2MW8A 5CVVA 3ZMTA 1WJEA 5FROA 5EZGA 2OCEA 3ZMDA 2DPUA 4V19K 3RIRA 4DZPA 1LPQA 1ZLJA 1I27A 2Y2ZA 5J4YA 1R23A 2DOFA 2BHYA 1R22A 1P92A 2JK3A 1P4XA 3FZVA 2E1MC 3RKYA 1OQYA 4D7MA 3GCMA 4F7ZA 3QRFF 2O6GE 3B73A 1QVTA 3HSFA 1K6YA 3L1PA 4I7HA 2CRGA 1YG2A 4MTDA 4ZYEA 1E3OC 1AHDP 3C3WA 4M72A 4IXAA 3RJPA 3LAPA 3FKIJ 5D8KB 2PLYA 4C9YA 1JHFA 4CUGA 5E3MA 1TQPA 3A0BC 3SYTA 2Z5UA 3HRUA 9ANTA 4KMUX 3D5RC 2CWEA 2VQCA 2H1KA 3TKYA 1Z3YA 5L3BA 2IPQX 3DEUA 1R6RA 4IHSA 1XMKA 3H9GA 3FISA 4RB0A 1CF7B 4U87A 3S2WA 1MNEA 4HDVA 4P9UA 1BA5A 3GLXA 3BLYA 4E4HA 3JSOA 2BGCA 3FK6A 4UHTA 4NC6A 2RREA 2KLOA 5F27A 5KAFC 2KZVA 4N4NB 4FETA 2XGDA 1Q1VA 5EEHA 3WG9A 2L7MP 1CGPA 4S0HB 2OAZA 1UG2A 1I5ZA 1MIJA 3FXUA 2GXGA 2OJED 1SAUA 3CCVI 4BJ6C 2V9KA 2ZXJA 3H3ZA 1IC8A 1N78A 2ZBKA 2ZNZA 2OD5A 3S17J 3FX3A 5LLQA 1SAXA 2QUFA 3AL0C 4H4KC 4HSTA 3PO3J 2XAFA 4UB8C 2K9MA 4HA8A 4XIDA 2FOKA 1VQ6I 2DMPA 1LDJA 1TT5B 2XIGA 4M74A 4A0YA 5ICEA 5DEQA 1YQAA 2MD0A 4FE7A 4XRFA 3MKWB 3U1DA 2FUG2 4UUVA 2ZKZA 2QSHX 1ZK8A 1XN7A 1DGRM 2D5VA 2QGUA 3K2ZA 4Q47A 1W36D 5EF6A 1FP1D 4XORA 1B4AA 1I3QJ 1Z91A 4G94A 4A12A 5JVTA 2RDPA 2VPLA 3DU5A 5LRSA 2K40A 3OR1C 1TNSA 2DA3A 3PUBA 3RPUD 2HGCA 4L5IA 1EV7A 1A6QA 3OIOA 5J1YA 3VWBA 4HQMA 3LA7A 2NS0A 4LJZF 2DA5A 4GFBA 3W2AA 4A6DA 1GHCA 2KHMA 1KGSA 4IQ4A 2WTEA 3TMOA 5DUIA 1D1BA 5ERIA 3H5AA 4CCOA 1T98A 4L0YB 1BIAA 3HZJA 3GFLA 4LD5A 3E5XA 3PFIA 1LEAA 2ICWG 4N4OB 4WWCA 1AKHA 5EG0B 2ZJ2A 2FNAA 1B1BA 2O9LA 3SHFA 3OV8A 4ANJA 1RR8C 1ZRDA 2VE8A 1FBQA 4YIFA 4LLGF 3HGYA 4L9JA 1H0MA 5D8LB 2L7KA 4IHYA 1JKRC 4XKVA 4EM0B 3G2BA 3U21A 4XBFA 1S72I 2CV2A 4LB6B 2H8WA 1GXPA 2HZTA 2K3PA 1K78B 3EETA 3T8RA 3TOAA 2AHQA 1YYVA 2H8RA 1EKEA 4RLFA 4NHJA 3FIWA 2UXNA 2X6OA 4RAGA 1V3FA 3LSKA 5E1WA 5J40A 2LD5A 4ZZLA 4KIBA 4A5MA 3PNVA 2EBIA 3DEEA 3JSPA 1BN5A 2CH0A 4FASD 4P96A 1T33A 1ETKA 2X1CA 1ON1A 1QPIA 1S7AA 2H6CA 4ZDOA 1K83J 2XC7A 1P4WA 3HBLA 2XHKA 1NH3A 2EV6A 3DTEA 2CSOA 1UHSA 3CESA 3AFHA 4OIPF 2H1LA 1BI0A 2E5ZA 1PVEA 4CCJA 2H09A 2DJNA 1MBKA 3ASNH 3AG4H 1IF1A 2ZMEA 3CF2A 4BQAA 5BPIA 2E71A 3M9AA 4AU7A 2K7LA 2HKXA 2EA2A 1S6LA 3UNGC 3R4KA 4KITB 2HQRA 1XPXA 2EFWA 4RA2A 2VQLA 4KISA 3SQNA 2MG4A 2MLKA 4G6DA 2R5ZA 2CUFA 1MKMA 1V5EA 3E0JB 4HV6A 2D1VA 1B9NA 1WFXA 3BQZA 1KQ8A 3E6DA 1VI0A 2ZB9A 1SD6A 4XOTA 3I64A 1R5ID 3G1LA 2RAEA 3TP0A 2JUCA 1EJ9A 4ZJZA 3I58A 3S14J 2BY0A 3V8KA 2KJCA 3DXJF 1PUFA 5GP9A 1WH5A 2DTRA 3H0DA 1MBHA 3K0LA 3S3OA 1AU7A 3ZPLA 2M8GX 2E2IJ 1OKRA 2LTPA 1YITI 3CZ6A 1ZREA 3GW2A 3HUGB 4O5VA 2ZC2A 1R58A 2Y75A 1IUFA 1BJZA 4CZCA 2M8EA 2O3FA 3I0TA 4M9XA 1ZAOA 5CPRB 1RESA 1BBYA 3M07A 1LFPA 1MD0A 3M8JA 3BG6A 3K4JA 4CCLA 2QKMB 2R7UA 1OYYA 4R1HA 4RBOA 2QCOA 1XTAA 2KZGA 3H5RA 2PFBA 3C1DA 2ZSIB 3MQ0A 4AYBN 1OCPA 1TWHJ 3CQZJ 3BPXA 3BY6A 2VJJA 1OCOH 1ON2A 2P6TA 1IDYA 3F21A 5LGTA 1U8BA 2AQEA 3E3VA 4A3KJ 2K5CA 3VFZA 2FOWA 1BI2A 3CC7I 2HXOA 4BHBA 2E1CA 4IKFA 4XKWA 1G3SA 2CUZA 5J8CA 1KA8A 1MJ9A 3H9QA 2JMWA 3HRTA 4L9TA 3WGIA 3QPLA 2VXDA 3F0CA 4UV8A 4FQGA 1U2WA 2DFIA 2DLLA 2Z3YA 4IEJA 1SEUA 2JTVA 3VYTB 2LBFA 3B02A 2CQQA 3KP5A 2JPCA 2HQAA 3LOCA 1LDKB 2RN7A 2K86A 1X3UA 3OS2A 2MD5A 3AG1H 1O7LA 1GVDA 2HS5A 2YR2A 2W84A 1K6OA 2GQQA 2X9DA 1PJRA 2MFZA 3LSPA 3LFUA 2DOAA 4E7JA 4GO1A 2H94A 2BV6A 1VFCA 3T0YA 1JJ6C 3CP8A 3IV5A 4EMSA 2Z33A 4BJTA 3CUQB 3R60A 1JE8A 2XAQA 2CW8A 3K4CA 3ABUA 3ZN0A 1HCRA 4IF4A 1T38A 1K78A 5J1UA 2BY1A 1TC3C 3KPHA 3EYIA 2PJRA 1ULYA 4A3EJ 1FTZA 1SVLA 4WXHA 3KEOA 4YEJA 1VQLI 3OMYA 3E6CC 2VBZA 2Y0SA 4EGYA 4WF2A 2KIUA 3IUOA 3OIQA 2XASA 1USSA 3HKZN 2A68F 1RPWA 2DA6A 5K1YA 3M4OJ 5J3LA 4B47A 1D0XA 4BNCA 3Q0VA 2IW5A 2A3SA 1FLIA 4ZTFA 3BR1A 5DYMA 3SFZA 4AIDA 4I6ZA 1RI7A 1FYMA 4O3MA 3I56I 4NC8A 4RLQA 1XCBA 2AXTC 4I02A 2BHZA 1HDDC 4HNUA 3ERMA 1R1VA 1R7JA 2DQRA 3VYUB 4BHPA 2Z1DA 1QO0D 3S1MJ 1K61A 1RC9A 3GX4X 1TWGJ 3HOZJ 4DYQA 1B6AA 1L3LA 2UV1A 2JA7J 3LQQA 4N9IA 1IUYA 2DOEA 1WJAA 4YIIA 3ZRGA 2VIXA 2M2EA 2R0QC 4X6AJ 5FRMA 2QQ9A 2IAIA 2W24A 3PL8A 2X4HA 2Z99A 3WTXC 1IJWC 2WAQN 5BPDA 4DNCA 4ITVA 3I4MJ 1X2MA 2GOXB 2GAUA 3CCEI 4WCGA 1R9TJ 1X4OA 3H5NA 2NS7A 3V8LA 1MMDA 2XSJC 1OYIA 3CLOA 3CCJI 1TQMA 3I4PA 1WH7A 5D5WB 1RR7A 1JKOC 1R49A 1QNTA 2R7TA 2KDZA 1XMXA 3L2CA 2IRFG 1X58A 3IWZA 2D45A 4GYIA 2V6CA 5K7HA 3P5JA 4ASNA 3K4LA 5L3FA 2EWNA 3WTYC 3JTGA 1F43A 3T8TA 1ITYA 5D5UB 4RB2C 2UZKA 1DU0A 4M3FA 3E5UA 3IH2A 4IRIA 5M5XJ 3JRIA 1B9MA 3CJQB 3GZ5A 4CDGA 4G9YA 2F2EA 2NRAC 3H92A 3ESWB 3I53A 4B09A 2XSDC 2RV8A 1KZHA 4CXFA 1QHHD 3EUHC 2VC1A 4KIGA 3O8HA 2A6TA 5M5YJ 1A31A 3BTLA 1NK2P 5IP6A 4QLCU 2XV4S 1XDSA 3M8EA 5HVQC 3J81K 2E1OA 1P2FA 1RUOA 4EM2A 2IS2A 2LMDA 2ID3A 3JRDA 4V2GA 2BYVE 2CMPA 1KU7A 3R61A 1X4PA 3T1BA 1YIJI 4IRHA 1QZYA 2DCEA 3RDIA 3HOTA 4M3EA 4ZTJA 4IOCF 2HDWA 4A3DJ 2BE5F 4AM3A 4LGWA 4KYWA 5CKTA 3ABKH 4HEA2 3OYKA 3L2RA 4AIHA 4IHVA 2V79A 1BM9A 4RM2A 4DW6A 3HOWJ 2RNJA 2E2HJ 2UWMA 2F5VA 3OL3A 1BI1A 5FLXK 3TW6A 4L5EA 1FYLA 4UNOA 3CJRB 1LJ9A 2LF8A 1HKTA 4ESFA 2VPRA 1K4SA 1TW2A 2R7SA 3CMYA 3FWEA 1ZHFA 2FBKA 2MYSA 2KDOA 3C2BA 4M9SA 3JRFA 2F4MB 4I0BA 2IGNA 3PSFA 4U0VA 2EFQA 1P6RA 2QA4I 2X6YA 4XLPF 1A36A 3MWMA 4OINF 4BEHA 2RNGA 5CVJA 3VYRB 1D1AA 2W57A 2PBIA 3CCMI 1TL8A 2FJ1A 5CVRA 4OWRB 1RIOH 4A3BJ 2XDVA 2EIMH 1ZH5A 1E2XA 2P6SA 3H0GJ 2Y31A 3S93A 1GV5A 4Z2YA 3CMEI 2CW0F 1OPCA 2FBHA 3WU2C 1WGXA 3N97A 3PO2J 4KDPA 1XSVA 1QA6A 5GADJ 4F55A 1S7OA 2K9NA 3CTAA 1P7JA 4E6KG 1WJFA 1YHQI 5LHIA 3SZTA 3F8NA 1FBUA 2I8DA 5FD6A 2W7NA 3HOYJ 3JAMK 2M9HA 3TO6A 4CZZA 4MQVA 1IN5A 4MFDA 1S9HA 2O61A 2G0EA 3ZOBA 1JXSA 1T0FC 2X85A 2TCTA 3PIPF 4CCKA 3WGGA 4Y7NJ 5D6FA 2WAQA 1O3SA 2M87A 3S8PA 4JK1X 3S1NJ 1HW5A 3P9KA 1W0TA 5E17F 3FXKA 1MH3A 4LLNA 1GLNA 4BBRJ 3H3UA 1XCVA 2Q2EB 1JGGA 1YW7A 1BC8C 1S8NA 1N75A 2L7ZA 5GAGJ 3COAC 3ZR8X 3HXLA 4DJAA 3TOBA 4CICA 4EGZA 3ZQ7A 2VT2A 2VODA 2GBYA 1YFHA 4UVAA 4BXFA 1ZQ3P 2AS5F 1TZLA 2KPMA 1L0OC 5E8IA 5JVGF 4ENMA 1U9OA 2Z2SB 4Y17A 4ABZA 4CA0A 4BUPA 3REOA 1FZPB 3Q5FA 3CMMA 2HNHA 3WU0A 1X3ZB 2P0WA 2QF7A 4L9NA 2CGPA 2E2JJ 1R36A 3BWGA 4EJWA 2GOMA 2Q0OA 1K4TA 5E1ZB 1O57A 2LG4A 2QSGX 3DBLB 3IH3A 3LSIA 1YI2I 3RPQA 2VKDA 4HF0A 4XONA 3KIOA 1U3EM 3WE2A 4BXUA 2RQQA 1VQOI 3E7LA 2R7XA 4MLOA 1LFUP 1K79A 4M3BA 2A6EF 1YS6A 1JTYA 1MMAA 3A02A 3ULQB 4Z6YA 3VDXA 4CCNA 1IRGA 3GBGA 1TNTA 4EM1A 2ELJA 2RC4A 4J00A 2HDCA 5J6XA 2OQRA 1W5SA 1YTYA 3L2VA 5IYDJ 4H0EA 4MFEA 5DS9A 1ZARA 1JHHA 1MMNA 4I99C 3KYLA 1G6NA 4S04A 2KP6A 2NAZA 2M34A 2HZDA 2DN0A 1T56A 3IP4B 4GYGA 2Q8KA 3Q9VA 2XF7A 2NVTJ 4XN3A 4RM3A 2GLOA 5L3GA 1YJWI 4HF2A 2JSPA 3I4NJ 2DQLA 5F6FA 3KX2A 5CQEA 3KYDB 1ONVA 5JHUA 5E8GA 1GXQA 2HYGD 3BCAA 3BZCA 3IKTA 1VQPI 2MGQA 3BR5A 3ZCOA 4OIOF 2KT0A 2ACJA 2PMZA 2F5EA 4XM3A 1BI3A 2L3DA 5F04A 4JOMA 2X6XA 1XX5A 2VT3A 4OIRF 5EGOB 3IHUA 3QPSA 1OFCX 1Q1HA 2ZMEB 3EDPA 2LFBA 5JR3A 1Y6IA 2R92J 1FOKA 4BS9A 3I55I 3CCRI 1IAWA 4Y52J 3CP2A 2FU4A 3BOQA 2XGXA 4YRVA 2UUZA 2JQ7A 2R5ZB 2O7OA 4K2EA 2XUBA 3NWTA 2HVSA 3A03A 3OYGA 3ECOA 5GPAA 2K9QA 1DPUA 1ODDA 2IJLA 4XLFA 1J59A 2LY9A 5FJ8J 2F5FA 1V55H 4IVNA 2EIJH 2X51A 1ETXA 3EYYA 1FOWA 2DFEA 3TDZC 5EYRA 5ICGA 1PUFB 3I3LA 4UV9A 4IHWA 4BBSJ 2HTSA 3PJRA 1DPRA 2EZKA 3FXQA 4M3GA 2K9SA 2CQXA 2DU9A 2LRDA 5DCMB 2F48A 5E18F 3EUKL 3GF2A 2EFPA 3V8JA 1F36A 1SANA 2XGCA 2KKOA 3OYNA 2Q2EA 3RZOJ 3CDLA 3EQLF 1JUSA 1DUXC 1ZG1A 3H3VK 5F1RA 2LKSA 3BTCA 2CQKA 3JCUC 4KIFA 5IOYA 3R0JA 1O7FA 2M5WA 4II2A 4B44A 2B63J 2IA1A 2Y0MA 2VOPA 4L18B 3HYIA 4M9ZA 1R4NB 4JBAA 1X1BA 1MBEA 3L09A 1K7AA 2PJPA 2E1NA 2FQ4A 1X2NA 2ESHA 4B48A 1W0UA 5F0CA 1VF9A 2VBYA 1I6XA 5ILSA 1NTCA 4A5NA 3EUHA 4RGXA 2IEKA 5TRDA 1QVUA 1ETYA 3OIPA 3IWFA 4WXDA 2LBFB 4ZC3A 2YS9A 3I54A 2HEOA 1ETWA 2DA4A 2VJ5A 3WTVC 1OCTC 2CQ7A 1WZ2A 1TWAJ 1D8KA 4A3LJ 2XRNA 1HXDA 1DGWY 3HM5A 4WK8F 4A0XA 2ZSHB 2XAJA 3HOXJ 2JVGA 4MGRA 2Y9YA 2KISA 3BT9A 4PFOA 1O3RA 3GTOJ 1G3YA 2XAGA 5HS9A 5EJCA 2V7FA 1AWCA 2E7XA 2EILH 4C3HJ 3IRQA 3K70D 2E1MB 1UHMA 3FXJA 4B3AA 2LC2A 3VOEA 4I01A 5IPAA 3MFKA 1QZZA 1YW9A 2GA1A 3FMSA 4J19A 1J5YA 1B8IA 5EEGA 4P5OA 1JT6A 2JA5J 1I1SA 1ZGWA 2XF5A 5E20A 2LSOA 2CFXA 2UXXA 3OYHA 3M8FA 2GXAA 5DV5A 2PJRB 2ISYA 4ETSA 2F6CA 4AVZA 1S29A 1T08B 5J47A 3NRVA 4XLHA 1PYVA 4XKCA 4DYRA 4YIRX 3WTZA 4ZH4F 2ZXIA 2RGVA 5LRRA 2ELHA 2L4AA 4FT8A 1XC5A 5FLXZ 3K2AA 3PFYA 5EZHA 3S32A 1X1CA 3ONQA 2R5YB 2EZIA 3FM5A 1C0WA 4ESBA 2Y0SN 3SDGA 2EPFA 2NOGA 2DODA 3RI4A 2I5UA 3CUQC 3K6GA 4HX4A 2B7EA 4JX5A 2A6HF 2STTA 1OISA 5KAIC 1KQ9A 3E6MA 4IQJA 4UY8I 2V1XA 1I6HJ 3MKYB 4TV7A 1U5TA 3K4MA 4F92B 1WJ5A 4ZYAA 5EGOA 4BE0A 3KYCB 3KZZA 4LK0F 4M6XA 4BU2A 1SVMA 3OYLA 1FBSA 1FY7A 3PIOF 2OZ6A 2VN2A 2NVUB 2QQAA 3CCSI 4J01A 3ZMVA 4BH9A 4ZYGA 2QYOA 5E79C 4FE4A 3VSLA 1FOYA 2IGKA 4A6EA 5HOOA 1HC8A 1KU2A 5J8FA 3OYJA 3DCFA 3L7WA 2M4GA 1YX5A 4Y13A 3AL0B 1R00A 3P9CA 1ZELA 1HOMA 2IGOA 4D9JA 2EZHA 5KK1A 4YFNF 4UUSA 1W4MA 4U0YA 5H20A 1W36C 1MH4A 4FX4A 4ZYDA 4BE1A 2PI0A 3G73A 4A0ZA 2VXZA 1J0RA 4HV5A 1UELB 1GV2A 2YU3A 5DCMA 3GTMJ 1IW7F 3QYFA 5IP7J 2W00A 5IY5H 1EA3A 1FJLA 3LWFA 5EDNA 2WY8Q 1Z1DA 3RCOA 5M5WJ 3MN2A 3B6AA 2QWWA 1UG0A 5F64A 2ELKA 1SVOA 2J5OA 1XS9A 3H36A 3MEXA 2IA0A 3WHBA 4XLCA 2JRTA 3QOPA 2EJRA 5L3CA 3KZYA 3HSRA 4EV0A 2YUSA 1I1GA 3FXRA 4NQWA 3QP6A 5HLGA 1H9TA 2OUMA 2ZFWA 3ISPA 2FQ3A 3KEYA 4OAYA 3RKQA 1A5JA 2R7QA 4IRGA 4UVBA 2HR3A 3HC7A 1ZG3A 4BAYA 3OYAA 2X6WA 5CVUA 2AO9A 3HDDA 1TBXA 3DKXA 3FF5A 3CUOA 1NHAA 1MSEC 3JRHA 4LG0A 1J09A 3K70C 3C2GA 1VTNC 2HTJA 1EH8A 2FBIA 3HSEA 4C3JJ 1FT9A 3EUAA 4ZDLA 1QGPA 1Y8QB 3IH4A 2ZJQF 3D5LA 2WB1A 3GMEA 1ZTRA 2L54A 1IGNA 4D5FA 1LVKA 4AIKA 3DPLC 3PNTA 4MEYF 3K1NA 1MJAA 1QBJA 2JUGA 1LKXA 2QQBA 1UZCA 3QYEA 3OYEA 2IP2A 3GFJA 5K7ZA 1OR7C 1WI3A 4QTRA 2DK8A 1IXCA 3S2DJ 2HYFA 2EFNA 2A05A 1TWFJ 2LF7A 2XB0X 3WTWC 3OOUA 3MKZA 3HTSB 4B43A 3GFMA 4XLEA 4G7HF 1WI9A 1CQTA 3GFIA 1SFKA 2W82A 2DFHA 2OU2A 2R7DA 3PNYA 3JW4A 4BEHB 2WY7Q 4IPAA 1N25A 4PZJA 3J7YJ 3LSJA 2HVQA 1ETQA 2R5YA 2R93J 4E7KA 2K4JA 3FXLA 3HHGA 3CC2I 3P9IA 2Y69H 4ESJA 2KJBA 3HJEA 3OL4A 5TGTA 1W7PA 3WODF 1Z0XA 5ILVA 4BDZA 2XPVA 3DPUA 3S2HJ 1MGTA 3F8MA 3GVAA 1R1UA 3S3MA 2K3FA 3J7AO 4P55A 1WVRA 2R7FA 3HOSA 4A3MJ 4PJ0C 3HTUA 5B66C 1KONA 5GTHC 2HWVA 4W97A 2VKVA 5ICCA 3GYHX 4BACA 3B6CA 4HQEA 3IRRA 2VASA 2Y9ZA 3K4KA 2HKOA 1HKSA 2CQNA 4DBQA 1VQ5I 4RMNA 3OYMA 5D5VB 3TL4X 4HX8A 2VJ4A 3GTPJ 4BHCA 2M0CA 1LVAA 4IOAF 3G4SI 2YX7A 5HLHA 4HLYA 4C30A 3JRAA 3BP8A 4YELA 1XMAA 5LBQA 5DM7F 4GDFA 5IT9K 3LA2A 5A2QK 2ISZA 4A3JJ 2E7WA 2LH9A 2V6EA 2EB7A 2V26A 3WTTC 1D0YA 1TT0A 2EV5A 1XGOA 2DDAA 4HYEA 1XSDA 3W2WA 1JUPA 3WU1B 2QEXI 2LK2A 1PP8F 1JKQC 5HDKA 1MZBA 4HG2A 3E97A 4KT5C 1HA8A 3HB9A 4C2UA 1GVJA 1P7IA 1FSEA 2PMUA 3Q3SA 5IOZA 4YFXF 4UVCA 3DV8A 3RZDJ 4BGDA 2CS3A 5B1AH 2C6YA 4LMYA 3CDHA 3FDYA 5CJ9A 4UB6C 3BC8A 1RZ4A 5IYBJ 2P8TA 1QRYA 1FMWA 2A69F 2ZXHA 2DYRH 2IXSA 4AD9A 4Q4ZF 3BJOA 1YOVB 5FGMA 2AXLA 1JI8A 3DKWA 1DQUA 5K5RA 1TW3A 2ETHA 1YRNA 3RKXA 3CCQI 2VQHA 2IS1A 4LOCA 2XKPA 3MVPA 2XKOA 4KJZA 1U8RA 1USTA 3BZ6A 4F93B 2M7BA 2IA2A 3QP5A 2L9NA 3VODA 2MH2A 1AOYA 2IVMA 4I09A 2Y48A 2HQNA 3F23A 2K27A 4Y33A 3V42A 1M1EB 4XNFA 4C2MJ 5GPCA 4PCQA 4NBQA 2F4OB 2N8GA 2BXYA 2NVYJ 3U1KA 2BW3B 3Q9SA 3KETA 3JR9A 2MBFA 3ABMH 1U78A 3O6BB 5KVRA 3UR3C 1HF0A 4L9VA 3RYRA 1H89C 3I5UA 3F72A 5BNGA 1WRJA 3HOUJ 2R7OA 5ED4A 1HLVA 2WV0A 2BBYA 3KP2A 2JA8J 1U9NA 1UFMA 2XPUA 3RSNA 1UCRA 2EQRA 1WJBA 4UXNA 3I9V2 4PFPA 1A35A 1VQKI 1SC7A 4KA4A 3KP4A 4LK1F 2IS4A 1T95A 2GA2A 1MDMA 5IP9J 3TP3A 1IO2A 2E36A 1S7EA 1Y1WJ 4Q5SF 1WQ2A 3BR6A 3DWLE 3QPHA 3MD2A 1OJLA 3DTIA 2R7WA 1ZRCA 3BPVA 2PMZN 5M3MJ 5H6RA 3CD6I 3TBIA 1QZEA 2O0YA 1P9QC 1W5CC 5B3SH 3DEWA 4XQFA 3VSKA 2R7ZJ 1R1TA 2V1DA 2VKEA 1LE8A 1GDTA 1PP7U 1N77A 3LQRA 3ZMZA 3FBIB 3MAJA 4NUBA 4LLLA 5JLXA 1YLFA 3BJAA 2JA6J 1FP2A 3VEPA 4B4CA 1Y1VJ 1HQCA 3J7AY 1VQ8I 1UJ8A 3ZXSA 2KIFA 2NXNB 3I59A 2DBBA 2DJIA 1FYKA 4CCMA 2Y30A 4E7ZA 3HGGA 1SMYF 3BROA 1Y0NA 5L3DA 3QU6A 3JRBA 4HF1A 1DU6A 2BY3A 3CCYA 2CW7A 2R3SA 2ZXWH 2GXBA 5GAHJ 3HRSA 4DBRA 1ZR4A 1J2XA 5DUKA 2DXIA 2WADA 1NK3P 2ZFUA 3ZQQA 5K5QA 2FA5A 5J1RA 3RPUA 2OV7A 4G6QA 1G59A 2MLGA 1JKPC 3ASOH 2DDBA 1XGSA 5AIPA 3K9TA 3P7NA 3W2VA 2A5YB 3TEDA 2DT5A 4IHTA 4EJUA 4A3GJ 2EINH 4HRIA 4WX9A 2BZTA 3WE3A 5LHGA 3GZ6A 3H1CA 4HNTA 2A5WA 4XR6A 4M3DA 3A4CA 1IXRC 3OYFA 1OCRH 5BQTA 2KFDA 3KP3A 3HG9A 5F08A 3RTRA 4F3QA 2NNYA 1VQMI 2XRLA 2XF6A 4W1UA 4ZDPA 3VB2A 1OCZH 2CO5A 1TLHB 4HLXA 4LFUA 2MH9A 4AWXB 4EEFG 3LSTA 3NWSA 4ENKA 4LB5A 5FRNA 5FLVA 2IT0A 3TDUC 1JT0A 1KQ0A 3FMRA 2QVOA 2RKHA 4QPOA 3OS1A 3Q0WA 4NB5A 5HLIA 1FWZA 4G8XA 4KN4X 1TQIA 2XAHA 3F8FA 1GUUA 1KYZA 4PJNA 3K7AJ 3GWZA 2R4GA 1MW7A 2LY2A 4YFKF 2DK5A 4DZJA 4IO9F 5C3EJ 1ZYRF 1Z77A 2O8XA 4E70A 2BW3A 5E3OA 1U0JA 2MSYA 5FFXA 4LG3A 4X0GA 2J5PA 4OAZA 2AQFA 3LL7A 1B8IB 1J9IA 3HPHA 2FE3A 2FXAA 3E5QA 3OR2C 4GGGA 1O4XA 2STWA 3CDIA 2OF7A 3LSHA 2M45A 4ENJA 3HRMA 1D5VA 1QHGA 4G6TB 4B8XA 2HDDA 4RGUA 1OR7A 3BR0A 2VLAA 2E34A 1D3YA 3O2PE 3J80K 2BY2A 2JN6A 3BG9A 3O8GA 4FX0A 4X1EA 5HODA 4YG2F 1R5HA 3F8BA 3LNQA 3A01A 5K5OA 2DA1A 1ZN2A 2ECCA 3FBNB 4F91B 3FM3A 3V7RA 4PK4A 3F3XA 4CYCA 4XSXF 1MMSA 1NG7A 5E1XA 1ERDA 2LY1A 2EV0A 2DA7A 5CLSA 2P5LC 2E35A 4EJTA 3M3YJ 4GCVA 2CV0A 2V4JC 2OTJI 3G1MA 1BJAA 2GWRA 1ZKGA 1QU3A 1BIBA 4PSWA 1YO5C 3W6JB 2LR8A 4FHTA 3WHCA 1Z67A 3V7CA 4ON0A 1X3WB 1U5TB 1RKWA 2OZUA 2A07F 2CG4A 2EA4A 4XL9A 1MNMC 3QOEA 4RS8A 1VZ0A 3HIFA 2G9WA 2HPIA 3BR3A 3R6SA 3K1PA 2FEZA 2DAOA 4HBLA 1XGNA 2HQ5A 5JHFA 2OPTA 2GIZA 1Z9CA 2Z9OA 4PJMA 2M30A 3KP7A 4D7NA 2G7UA 3GTQJ 3L2WA 4Y3OA 2JA2A 6PAXA 3L00A 3QAHA 1SFOJ 1DP7P 3GTLJ 2P5VA 4BQOA 2DYSH 4UUSB 4BDYA 3D5SC 2L2OA 5HS7A 1QQIA 2QBYA 4DOZA 4LITA 5JFRA 2JRMA 2B0LA 2QQ8A 4PJLA 3GTJJ 5IT9Z 3M1CA 5BMZA 2LNBA 1A6IA 2FMLA 4MIMA 3ROUA 5A2QZ 1IV8A 3E1SA 2DA2A 1WJCA 2DI3A 3KLNA 2XGEA 1G3TA 3OYDA 2DO7A 2BVMA 1IN7A 3E6BA 3FMQA 1FNNA 3L2UA 2Q1ZB 2NVQJ 1YE9A 3ELKA 5H2FC 1OCCH 2CJJA 2ZNYA 5DD8A 5J4VA 1SMTA 4XRMA 2E5NA 2CV1A 2KQRA 3H9JA 2ZJRF 5B1BH 5FFZA 4MHGA 4D1QA 5ICFA 1YW8A 4NQWB 2M7AA 3U2RA 3BTIA 3M1EA 4AVPA 3ZMUA 3NQOA 5CYVA 1XG1A 5F0HA 5KCMA 3TW7A 3K10A 4C2TA 2DW4A 2QM3A 3GXOA 1RETA 3MZYA 3QU3A 4FTHA 1H9GA 2DT6A 2X1DA 1BR1A 2A61A 4XKBA 1XD7A 2R7RA 4LG0B 2RQPA 3KZIC 1T6SA 5FO5A 2ECBA 1YS7A 1Y39A 1FX7A 2LKXA 5LEKA 4I0AA 2DPDA 1W5TA 2YSRA 3LA3A 3SXYA 3A2KA 1HSJA 1X19A 1R4MB 3CMAI 2E60A 2WB1N 3J81Z 3DTKA 1T39A 1VQ7I 3SEQA 2ZO4A 4JQFA 1BW6A 3BG5A 2OBPA 3KP6A 5ILUA 5HNHA 1JJ8C 4CO8A 2L7FP 5FKKA 3IAS2 1BOBA 1FC3A 2FX0A 4AIJA 2KRHA 2QLZA 1Z3XA 3WG7H 5HNFA 5DCFA 3AKZA 3S1QJ 4BXXJ 2P5KA 3K4BA 2JJ7A 4A69C 4PGHA 3K4NA 3FKJA 2QSFX 1MBGA 2NYXA 5DTDA 1DDNA 3FXMA 2ZCWA 3CC4I 2L01A 3RQIA 3BTJA 3ECHA 1J75A 3CO7C 2D1HA 4AC0A 5C4JJ 5LGUA 2CUJA 1IRXA 3F6VA 2JPBA 4E7LA 3T5XA 1RRJA 2EIKH 2WBMA 1R71A 1ZRFA 4IHXA 3GUDA 3ZQHA 2K9LA 3HL2A 1W7PB 3OYIA 5B5EC 3GTGJ 3BZKA 3ZMSA 3CCLI 3TO9A 2HU9A 1XSXA 5K7FA 2BVLA 2L5QA 5DDGA 3CJNA 1U6GA 1YJ9I 3GTKJ 1EH7A 2XAUA 4RAFA 3IC7A 4CHUA 2OC6A 2OCCH 2NOJB 1YX3A 4M71A 4D0PA 1S3JA 3OYBA 2M4KA 3DKYA 3JTHA 4PDKA 4B3XA 2P7CB 3PUFA 2HOSA 2PG4A 5L3EA 4BE2A 1H8AC 2OQGA 3D0SA 4JX6A 4A2UA 3V7SA 4BKXA 2XROA 1O3QA 5FB2A 1FOXA 1B59A 2V9VA 1IV6A 1T0FA 2WV1A 3BCBA 1T2KA 4BYYA 1E0EA 4EJVA 1CF7A 5AIQA 1X1PA 3C7JA 3SEZA 1SFUA 2JZYA 2CUEA 3F8CA 3JAMZ 1Z6TA 1HBXG 3TO7A 4E7SA 1TP4A 3HEFA 4BJ5C 3JRCA 2LLKA 1WPKA 3KEQA 3S1RJ 4N0BA 1B72B 3KCCA 5LGNA 2JT1A 1ZG5A 5JLWA 1JGSA 2WAEA 4MEXF 1VQ9I 1BOAA 4KFCA 1PUEE 3JRGA 4RAYA 1KU3A 2DFFA 3ZP5A 4XMYA 2W4SA 2H6BA 3R0AA 1E3HA 4F52A 4HAMA 1MBJA 4DGWB 3Q0UA 1FIAA 1BL0A 3DLAA 2KL4A 2V1NA 4JP0A 2L9VA 4RB1A 3BDDA 3C2HA 3ZQLA 2KRFA 3K69A 3DF8A 1POGA 1IXSB 3IAM2 3QQAA 3ZQGA 4BL0B 3MZHA 3DBHB 1YRNB 2NS8A 4EATA 2COMA 2XPWA 2IGMA 1WWXA 4RGRA 3MKLA 1ZLKA 3PM1A 4MQ9F 2H27A 2JSCA 3F22A 1XGMA 2HYJA 4EJOA 4EQQA 3G3ZA 3PSIA 4M6VA 5JI6A 4A3CJ 2BEOA 3BJ6A 3W6KB 1ZR2A 3HOVJ 2VB6A 2HI3A 4G7OF 4D5CA 4E7HA 2KMUA 2PN6A 4BY7J 4XLAA 5C4XJ 3G6EI 3KE2A 3NAUA 4HDUA 4A3FJ 4QWQA 4G7ZF 1Y56A 5FLMJ 2WC2A 3UKGA 2L9SA 1I39A 2M0MA 3ABLH 4OIQF 1P4AA 2K85A 4HW0A 2KRCA 3TQNA 3LAJA 2FD5A 3ZN1A 4PJJA 2W25A 1NG6A 4I98B 1A04A 1SD7A 5HDNA 2CFOA 3SJMA 2P4WA 3S15J 1Z7LA 4DYCA 4JYKA 3QYBA 4MTEA 2ADUA 2FSWA 3NARA 4HZFA 1G8XA 4BY1J 1UMQA 3RQ4A 3CO6C 1ZGAA 1HKQA 3GEZA 1MDMB 1BC7C 5EG0A 4GXOA 4RAZA 4HX7A 4Y4RA 2KIMA 3LSMA 5AONA 1D1CA 3QWLA 3DU6A 3J80Z 2DMNA 3MZ8A 2FMYA 3M7GA 1WKMA 1IRFA 5F1JA 3RYPA 4DIQA 1ACIA 1VQNI 4RB3C 3AG2H 2PX9A 2E19A 4M6YA 3ZQFA 3NEUA 2DMUA 1FEXA 4OU0A 5E3LA 1V54H 1ORKA 3J7ZI 3IL2A 1LE8B 2O5RA 5FKNA 1SD5A 3BQYA 3A0HC 2QKLB 1IG7A 3PQJA 2IBDA 2VBWA 4R8HA 1AA7A 3ZQIA 5HDGA 3A1YA 5DD4A 3ERED 3CLQA 4M73A 3SZGA 3I59B 4PSXA 4KNYA 5D6EA 2L02A 2HOAA 1SD4A 1HSTA 3ABTA 1LEBA 2LREA 2LVSA 4KUMA 1IRZA 2LYCA 1LQ1A 2OA4A 4HSRA 2XVCA 3DPTA 1Y8RB 1STZA 2HXIA 2XB5A 4XOPA 2BOLA 1HW1A 2COBA 1PDNC 3LSRA 4LIUA 2VBXA 4XRSA 3DFGA 4QPQA 4I2OA 2FNPA 1J7KA 4Q48A 3S3NA 5GTIC 4R79A 3D1NI 1IN8A 3SZPA 1DP3A 1T8IA 1MSFC 5D4RA 1B72A 2FF4A 4I76A 4MO7A 3K1MA 3FHNA 5EEAA 2TRTA 5KHDA 1I3AA 2VONA 2VOOA 5FKLA 4FCYA 4BQQA 4OMYA 2M3AA 1FMVA 4ENNA 4A3IJ 3O3KA 2QENA 3OYCA 1FPQA 3DQVC 4XRSG 1Z21A 2JVHA 3N05A 5KNLA 4EVIA 5D4SA 4XN0A 1V5FA 2YX4A 2Z16A 3BG7A 2PQ8A 4IX7A 5FKOA 1HW2A 1LFBA 3VPRA 2HPMA 2HOEA 4B1RA 1TWCJ 3HUGA 4NC7A 1E17A 4DQ2A 1ENHA 3G1OA 2W48A 4U88A 2ID6A 1EF4A 2M1BA 5HLTA 1KYWA 3G71I 1Y0UA 4O6JA 4AYBA 3N4MA 1ETOA 1XB4A 3FK7A 1WHUA 4QIWN 1UAAA 4II3A 4L0ZB 3HHHA 4CGZA 2HOTA 1IZ1A 2R7VA 3I71A 3V4GA 2HVRA 5GAEJ 2MC4A 3HPGA 4A93J 1WJDA 1F4KA 4NDLA 4HOBA 2W1OA 2VUMJ 3KFWX 4HPQA 5D5XB 5LFAA 1JTXA 4XSZF 3L9FA 2X0LA 1IN6A 4U7BA 3C18A 1RUNA 2MC3A 3QODA 4L5JA 4CSWA 3DBRB 4NNJA 1VQ4I 1G4DA 1TTYA 3QPTA 4HNVA 2ESNA 4U0WA 2NNNA 4CYDA 3A01B 5H6QA 1Z6RA 1V5GA 2EK5A 4CYCB 1F5TA 4ZYHA 2RVCA 2CU7A 2EH3A 3GLLA 1F1ZA 5BOXA 3AG3H 2ME6A 3DLLF 1IN4A 3WGHA 2O8KA 2P81A 1UB9A 3F9KA 3BR2A 1OLTA 2ZJPF 3CUQA 2CYYA 1D8JA 2JWTA 3JREA 4KMFA 1Z05A 1ZGJA 3VYSB 4IL6C 5LD2C 1ETVA 3ZQCA 1REPC 2HFHA 1O3TA 5BS6A 1XDUA 4KT6A 4KICA 3LSGA 3KLOA 2ME0A 4WXCA 4U7DA 3OS0A 1EH6A 1FTTA 1GT0C 1MJBA 2DMQA 3HKZA 1QPMA 4P9FA 2BXZA 3FXOA 1OYWA 5IT3A 2TDXA 4Y15A 3X2QH 5CQGA
chains in the Genus database with same CATH topology
3K4MA 5JHFA 1X1DA 4F92B 1WJ5A 4PJMA 4ZYAA 2WA0A 4BE0A 2F4IA 4BU2A 3OYLA 3L2WA 4Y3OA 4PUSA 4ZTFA 3LMMA 2JA2A 3OY9A 2DT7B 4J01A 3OWTA 4NC8A 4RLQA 4BQOA 4BQNA 3VSLA 2IGKA 5HOOA 4HNUA 4BDYA 3D5SC 2L2OA 3VYUB 3OYJA 2Z1DA 4DOZA 2M4GA 3H35A 1YX5A 3AL0B 4LITA 2MABA 1ZELA 2IGOA 4PJLA 4D9JA 2UV1A 3M1CA 4CH7A 1X1AA 3E1SA 2X1EA 2VJIA 3SDBA 1WJCA 1WJAA 1W36C 4BE1A 3ZRGA 2VIXA 3OYDA 2BVMA 5FRMA 3PL8A 4IZZA 2VXZA 4ITVA 2GOXB 1UELB 3L2UA 2Q1ZB 2VKHA 1YE9A 3QYFA 2W00A 1X4OA 1MMGA 3H5NA 4E7IA 1MMDA 1EA3A 2XSJC 2E5NA 2CV1A 2WY8Q 3RCOA 1BR4A 2KQRA 3H9JA 1D0ZA 1UG0A 2R7TA 4D1QA 4NQWB 2M7AA 4XLCA 2LOOA 5KCMA 3K4LA 3K10A 4C2TA 2OUMA 1BR2A 3ZGKA 3L2QA 2DT6A 3EPZA 2X1DA 3KEYA 4OAYA 1BR1A 2R7QA 2R7RA 4XKBA 3HC7A 3OYAA 2VL8A 2X6WA 3W3CA 3CJQB 4P1WA 3DKXA 3MMYB 2VQGA 1J09A 3K70C 1QHHD 3EUHC 3C2GA 1MNDA 2A6TA 3A2KA 1X19A 2E60A 3EUAA 2WAFA 5HVQC 4ZDLA 3DTKA 2IS6A 3D5LA 2WB1A 4GRIA 3SEQA 4JQFA 4LIVA 2IS2A 5HNHA 1LVKA 3DPLC 3PNTA 3IAS2 1BOBA 2CMPA 2KRHA 1X4PA 1Z3XA 2JUGA 5HNFA 1LKXA 3AKZA 2DCEA 3K4BA 3HOTA 3QYEA 3OYEA 1WJEA 3K4NA 4ZTJA 5FROA 3FKJA 2HDWA 1OR7C 5CKTA 4HEA2 3OYKA 3L2RA 4RM2A 2UWMA 2F5VA 3OOUA 3OL3A 2E1MC 2CUJA 1IRXA 3MKZA 3CJRB 4E7LA 4B43A 4XLEA 2WBMA 1SFKA 2W82A 1K6YA 3PNYA 4BEHB 2K9LA 2WY7Q 3HL2A 2R7SA 3OYIA 2MYSA 2KDOA 2HVQA 2HU9A 4E7KA 2IGNA 3PSFA 2BVLA 2L5QA 2X6YA 4BEHA 2RNGA 5TGTA 3OL4A 3VYRB 2XAUA 4C9YA 4CUGA 1D1AA 4BDZA 3DPUA 3SYTA 3S3MA 2OC6A 2NOJB 1YX3A 3D5RC 3HOSA 3OYBA 2M4KA 2VQCA 3DKYA 4OWRB 4B3XA 1Z3YA 1KONA 2XDVA 1R6RA 3H9GA 4BE2A 4U87A 1MNEA 3S93A 4BACA 2VASA 3K4KA 3BLYA 4DBQA 4E4HA 4RMNA 3OYMA 4F55A 2RREA 3TL4X 3BCBA 2VJ4A 2KLOA 1E0EA 4E6KG 1WJFA 2KZVA 4N4NB 4FETA 3SEZA 4C30A 2W7NA 2I8DA 4YELA 4E7SA 2LH9A 2V6EA 4BJ5C 2V26A 1S9HA 1D0YA 1TT0A 1T0FC 2X85A 1SAUA 3W2WA 4CCKA 4BJ6C 2V9KA 2WAEA 1N78A 2WAQA 4HG2A 1HA8A 4XMYA 3S8PA 2W4SA 4C2UA 3AL0C 4H4KC 4HSTA 4F52A 1GLNA 2K9MA 4DGWB 4BGDA 2CS3A 3DLAA 2Q2EB 2KL4A 2V1NA 3C2HA 1N75A 3FDYA 3ZR8X 3HXLA 3BC8A 2MD0A 3IAM2 4BL0B 4DJAA 3MKWB 2FUG2 4EATA 1FMWA 2IGMA 4BXFA 2ZXHA 1DGRM 2IXSA 1TZLA 2KPMA 1JI8A 1W36D 1DQUA 2Z2SB 4XORA 4CA0A 2IS1A 3PSIA 2VQHA 4BUPA 4KJZA 3CMMA 2VPLA 2HNHA 3DU5A 2VB6A 4F93B 2M7BA 2P0WA 4E7HA 2KMUA 2L9NA 3OR1C 4XLAA 3PUBA 2GOMA 3RPUD 2LG4A 1Y56A 3LSIA 3VWBA 2L9SA 2M0MA 2VKDA 4XONA 2KRCA 4Y33A 4PJJA 2RQQA 3V42A 1NG6A 4XNFA 3W2AA 2R7XA 4MLOA 2CFOA 2KHMA 4IQ4A 1Z7LA 3TMOA 2BW3B 1MMAA 1D1BA 3H5AA 3VDXA 4CCNA 4CCOA 3UR3C 3GBGA 3QYBA 2ELJA 4J00A 4N4OB 1G8XA 2R7OA 3RQ4A 4ANJA 1MMNA 3RSNA 3KYLA 1WJBA 2L7KA 3I9V2 2KP6A 4PFPA 4Y4RA 4XKVA 3LSMA 2HZDA 1D1CA 3G2BA 3DU6A 3U21A 3IP4B 2CV2A 2XF7A 2IS4A 1T95A 4XN3A 4RM3A 2K3PA 4DIQA 2JSPA 4RLFA 3KX2A 5CQEA 3LSKA 3DWLE 3MD2A 3DTIA 2R7WA 3BCAA 2O5RA 3PNVA 3DEEA 3ZCOA 2CH0A 4FASD 2QKLB 3TBIA 2PMZA 1AA7A 2X1CA 1P9QC 4XM3A 4JOMA 3A1YA 4ZDOA 4XQFA 3VSKA 2XC7A 2X6XA 1N77A 3DTEA 3CESA 3AFHA 3SZGA 4PSXA 2E5ZA 3FBIB 4NUBA 1Y6IA 4CCJA 4BS9A 2LREA 3CP2A 2LYCA 3J7AY 4YRVA 4HSRA 3ZXSA 3DPTA 2UUZA 3CF2A 2DJIA 4XOPA 4CCMA 4AU7A 2BOLA 3NWTA 2HVSA 3OYGA 4LIUA 3UNGC 4E7ZA 4KITB 4QPQA 2VQLA 4KISA 4XLFA 3S3NA 4R79A 2X51A 1V5EA 1DP3A 2CW7A 3E0JB 1WFXA 3I3LA 4DBRA 3FHNA 3PJRA 4XOTA 5KHDA 2WADA 2DXIA 4ZJZA 2ZFUA 3ZQQA 4BQQA 2M3AA 2OV7A 1G59A 2LRDA 1FMVA 3EUKL 3H0DA 3OYCA 3DQVC 3S3OA 3W2VA 1Z21A 2JVHA 3N05A 5KNLA 3OYNA 3CZ6A 3HUGB 4XN0A 1V5FA 4HRIA 2Z16A 3BG7A 4CZCA 4IX7A 4HNTA 2A5WA 2HPMA 5CPRB 4XR6A 1LFPA 3A4CA 3M8JA 3BG6A 3K4JA 4II2A 4B44A 4CCLA 2QKMB 3OYFA 2R7UA 4NC7A 3H5RA 3HG9A 3RTRA 2ZSIB 4F3QA 2XF6A 5HLTA 4ZDPA 1X1BA 4AYBA 2VJJA 4B48A 3NWSA 1UAAA 5FRNA 4II3A 2AQEA 2K5CA 4IKFA 4XKWA 2CUZA 4QPOA 2R7VA 3OS1A 3OIPA 3H9QA 2LBFB 2HVRA 4ZC3A 2MC4A 2VJ5A 2VXDA 3HPGA 1WJDA 4PJNA 2W1OA 2R4GA 1MW7A 2LY2A 4HPQA 5LFAA 3VYTB 2LBFA 1DGWY 2BW3A 4U7BA 2ZSHB 1U0JA 2HQAA 4X0GA 4LG3A 1LDKB 2JVGA 4OAZA 2AQFA 3LL7A 3QODA 3OS2A 4PFOA 3HPHA 4CSWA 3OR2C 4NNJA 2V7FA 3LSHA 3K70D 2E1MB 1PJRA 1QHGA 2MFZA 4G6TB 2LC2A 3LFUA 2DOAA 4E7JA 2VLAA 1V5GA 4P5OA 3CP8A 3L2VA 2XF5A 3OYHA 3FBNB 4BJTA 4F91B 2PJRB 2F6CA 4PK4A 2CW8A 3K4CA 4AVZA 1NG7A 1ERDA 4XLHA 1PYVA 2LY1A 4XKCA 2ZXIA 3F9KA 1OLTA 2PJRA 2CV0A 2V4JC 3VYSB 5LD2C 3PFYA 4YEJA 3S32A 1X1CA 3ONQA 3OMYA 1QU3A 4PSWA 4KT6A 3LSGA 2Y0SA 3IUOA 3OIQA 3OS0A 3K6GA 3HKZA 4XL9A 3QOEA 1VZ0A 2HPIA 4IQJA 4B47A 1D0XA 5CQGA 3MKYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2B A; 
#chains in the Genus database with same CATH topology
 1MBF A;  2EFO A;  1RNL A;  1X1D A;  4RGS A;  4RDU A;  2YPR A;  1IDZ A;  2WA0 A;  2DTZ A;  2F4I A;  5C44 J;  4PUS A;  5LHH A;  3ML6 A;  3LMM A;  1KU9 A;  2QBY B;  3RKW A;  1W1W E;  3OY9 A;  2DT7 B;  2GIV A;  2O03 A;  1U5T C;  3OWT A;  5TIS C;  4BQN A;  2F5D A;  3TGN A;  5FKM A;  2GZW A;  2ZME C;  2OTL I;  2GM4 A;  3H35 A;  3OSF A;  5TJJ A;  3CCU I;  2KIQ A;  2MAB A;  4IJA A;  5HS8 A;  4ZZD A;  1W7P D;  4CH7 A;  4XK4 A;  1X1A A;  2X1E A;  2VJI A;  3SDB A;  1FSH A;  2VC0 A;  2L0K A;  2B9S A;  3BG3 A;  1D5Y A;  2K02 A;  3LFK A;  1LUJ B;  4IZZ A;  3GZN B;  2VI6 A;  2K4B A;  2W85 A;  1BW5 A;  2L9R A;  5F0F A;  2FRH A;  5IYC J;  4UUT A;  1UHW A;  2VKH A;  4S05 A;  1LDD A;  1MMG A;  4E7I A;  4XIC A;  1YJN I;  2V9P A;  4V2F A;  2I10 A;  4PGG A;  3AAF A;  1BR4 A;  3PQK A;  2NVX J;  1D0Z A;  1HDP A;  1Z7U A;  5CVI A;  3F6O A;  1SFX A;  5M3F J;  2YU9 J;  1OMI A;  1RKT A;  2EZL A;  3FHZ A;  2LOO A;  3DP7 A;  1F9N A;  2LP0 A;  3SFI A;  1LB2 A;  5FD5 A;  4N9H A;  2DMT A;  5DM6 F;  1S5L C;  1SFE A;  2VE9 A;  1E3P A;  1WCM J;  2MA3 A;  2PEX A;  2V1U A;  3L2Q A;  1BR2 A;  3ZGK A;  3EPZ A;  3OSG A;  1V4R A;  1APL C;  4OOI A;  2WWY A;  4XLN F;  2LKP A;  2VL8 A;  3CJT B;  3W3C A;  2G7H A;  4P1W A;  4KN7 X;  4OMZ A;  3IKV A;  4C3I J;  3MMY B;  1YIO A;  4FIS A;  1H88 C;  3S16 J;  3MCZ A;  1FIP A;  2VQG A;  4G12 A;  1R5G A;  1MND A;  2P7V B;  2QZ8 A;  3OOP A;  1JUM A;  1LNW A;  2L4M A;  3GO5 A;  5LEJ A;  2WAF A;  2F5C A;  4QSH A;  2IS6 A;  1G3W A;  4GRI A;  4AUX A;  2X48 A;  4LIV A;  3WTU C;  3CF5 F;  4JX4 A;  3WTS C;  1VND A;  1WSU A;  2LDU A;  1AKH B;  4MNU A;  3W6V A;  2D2W A;  3U9G A;  2PMH A;  5E3N A;  1G2H A;  1I50 J;  2MW8 A;  5CVV A;  3ZMT A;  1WJE A;  5FRO A;  5EZG A;  2OCE A;  3ZMD A;  2DPU A;  4V19 K;  3RIR A;  4DZP A;  1LPQ A;  1ZLJ A;  1I27 A;  2Y2Z A;  5J4Y A;  1R23 A;  2DOF A;  2BHY A;  1R22 A;  1P92 A;  2JK3 A;  1P4X A;  3FZV A;  2E1M C;  3RKY A;  1OQY A;  4D7M A;  3GCM A;  4F7Z A;  3QRF F;  2O6G E;  3B73 A;  1QVT A;  3HSF A;  1K6Y A;  3L1P A;  4I7H A;  2CRG A;  1YG2 A;  4MTD A;  4ZYE A;  1E3O C;  1AHD P;  3C3W A;  4M72 A;  4IXA A;  3RJP A;  3LAP A;  3FKI J;  5D8K B;  2PLY A;  4C9Y A;  1JHF A;  4CUG A;  5E3M A;  1TQP A;  3A0B C;  3SYT A;  2Z5U A;  3HRU A;  9ANT A;  4KMU X;  3D5R C;  2CWE A;  2VQC A;  2H1K A;  3TKY A;  1Z3Y A;  5L3B A;  2IPQ X;  3DEU A;  1R6R A;  4IHS A;  1XMK A;  3H9G A;  3FIS A;  4RB0 A;  1CF7 B;  4U87 A;  3S2W A;  1MNE A;  4HDV A;  4P9U A;  1BA5 A;  3GLX A;  3BLY A;  4E4H A;  3JSO A;  2BGC A;  3FK6 A;  4UHT A;  4NC6 A;  2RRE A;  2KLO A;  5F27 A;  5KAF C;  2KZV A;  4N4N B;  4FET A;  2XGD A;  1Q1V A;  5EEH A;  3WG9 A;  2L7M P;  1CGP A;  4S0H B;  2OAZ A;  1UG2 A;  1I5Z A;  1MIJ A;  3FXU A;  2GXG A;  2OJE D;  1SAU A;  3CCV I;  4BJ6 C;  2V9K A;  2ZXJ A;  3H3Z A;  1IC8 A;  1N78 A;  2ZBK A;  2ZNZ A;  2OD5 A;  3S17 J;  3FX3 A;  5LLQ A;  1SAX A;  2QUF A;  3AL0 C;  4H4K C;  4HST A;  3PO3 J;  2XAF A;  4UB8 C;  2K9M A;  4HA8 A;  4XID A;  2FOK A;  1VQ6 I;  2DMP A;  1LDJ A;  1TT5 B;  2XIG A;  4M74 A;  4A0Y A;  5ICE A;  5DEQ A;  1YQA A;  2MD0 A;  4FE7 A;  4XRF A;  3MKW B;  3U1D A;  2FUG 2;  4UUV A;  2ZKZ A;  2QSH X;  1ZK8 A;  1XN7 A;  1DGR M;  2D5V A;  2QGU A;  3K2Z A;  4Q47 A;  1W36 D;  5EF6 A;  1FP1 D;  4XOR A;  1B4A A;  1I3Q J;  1Z91 A;  4G94 A;  4A12 A;  5JVT A;  2RDP A;  2VPL A;  3DU5 A;  5LRS A;  2K40 A;  3OR1 C;  1TNS A;  2DA3 A;  3PUB A;  3RPU D;  2HGC A;  4L5I A;  1EV7 A;  1A6Q A;  3OIO A;  5J1Y A;  3VWB A;  4HQM A;  3LA7 A;  2NS0 A;  4LJZ F;  2DA5 A;  4GFB A;  3W2A A;  4A6D A;  1GHC A;  2KHM A;  1KGS A;  4IQ4 A;  2WTE A;  3TMO A;  5DUI A;  1D1B A;  5ERI A;  3H5A A;  4CCO A;  1T98 A;  4L0Y B;  1BIA A;  3HZJ A;  3GFL A;  4LD5 A;  3E5X A;  3PFI A;  1LEA A;  2ICW G;  4N4O B;  4WWC A;  1AKH A;  5EG0 B;  2ZJ2 A;  2FNA A;  1B1B A;  2O9L A;  3SHF A;  3OV8 A;  4ANJ A;  1RR8 C;  1ZRD A;  2VE8 A;  1FBQ A;  4YIF A;  4LLG F;  3HGY A;  4L9J A;  1H0M A;  5D8L B;  2L7K A;  4IHY A;  1JKR C;  4XKV A;  4EM0 B;  3G2B A;  3U21 A;  4XBF A;  1S72 I;  2CV2 A;  4LB6 B;  2H8W A;  1GXP A;  2HZT A;  2K3P A;  1K78 B;  3EET A;  3T8R A;  3TOA A;  2AHQ A;  1YYV A;  2H8R A;  1EKE A;  4RLF A;  4NHJ A;  3FIW A;  2UXN A;  2X6O A;  4RAG A;  1V3F A;  3LSK A;  5E1W A;  5J40 A;  2LD5 A;  4ZZL A;  4KIB A;  4A5M A;  3PNV A;  2EBI A;  3DEE A;  3JSP A;  1BN5 A;  2CH0 A;  4FAS D;  4P96 A;  1T33 A;  1ETK A;  2X1C A;  1ON1 A;  1QPI A;  1S7A A;  2H6C A;  4ZDO A;  1K83 J;  2XC7 A;  1P4W A;  3HBL A;  2XHK A;  1NH3 A;  2EV6 A;  3DTE A;  2CSO A;  1UHS A;  3CES A;  3AFH A;  4OIP F;  2H1L A;  1BI0 A;  2E5Z A;  1PVE A;  4CCJ A;  2H09 A;  2DJN A;  1MBK A;  3ASN H;  3AG4 H;  1IF1 A;  2ZME A;  3CF2 A;  4BQA A;  5BPI A;  2E71 A;  3M9A A;  4AU7 A;  2K7L A;  2HKX A;  2EA2 A;  1S6L A;  3UNG C;  3R4K A;  4KIT B;  2HQR A;  1XPX A;  2EFW A;  4RA2 A;  2VQL A;  4KIS A;  3SQN A;  2MG4 A;  2MLK A;  4G6D A;  2R5Z A;  2CUF A;  1MKM A;  1V5E A;  3E0J B;  4HV6 A;  2D1V A;  1B9N A;  1WFX A;  3BQZ A;  1KQ8 A;  3E6D A;  1VI0 A;  2ZB9 A;  1SD6 A;  4XOT A;  3I64 A;  1R5I D;  3G1L A;  2RAE A;  3TP0 A;  2JUC A;  1EJ9 A;  4ZJZ A;  3I58 A;  3S14 J;  2BY0 A;  3V8K A;  2KJC A;  3DXJ F;  1PUF A;  5GP9 A;  1WH5 A;  2DTR A;  3H0D A;  1MBH A;  3K0L A;  3S3O A;  1AU7 A;  3ZPL A;  2M8G X;  2E2I J;  1OKR A;  2LTP A;  1YIT I;  3CZ6 A;  1ZRE A;  3GW2 A;  3HUG B;  4O5V A;  2ZC2 A;  1R58 A;  2Y75 A;  1IUF A;  1BJZ A;  4CZC A;  2M8E A;  2O3F A;  3I0T A;  4M9X A;  1ZAO A;  5CPR B;  1RES A;  1BBY A;  3M07 A;  1LFP A;  1MD0 A;  3M8J A;  3BG6 A;  3K4J A;  4CCL A;  2QKM B;  2R7U A;  1OYY A;  4R1H A;  4RBO A;  2QCO A;  1XTA A;  2KZG A;  3H5R A;  2PFB A;  3C1D A;  2ZSI B;  3MQ0 A;  4AYB N;  1OCP A;  1TWH J;  3CQZ J;  3BPX A;  3BY6 A;  2VJJ A;  1OCO H;  1ON2 A;  2P6T A;  1IDY A;  3F21 A;  5LGT A;  1U8B A;  2AQE A;  3E3V A;  4A3K J;  2K5C A;  3VFZ A;  2FOW A;  1BI2 A;  3CC7 I;  2HXO A;  4BHB A;  2E1C A;  4IKF A;  4XKW A;  1G3S A;  2CUZ A;  5J8C A;  1KA8 A;  1MJ9 A;  3H9Q A;  2JMW A;  3HRT A;  4L9T A;  3WGI A;  3QPL A;  2VXD A;  3F0C A;  4UV8 A;  4FQG A;  1U2W A;  2DFI A;  2DLL A;  2Z3Y A;  4IEJ A;  1SEU A;  2JTV A;  3VYT B;  2LBF A;  3B02 A;  2CQQ A;  3KP5 A;  2JPC A;  2HQA A;  3LOC A;  1LDK B;  2RN7 A;  2K86 A;  1X3U A;  3OS2 A;  2MD5 A;  3AG1 H;  1O7L A;  1GVD A;  2HS5 A;  2YR2 A;  2W84 A;  1K6O A;  2GQQ A;  2X9D A;  1PJR A;  2MFZ A;  3LSP A;  3LFU A;  2DOA A;  4E7J A;  4GO1 A;  2H94 A;  2BV6 A;  1VFC A;  3T0Y A;  1JJ6 C;  3CP8 A;  3IV5 A;  4EMS A;  2Z33 A;  4BJT A;  3CUQ B;  3R60 A;  1JE8 A;  2XAQ A;  2CW8 A;  3K4C A;  3ABU A;  3ZN0 A;  1HCR A;  4IF4 A;  1T38 A;  1K78 A;  5J1U A;  2BY1 A;  1TC3 C;  3KPH A;  3EYI A;  2PJR A;  1ULY A;  4A3E J;  1FTZ A;  1SVL A;  4WXH A;  3KEO A;  4YEJ A;  1VQL I;  3OMY A;  3E6C C;  2VBZ A;  2Y0S A;  4EGY A;  4WF2 A;  2KIU A;  3IUO A;  3OIQ A;  2XAS A;  1USS A;  3HKZ N;  2A68 F;  1RPW A;  2DA6 A;  5K1Y A;  3M4O J;  5J3L A;  4B47 A;  1D0X A;  4BNC A;  3Q0V A;  2IW5 A;  2A3S A;  1FLI A;  4ZTF A;  3BR1 A;  5DYM A;  3SFZ A;  4AID A;  4I6Z A;  1RI7 A;  1FYM A;  4O3M A;  3I56 I;  4NC8 A;  4RLQ A;  1XCB A;  2AXT C;  4I02 A;  2BHZ A;  1HDD C;  4HNU A;  3ERM A;  1R1V A;  1R7J A;  2DQR A;  3VYU B;  4BHP A;  2Z1D A;  1QO0 D;  3S1M J;  1K61 A;  1RC9 A;  3GX4 X;  1TWG J;  3HOZ J;  4DYQ A;  1B6A A;  1L3L A;  2UV1 A;  2JA7 J;  3LQQ A;  4N9I A;  1IUY A;  2DOE A;  1WJA A;  4YII A;  3ZRG A;  2VIX A;  2M2E A;  2R0Q C;  4X6A J;  5FRM A;  2QQ9 A;  2IAI A;  2W24 A;  3PL8 A;  2X4H A;  2Z99 A;  3WTX C;  1IJW C;  2WAQ N;  5BPD A;  4DNC A;  4ITV A;  3I4M J;  1X2M A;  2GOX B;  2GAU A;  3CCE I;  4WCG A;  1R9T J;  1X4O A;  3H5N A;  2NS7 A;  3V8L A;  1MMD A;  2XSJ C;  1OYI A;  3CLO A;  3CCJ I;  1TQM A;  3I4P A;  1WH7 A;  5D5W B;  1RR7 A;  1JKO C;  1R49 A;  1QNT A;  2R7T A;  2KDZ A;  1XMX A;  3L2C A;  2IRF G;  1X58 A;  3IWZ A;  2D45 A;  4GYI A;  2V6C A;  5K7H A;  3P5J A;  4ASN A;  3K4L A;  5L3F A;  2EWN A;  3WTY C;  3JTG A;  1F43 A;  3T8T A;  1ITY A;  5D5U B;  4RB2 C;  2UZK A;  1DU0 A;  4M3F A;  3E5U A;  3IH2 A;  4IRI A;  5M5X J;  3JRI A;  1B9M A;  3CJQ B;  3GZ5 A;  4CDG A;  4G9Y A;  2F2E A;  2NRA C;  3H92 A;  3ESW B;  3I53 A;  4B09 A;  2XSD C;  2RV8 A;  1KZH A;  4CXF A;  1QHH D;  3EUH C;  2VC1 A;  4KIG A;  3O8H A;  2A6T A;  5M5Y J;  1A31 A;  3BTL A;  1NK2 P;  5IP6 A;  4QLC U;  2XV4 S;  1XDS A;  3M8E A;  5HVQ C;  3J81 K;  2E1O A;  1P2F A;  1RUO A;  4EM2 A;  2IS2 A;  2LMD A;  2ID3 A;  3JRD A;  4V2G A;  2BYV E;  2CMP A;  1KU7 A;  3R61 A;  1X4P A;  3T1B A;  1YIJ I;  4IRH A;  1QZY A;  2DCE A;  3RDI A;  3HOT A;  4M3E A;  4ZTJ A;  4IOC F;  2HDW A;  4A3D J;  2BE5 F;  4AM3 A;  4LGW A;  4KYW A;  5CKT A;  3ABK H;  4HEA 2;  3OYK A;  3L2R A;  4AIH A;  4IHV A;  2V79 A;  1BM9 A;  4RM2 A;  4DW6 A;  3HOW J;  2RNJ A;  2E2H J;  2UWM A;  2F5V A;  3OL3 A;  1BI1 A;  5FLX K;  3TW6 A;  4L5E A;  1FYL A;  4UNO A;  3CJR B;  1LJ9 A;  2LF8 A;  1HKT A;  4ESF A;  2VPR A;  1K4S A;  1TW2 A;  2R7S A;  3CMY A;  3FWE A;  1ZHF A;  2FBK A;  2MYS A;  2KDO A;  3C2B A;  4M9S A;  3JRF A;  2F4M B;  4I0B A;  2IGN A;  3PSF A;  4U0V A;  2EFQ A;  1P6R A;  2QA4 I;  2X6Y A;  4XLP F;  1A36 A;  3MWM A;  4OIN F;  4BEH A;  2RNG A;  5CVJ A;  3VYR B;  1D1A A;  2W57 A;  2PBI A;  3CCM I;  1TL8 A;  2FJ1 A;  5CVR A;  4OWR B;  1RIO H;  4A3B J;  2XDV A;  2EIM H;  1ZH5 A;  1E2X A;  2P6S A;  3H0G J;  2Y31 A;  3S93 A;  1GV5 A;  4Z2Y A;  3CME I;  2CW0 F;  1OPC A;  2FBH A;  3WU2 C;  1WGX A;  3N97 A;  3PO2 J;  4KDP A;  1XSV A;  1QA6 A;  5GAD J;  4F55 A;  1S7O A;  2K9N A;  3CTA A;  1P7J A;  4E6K G;  1WJF A;  1YHQ I;  5LHI A;  3SZT A;  3F8N A;  1FBU A;  2I8D A;  5FD6 A;  2W7N A;  3HOY J;  3JAM K;  2M9H A;  3TO6 A;  4CZZ A;  4MQV A;  1IN5 A;  4MFD A;  1S9H A;  2O61 A;  2G0E A;  3ZOB A;  1JXS A;  1T0F C;  2X85 A;  2TCT A;  3PIP F;  4CCK A;  3WGG A;  4Y7N J;  5D6F A;  2WAQ A;  1O3S A;  2M87 A;  3S8P A;  4JK1 X;  3S1N J;  1HW5 A;  3P9K A;  1W0T A;  5E17 F;  3FXK A;  1MH3 A;  4LLN A;  1GLN A;  4BBR J;  3H3U A;  1XCV A;  2Q2E B;  1JGG A;  1YW7 A;  1BC8 C;  1S8N A;  1N75 A;  2L7Z A;  5GAG J;  3COA C;  3ZR8 X;  3HXL A;  4DJA A;  3TOB A;  4CIC A;  4EGZ A;  3ZQ7 A;  2VT2 A;  2VOD A;  2GBY A;  1YFH A;  4UVA A;  4BXF A;  1ZQ3 P;  2AS5 F;  1TZL A;  2KPM A;  1L0O C;  5E8I A;  5JVG F;  4ENM A;  1U9O A;  2Z2S B;  4Y17 A;  4ABZ A;  4CA0 A;  4BUP A;  3REO A;  1FZP B;  3Q5F A;  3CMM A;  2HNH A;  3WU0 A;  1X3Z B;  2P0W A;  2QF7 A;  4L9N A;  2CGP A;  2E2J J;  1R36 A;  3BWG A;  4EJW A;  2GOM A;  2Q0O A;  1K4T A;  5E1Z B;  1O57 A;  2LG4 A;  2QSG X;  3DBL B;  3IH3 A;  3LSI A;  1YI2 I;  3RPQ A;  2VKD A;  4HF0 A;  4XON A;  3KIO A;  1U3E M;  3WE2 A;  4BXU A;  2RQQ A;  1VQO I;  3E7L A;  2R7X A;  4MLO A;  1LFU P;  1K79 A;  4M3B A;  2A6E F;  1YS6 A;  1JTY A;  1MMA A;  3A02 A;  3ULQ B;  4Z6Y A;  3VDX A;  4CCN A;  1IRG A;  3GBG A;  1TNT A;  4EM1 A;  2ELJ A;  2RC4 A;  4J00 A;  2HDC A;  5J6X A;  2OQR A;  1W5S A;  1YTY A;  3L2V A;  5IYD J;  4H0E A;  4MFE A;  5DS9 A;  1ZAR A;  1JHH A;  1MMN A;  4I99 C;  3KYL A;  1G6N A;  4S04 A;  2KP6 A;  2NAZ A;  2M34 A;  2HZD A;  2DN0 A;  1T56 A;  3IP4 B;  4GYG A;  2Q8K A;  3Q9V A;  2XF7 A;  2NVT J;  4XN3 A;  4RM3 A;  2GLO A;  5L3G A;  1YJW I;  4HF2 A;  2JSP A;  3I4N J;  2DQL A;  5F6F A;  3KX2 A;  5CQE A;  3KYD B;  1ONV A;  5JHU A;  5E8G A;  1GXQ A;  2HYG D;  3BCA A;  3BZC A;  3IKT A;  1VQP I;  2MGQ A;  3BR5 A;  3ZCO A;  4OIO F;  2KT0 A;  2ACJ A;  2PMZ A;  2F5E A;  4XM3 A;  1BI3 A;  2L3D A;  5F04 A;  4JOM A;  2X6X A;  1XX5 A;  2VT3 A;  4OIR F;  5EGO B;  3IHU A;  3QPS A;  1OFC X;  1Q1H A;  2ZME B;  3EDP A;  2LFB A;  5JR3 A;  1Y6I A;  2R92 J;  1FOK A;  4BS9 A;  3I55 I;  3CCR I;  1IAW A;  4Y52 J;  3CP2 A;  2FU4 A;  3BOQ A;  2XGX A;  4YRV A;  2UUZ A;  2JQ7 A;  2R5Z B;  2O7O A;  4K2E A;  2XUB A;  3NWT A;  2HVS A;  3A03 A;  3OYG A;  3ECO A;  5GPA A;  2K9Q A;  1DPU A;  1ODD A;  2IJL A;  4XLF A;  1J59 A;  2LY9 A;  5FJ8 J;  2F5F A;  1V55 H;  4IVN A;  2EIJ H;  2X51 A;  1ETX A;  3EYY A;  1FOW A;  2DFE A;  3TDZ C;  5EYR A;  5ICG A;  1PUF B;  3I3L A;  4UV9 A;  4IHW A;  4BBS J;  2HTS A;  3PJR A;  1DPR A;  2EZK A;  3FXQ A;  4M3G A;  2K9S A;  2CQX A;  2DU9 A;  2LRD A;  5DCM B;  2F48 A;  5E18 F;  3EUK L;  3GF2 A;  2EFP A;  3V8J A;  1F36 A;  1SAN A;  2XGC A;  2KKO A;  3OYN A;  2Q2E A;  3RZO J;  3CDL A;  3EQL F;  1JUS A;  1DUX C;  1ZG1 A;  3H3V K;  5F1R A;  2LKS A;  3BTC A;  2CQK A;  3JCU C;  4KIF A;  5IOY A;  3R0J A;  1O7F A;  2M5W A;  4II2 A;  4B44 A;  2B63 J;  2IA1 A;  2Y0M A;  2VOP A;  4L18 B;  3HYI A;  4M9Z A;  1R4N B;  4JBA A;  1X1B A;  1MBE A;  3L09 A;  1K7A A;  2PJP A;  2E1N A;  2FQ4 A;  1X2N A;  2ESH A;  4B48 A;  1W0U A;  5F0C A;  1VF9 A;  2VBY A;  1I6X A;  5ILS A;  1NTC A;  4A5N A;  3EUH A;  4RGX A;  2IEK A;  5TRD A;  1QVU A;  1ETY A;  3OIP A;  3IWF A;  4WXD A;  2LBF B;  4ZC3 A;  2YS9 A;  3I54 A;  2HEO A;  1ETW A;  2DA4 A;  2VJ5 A;  3WTV C;  1OCT C;  2CQ7 A;  1WZ2 A;  1TWA J;  1D8K A;  4A3L J;  2XRN A;  1HXD A;  1DGW Y;  3HM5 A;  4WK8 F;  4A0X A;  2ZSH B;  2XAJ A;  3HOX J;  2JVG A;  4MGR A;  2Y9Y A;  2KIS A;  3BT9 A;  4PFO A;  1O3R A;  3GTO J;  1G3Y A;  2XAG A;  5HS9 A;  5EJC A;  2V7F A;  1AWC A;  2E7X A;  2EIL H;  4C3H J;  3IRQ A;  3K70 D;  2E1M B;  1UHM A;  3FXJ A;  4B3A A;  2LC2 A;  3VOE A;  4I01 A;  5IPA A;  3MFK A;  1QZZ A;  1YW9 A;  2GA1 A;  3FMS A;  4J19 A;  1J5Y A;  1B8I A;  5EEG A;  4P5O A;  1JT6 A;  2JA5 J;  1I1S A;  1ZGW A;  2XF5 A;  5E20 A;  2LSO A;  2CFX A;  2UXX A;  3OYH A;  3M8F A;  2GXA A;  5DV5 A;  2PJR B;  2ISY A;  4ETS A;  2F6C A;  4AVZ A;  1S29 A;  1T08 B;  5J47 A;  3NRV A;  4XLH A;  1PYV A;  4XKC A;  4DYR A;  4YIR X;  3WTZ A;  4ZH4 F;  2ZXI A;  2RGV A;  5LRR A;  2ELH A;  2L4A A;  4FT8 A;  1XC5 A;  5FLX Z;  3K2A A;  3PFY A;  5EZH A;  3S32 A;  1X1C A;  3ONQ A;  2R5Y B;  2EZI A;  3FM5 A;  1C0W A;  4ESB A;  2Y0S N;  3SDG A;  2EPF A;  2NOG A;  2DOD A;  3RI4 A;  2I5U A;  3CUQ C;  3K6G A;  4HX4 A;  2B7E A;  4JX5 A;  2A6H F;  2STT A;  1OIS A;  5KAI C;  1KQ9 A;  3E6M A;  4IQJ A;  4UY8 I;  2V1X A;  1I6H J;  3MKY B;  4TV7 A;  1U5T A;  3K4M A;  4F92 B;  1WJ5 A;  4ZYA A;  5EGO A;  4BE0 A;  3KYC B;  3KZZ A;  4LK0 F;  4M6X A;  4BU2 A;  1SVM A;  3OYL A;  1FBS A;  1FY7 A;  3PIO F;  2OZ6 A;  2VN2 A;  2NVU B;  2QQA A;  3CCS I;  4J01 A;  3ZMV A;  4BH9 A;  4ZYG A;  2QYO A;  5E79 C;  4FE4 A;  3VSL A;  1FOY A;  2IGK A;  4A6E A;  5HOO A;  1HC8 A;  1KU2 A;  5J8F A;  3OYJ A;  3DCF A;  3L7W A;  2M4G A;  1YX5 A;  4Y13 A;  3AL0 B;  1R00 A;  3P9C A;  1ZEL A;  1HOM A;  2IGO A;  4D9J A;  2EZH A;  5KK1 A;  4YFN F;  4UUS A;  1W4M A;  4U0Y A;  5H20 A;  1W36 C;  1MH4 A;  4FX4 A;  4ZYD A;  4BE1 A;  2PI0 A;  3G73 A;  4A0Z A;  2VXZ A;  1J0R A;  4HV5 A;  1UEL B;  1GV2 A;  2YU3 A;  5DCM A;  3GTM J;  1IW7 F;  3QYF A;  5IP7 J;  2W00 A;  5IY5 H;  1EA3 A;  1FJL A;  3LWF A;  5EDN A;  2WY8 Q;  1Z1D A;  3RCO A;  5M5W J;  3MN2 A;  3B6A A;  2QWW A;  1UG0 A;  5F64 A;  2ELK A;  1SVO A;  2J5O A;  1XS9 A;  3H36 A;  3MEX A;  2IA0 A;  3WHB A;  4XLC A;  2JRT A;  3QOP A;  2EJR A;  5L3C A;  3KZY A;  3HSR A;  4EV0 A;  2YUS A;  1I1G A;  3FXR A;  4NQW A;  3QP6 A;  5HLG A;  1H9T A;  2OUM A;  2ZFW A;  3ISP A;  2FQ3 A;  3KEY A;  4OAY A;  3RKQ A;  1A5J A;  2R7Q A;  4IRG A;  4UVB A;  2HR3 A;  3HC7 A;  1ZG3 A;  4BAY A;  3OYA A;  2X6W A;  5CVU A;  2AO9 A;  3HDD A;  1TBX A;  3DKX A;  3FF5 A;  3CUO A;  1NHA A;  1MSE C;  3JRH A;  4LG0 A;  1J09 A;  3K70 C;  3C2G A;  1VTN C;  2HTJ A;  1EH8 A;  2FBI A;  3HSE A;  4C3J J;  1FT9 A;  3EUA A;  4ZDL A;  1QGP A;  1Y8Q B;  3IH4 A;  2ZJQ F;  3D5L A;  2WB1 A;  3GME A;  1ZTR A;  2L54 A;  1IGN A;  4D5F A;  1LVK A;  4AIK A;  3DPL C;  3PNT A;  4MEY F;  3K1N A;  1MJA A;  1QBJ A;  2JUG A;  1LKX A;  2QQB A;  1UZC A;  3QYE A;  3OYE A;  2IP2 A;  3GFJ A;  5K7Z A;  1OR7 C;  1WI3 A;  4QTR A;  2DK8 A;  1IXC A;  3S2D J;  2HYF A;  2EFN A;  2A05 A;  1TWF J;  2LF7 A;  2XB0 X;  3WTW C;  3OOU A;  3MKZ A;  3HTS B;  4B43 A;  3GFM A;  4XLE A;  4G7H F;  1WI9 A;  1CQT A;  3GFI A;  1SFK A;  2W82 A;  2DFH A;  2OU2 A;  2R7D A;  3PNY A;  3JW4 A;  4BEH B;  2WY7 Q;  4IPA A;  1N25 A;  4PZJ A;  3J7Y J;  3LSJ A;  2HVQ A;  1ETQ A;  2R5Y A;  2R93 J;  4E7K A;  2K4J A;  3FXL A;  3HHG A;  3CC2 I;  3P9I A;  2Y69 H;  4ESJ A;  2KJB A;  3HJE A;  3OL4 A;  5TGT A;  1W7P A;  3WOD F;  1Z0X A;  5ILV A;  4BDZ A;  2XPV A;  3DPU A;  3S2H J;  1MGT A;  3F8M A;  3GVA A;  1R1U A;  3S3M A;  2K3F A;  3J7A O;  4P55 A;  1WVR A;  2R7F A;  3HOS A;  4A3M J;  4PJ0 C;  3HTU A;  5B66 C;  1KON A;  5GTH C;  2HWV A;  4W97 A;  2VKV A;  5ICC A;  3GYH X;  4BAC A;  3B6C A;  4HQE A;  3IRR A;  2VAS A;  2Y9Z A;  3K4K A;  2HKO A;  1HKS A;  2CQN A;  4DBQ A;  1VQ5 I;  4RMN A;  3OYM A;  5D5V B;  3TL4 X;  4HX8 A;  2VJ4 A;  3GTP J;  4BHC A;  2M0C A;  1LVA A;  4IOA F;  3G4S I;  2YX7 A;  5HLH A;  4HLY A;  4C30 A;  3JRA A;  3BP8 A;  4YEL A;  1XMA A;  5LBQ A;  5DM7 F;  4GDF A;  5IT9 K;  3LA2 A;  5A2Q K;  2ISZ A;  4A3J J;  2E7W A;  2LH9 A;  2V6E A;  2EB7 A;  2V26 A;  3WTT C;  1D0Y A;  1TT0 A;  2EV5 A;  1XGO A;  2DDA A;  4HYE A;  1XSD A;  3W2W A;  1JUP A;  3WU1 B;  2QEX I;  2LK2 A;  1PP8 F;  1JKQ C;  5HDK A;  1MZB A;  4HG2 A;  3E97 A;  4KT5 C;  1HA8 A;  3HB9 A;  4C2U A;  1GVJ A;  1P7I A;  1FSE A;  2PMU A;  3Q3S A;  5IOZ A;  4YFX F;  4UVC A;  3DV8 A;  3RZD J;  4BGD A;  2CS3 A;  5B1A H;  2C6Y A;  4LMY A;  3CDH A;  3FDY A;  5CJ9 A;  4UB6 C;  3BC8 A;  1RZ4 A;  5IYB J;  2P8T A;  1QRY A;  1FMW A;  2A69 F;  2ZXH A;  2DYR H;  2IXS A;  4AD9 A;  4Q4Z F;  3BJO A;  1YOV B;  5FGM A;  2AXL A;  1JI8 A;  3DKW A;  1DQU A;  5K5R A;  1TW3 A;  2ETH A;  1YRN A;  3RKX A;  3CCQ I;  2VQH A;  2IS1 A;  4LOC A;  2XKP A;  3MVP A;  2XKO A;  4KJZ A;  1U8R A;  1UST A;  3BZ6 A;  4F93 B;  2M7B A;  2IA2 A;  3QP5 A;  2L9N A;  3VOD A;  2MH2 A;  1AOY A;  2IVM A;  4I09 A;  2Y48 A;  2HQN A;  3F23 A;  2K27 A;  4Y33 A;  3V42 A;  1M1E B;  4XNF A;  4C2M J;  5GPC A;  4PCQ A;  4NBQ A;  2F4O B;  2N8G A;  2BXY A;  2NVY J;  3U1K A;  2BW3 B;  3Q9S A;  3KET A;  3JR9 A;  2MBF A;  3ABM H;  1U78 A;  3O6B B;  5KVR A;  3UR3 C;  1HF0 A;  4L9V A;  3RYR A;  1H89 C;  3I5U A;  3F72 A;  5BNG A;  1WRJ A;  3HOU J;  2R7O A;  5ED4 A;  1HLV A;  2WV0 A;  2BBY A;  3KP2 A;  2JA8 J;  1U9N A;  1UFM A;  2XPU A;  3RSN A;  1UCR A;  2EQR A;  1WJB A;  4UXN A;  3I9V 2;  4PFP A;  1A35 A;  1VQK I;  1SC7 A;  4KA4 A;  3KP4 A;  4LK1 F;  2IS4 A;  1T95 A;  2GA2 A;  1MDM A;  5IP9 J;  3TP3 A;  1IO2 A;  2E36 A;  1S7E A;  1Y1W J;  4Q5S F;  1WQ2 A;  3BR6 A;  3DWL E;  3QPH A;  3MD2 A;  1OJL A;  3DTI A;  2R7W A;  1ZRC A;  3BPV A;  2PMZ N;  5M3M J;  5H6R A;  3CD6 I;  3TBI A;  1QZE A;  2O0Y A;  1P9Q C;  1W5C C;  5B3S H;  3DEW A;  4XQF A;  3VSK A;  2R7Z J;  1R1T A;  2V1D A;  2VKE A;  1LE8 A;  1GDT A;  1PP7 U;  1N77 A;  3LQR A;  3ZMZ A;  3FBI B;  3MAJ A;  4NUB A;  4LLL A;  5JLX A;  1YLF A;  3BJA A;  2JA6 J;  1FP2 A;  3VEP A;  4B4C A;  1Y1V J;  1HQC A;  3J7A Y;  1VQ8 I;  1UJ8 A;  3ZXS A;  2KIF A;  2NXN B;  3I59 A;  2DBB A;  2DJI A;  1FYK A;  4CCM A;  2Y30 A;  4E7Z A;  3HGG A;  1SMY F;  3BRO A;  1Y0N A;  5L3D A;  3QU6 A;  3JRB A;  4HF1 A;  1DU6 A;  2BY3 A;  3CCY A;  2CW7 A;  2R3S A;  2ZXW H;  2GXB A;  5GAH J;  3HRS A;  4DBR A;  1ZR4 A;  1J2X A;  5DUK A;  2DXI A;  2WAD A;  1NK3 P;  2ZFU A;  3ZQQ A;  5K5Q A;  2FA5 A;  5J1R A;  3RPU A;  2OV7 A;  4G6Q A;  1G59 A;  2MLG A;  1JKP C;  3ASO H;  2DDB A;  1XGS A;  5AIP A;  3K9T A;  3P7N A;  3W2V A;  2A5Y B;  3TED A;  2DT5 A;  4IHT A;  4EJU A;  4A3G J;  2EIN H;  4HRI A;  4WX9 A;  2BZT A;  3WE3 A;  5LHG A;  3GZ6 A;  3H1C A;  4HNT A;  2A5W A;  4XR6 A;  4M3D A;  3A4C A;  1IXR C;  3OYF A;  1OCR H;  5BQT A;  2KFD A;  3KP3 A;  3HG9 A;  5F08 A;  3RTR A;  4F3Q A;  2NNY A;  1VQM I;  2XRL A;  2XF6 A;  4W1U A;  4ZDP A;  3VB2 A;  1OCZ H;  2CO5 A;  1TLH B;  4HLX A;  4LFU A;  2MH9 A;  4AWX B;  4EEF G;  3LST A;  3NWS A;  4ENK A;  4LB5 A;  5FRN A;  5FLV A;  2IT0 A;  3TDU C;  1JT0 A;  1KQ0 A;  3FMR A;  2QVO A;  2RKH A;  4QPO A;  3OS1 A;  3Q0W A;  4NB5 A;  5HLI A;  1FWZ A;  4G8X A;  4KN4 X;  1TQI A;  2XAH A;  3F8F A;  1GUU A;  1KYZ A;  4PJN A;  3K7A J;  3GWZ A;  2R4G A;  1MW7 A;  2LY2 A;  4YFK F;  2DK5 A;  4DZJ A;  4IO9 F;  5C3E J;  1ZYR F;  1Z77 A;  2O8X A;  4E70 A;  2BW3 A;  5E3O A;  1U0J A;  2MSY A;  5FFX A;  4LG3 A;  4X0G A;  2J5P A;  4OAZ A;  2AQF A;  3LL7 A;  1B8I B;  1J9I A;  3HPH A;  2FE3 A;  2FXA A;  3E5Q A;  3OR2 C;  4GGG A;  1O4X A;  2STW A;  3CDI A;  2OF7 A;  3LSH A;  2M45 A;  4ENJ A;  3HRM A;  1D5V A;  1QHG A;  4G6T B;  4B8X A;  2HDD A;  4RGU A;  1OR7 A;  3BR0 A;  2VLA A;  2E34 A;  1D3Y A;  3O2P E;  3J80 K;  2BY2 A;  2JN6 A;  3BG9 A;  3O8G A;  4FX0 A;  4X1E A;  5HOD A;  4YG2 F;  1R5H A;  3F8B A;  3LNQ A;  3A01 A;  5K5O A;  2DA1 A;  1ZN2 A;  2ECC A;  3FBN B;  4F91 B;  3FM3 A;  3V7R A;  4PK4 A;  3F3X A;  4CYC A;  4XSX F;  1MMS A;  1NG7 A;  5E1X A;  1ERD A;  2LY1 A;  2EV0 A;  2DA7 A;  5CLS A;  2P5L C;  2E35 A;  4EJT A;  3M3Y J;  4GCV A;  2CV0 A;  2V4J C;  2OTJ I;  3G1M A;  1BJA A;  2GWR A;  1ZKG A;  1QU3 A;  1BIB A;  4PSW A;  1YO5 C;  3W6J B;  2LR8 A;  4FHT A;  3WHC A;  1Z67 A;  3V7C A;  4ON0 A;  1X3W B;  1U5T B;  1RKW A;  2OZU A;  2A07 F;  2CG4 A;  2EA4 A;  4XL9 A;  1MNM C;  3QOE A;  4RS8 A;  1VZ0 A;  3HIF A;  2G9W A;  2HPI A;  3BR3 A;  3R6S A;  3K1P A;  2FEZ A;  2DAO A;  4HBL A;  1XGN A;  2HQ5 A;  5JHF A;  2OPT A;  2GIZ A;  1Z9C A;  2Z9O A;  4PJM A;  2M30 A;  3KP7 A;  4D7N A;  2G7U A;  3GTQ J;  3L2W A;  4Y3O A;  2JA2 A;  6PAX A;  3L00 A;  3QAH A;  1SFO J;  1DP7 P;  3GTL J;  2P5V A;  4BQO A;  2DYS H;  4UUS B;  4BDY A;  3D5S C;  2L2O A;  5HS7 A;  1QQI A;  2QBY A;  4DOZ A;  4LIT A;  5JFR A;  2JRM A;  2B0L A;  2QQ8 A;  4PJL A;  3GTJ J;  5IT9 Z;  3M1C A;  5BMZ A;  2LNB A;  1A6I A;  2FML A;  4MIM A;  3ROU A;  5A2Q Z;  1IV8 A;  3E1S A;  2DA2 A;  1WJC A;  2DI3 A;  3KLN A;  2XGE A;  1G3T A;  3OYD A;  2DO7 A;  2BVM A;  1IN7 A;  3E6B A;  3FMQ A;  1FNN A;  3L2U A;  2Q1Z B;  2NVQ J;  1YE9 A;  3ELK A;  5H2F C;  1OCC H;  2CJJ A;  2ZNY A;  5DD8 A;  5J4V A;  1SMT A;  4XRM A;  2E5N A;  2CV1 A;  2KQR A;  3H9J A;  2ZJR F;  5B1B H;  5FFZ A;  4MHG A;  4D1Q A;  5ICF A;  1YW8 A;  4NQW B;  2M7A A;  3U2R A;  3BTI A;  3M1E A;  4AVP A;  3ZMU A;  3NQO A;  5CYV A;  1XG1 A;  5F0H A;  5KCM A;  3TW7 A;  3K10 A;  4C2T A;  2DW4 A;  2QM3 A;  3GXO A;  1RET A;  3MZY A;  3QU3 A;  4FTH A;  1H9G A;  2DT6 A;  2X1D A;  1BR1 A;  2A61 A;  4XKB A;  1XD7 A;  2R7R A;  4LG0 B;  2RQP A;  3KZI C;  1T6S A;  5FO5 A;  2ECB A;  1YS7 A;  1Y39 A;  1FX7 A;  2LKX A;  5LEK A;  4I0A A;  2DPD A;  1W5T A;  2YSR A;  3LA3 A;  3SXY A;  3A2K A;  1HSJ A;  1X19 A;  1R4M B;  3CMA I;  2E60 A;  2WB1 N;  3J81 Z;  3DTK A;  1T39 A;  1VQ7 I;  3SEQ A;  2ZO4 A;  4JQF A;  1BW6 A;  3BG5 A;  2OBP A;  3KP6 A;  5ILU A;  5HNH A;  1JJ8 C;  4CO8 A;  2L7F P;  5FKK A;  3IAS 2;  1BOB A;  1FC3 A;  2FX0 A;  4AIJ A;  2KRH A;  2QLZ A;  1Z3X A;  3WG7 H;  5HNF A;  5DCF A;  3AKZ A;  3S1Q J;  4BXX J;  2P5K A;  3K4B A;  2JJ7 A;  4A69 C;  4PGH A;  3K4N A;  3FKJ A;  2QSF X;  1MBG A;  2NYX A;  5DTD A;  1DDN A;  3FXM A;  2ZCW A;  3CC4 I;  2L01 A;  3RQI A;  3BTJ A;  3ECH A;  1J75 A;  3CO7 C;  2D1H A;  4AC0 A;  5C4J J;  5LGU A;  2CUJ A;  1IRX A;  3F6V A;  2JPB A;  4E7L A;  3T5X A;  1RRJ A;  2EIK H;  2WBM A;  1R71 A;  1ZRF A;  4IHX A;  3GUD A;  3ZQH A;  2K9L A;  3HL2 A;  1W7P B;  3OYI A;  5B5E C;  3GTG J;  3BZK A;  3ZMS A;  3CCL I;  3TO9 A;  2HU9 A;  1XSX A;  5K7F A;  2BVL A;  2L5Q A;  5DDG A;  3CJN A;  1U6G A;  1YJ9 I;  3GTK J;  1EH7 A;  2XAU A;  4RAF A;  3IC7 A;  4CHU A;  2OC6 A;  2OCC H;  2NOJ B;  1YX3 A;  4M71 A;  4D0P A;  1S3J A;  3OYB A;  2M4K A;  3DKY A;  3JTH A;  4PDK A;  4B3X A;  2P7C B;  3PUF A;  2HOS A;  2PG4 A;  5L3E A;  4BE2 A;  1H8A C;  2OQG A;  3D0S A;  4JX6 A;  4A2U A;  3V7S A;  4BKX A;  2XRO A;  1O3Q A;  5FB2 A;  1FOX A;  1B59 A;  2V9V A;  1IV6 A;  1T0F A;  2WV1 A;  3BCB A;  1T2K A;  4BYY A;  1E0E A;  4EJV A;  1CF7 A;  5AIQ A;  1X1P A;  3C7J A;  3SEZ A;  1SFU A;  2JZY A;  2CUE A;  3F8C A;  3JAM Z;  1Z6T A;  1HBX G;  3TO7 A;  4E7S A;  1TP4 A;  3HEF A;  4BJ5 C;  3JRC A;  2LLK A;  1WPK A;  3KEQ A;  3S1R J;  4N0B A;  1B72 B;  3KCC A;  5LGN A;  2JT1 A;  1ZG5 A;  5JLW A;  1JGS A;  2WAE A;  4MEX F;  1VQ9 I;  1BOA A;  4KFC A;  1PUE E;  3JRG A;  4RAY A;  1KU3 A;  2DFF A;  3ZP5 A;  4XMY A;  2W4S A;  2H6B A;  3R0A A;  1E3H A;  4F52 A;  4HAM A;  1MBJ A;  4DGW B;  3Q0U A;  1FIA A;  1BL0 A;  3DLA A;  2KL4 A;  2V1N A;  4JP0 A;  2L9V A;  4RB1 A;  3BDD A;  3C2H A;  3ZQL A;  2KRF A;  3K69 A;  3DF8 A;  1POG A;  1IXS B;  3IAM 2;  3QQA A;  3ZQG A;  4BL0 B;  3MZH A;  3DBH B;  1YRN B;  2NS8 A;  4EAT A;  2COM A;  2XPW A;  2IGM A;  1WWX A;  4RGR A;  3MKL A;  1ZLK A;  3PM1 A;  4MQ9 F;  2H27 A;  2JSC A;  3F22 A;  1XGM A;  2HYJ A;  4EJO A;  4EQQ A;  3G3Z A;  3PSI A;  4M6V A;  5JI6 A;  4A3C J;  2BEO A;  3BJ6 A;  3W6K B;  1ZR2 A;  3HOV J;  2VB6 A;  2HI3 A;  4G7O F;  4D5C A;  4E7H A;  2KMU A;  2PN6 A;  4BY7 J;  4XLA A;  5C4X J;  3G6E I;  3KE2 A;  3NAU A;  4HDU A;  4A3F J;  4QWQ A;  4G7Z F;  1Y56 A;  5FLM J;  2WC2 A;  3UKG A;  2L9S A;  1I39 A;  2M0M A;  3ABL H;  4OIQ F;  1P4A A;  2K85 A;  4HW0 A;  2KRC A;  3TQN A;  3LAJ A;  2FD5 A;  3ZN1 A;  4PJJ A;  2W25 A;  1NG6 A;  4I98 B;  1A04 A;  1SD7 A;  5HDN A;  2CFO A;  3SJM A;  2P4W A;  3S15 J;  1Z7L A;  4DYC A;  4JYK A;  3QYB A;  4MTE A;  2ADU A;  2FSW A;  3NAR A;  4HZF A;  1G8X A;  4BY1 J;  1UMQ A;  3RQ4 A;  3CO6 C;  1ZGA A;  1HKQ A;  3GEZ A;  1MDM B;  1BC7 C;  5EG0 A;  4GXO A;  4RAZ A;  4HX7 A;  4Y4R A;  2KIM A;  3LSM A;  5AON A;  1D1C A;  3QWL A;  3DU6 A;  3J80 Z;  2DMN A;  3MZ8 A;  2FMY A;  3M7G A;  1WKM A;  1IRF A;  5F1J A;  3RYP A;  4DIQ A;  1ACI A;  1VQN I;  4RB3 C;  3AG2 H;  2PX9 A;  2E19 A;  4M6Y A;  3ZQF A;  3NEU A;  2DMU A;  1FEX A;  4OU0 A;  5E3L A;  1V54 H;  1ORK A;  3J7Z I;  3IL2 A;  1LE8 B;  2O5R A;  5FKN A;  1SD5 A;  3BQY A;  3A0H C;  2QKL B;  1IG7 A;  3PQJ A;  2IBD A;  2VBW A;  4R8H A;  1AA7 A;  3ZQI A;  5HDG A;  3A1Y A;  5DD4 A;  3ERE D;  3CLQ A;  4M73 A;  3SZG A;  3I59 B;  4PSX A;  4KNY A;  5D6E A;  2L02 A;  2HOA A;  1SD4 A;  1HST A;  3ABT A;  1LEB A;  2LRE A;  2LVS A;  4KUM A;  1IRZ A;  2LYC A;  1LQ1 A;  2OA4 A;  4HSR A;  2XVC A;  3DPT A;  1Y8R B;  1STZ A;  2HXI A;  2XB5 A;  4XOP A;  2BOL A;  1HW1 A;  2COB A;  1PDN C;  3LSR A;  4LIU A;  2VBX A;  4XRS A;  3DFG A;  4QPQ A;  4I2O A;  2FNP A;  1J7K A;  4Q48 A;  3S3N A;  5GTI C;  4R79 A;  3D1N I;  1IN8 A;  3SZP A;  1DP3 A;  1T8I A;  1MSF C;  5D4R A;  1B72 A;  2FF4 A;  4I76 A;  4MO7 A;  3K1M A;  3FHN A;  5EEA A;  2TRT A;  5KHD A;  1I3A A;  2VON A;  2VOO A;  5FKL A;  4FCY A;  4BQQ A;  4OMY A;  2M3A A;  1FMV A;  4ENN A;  4A3I J;  3O3K A;  2QEN A;  3OYC A;  1FPQ A;  3DQV C;  4XRS G;  1Z21 A;  2JVH A;  3N05 A;  5KNL A;  4EVI A;  5D4S A;  4XN0 A;  1V5F A;  2YX4 A;  2Z16 A;  3BG7 A;  2PQ8 A;  4IX7 A;  5FKO A;  1HW2 A;  1LFB A;  3VPR A;  2HPM A;  2HOE A;  4B1R A;  1TWC J;  3HUG A;  4NC7 A;  1E17 A;  4DQ2 A;  1ENH A;  3G1O A;  2W48 A;  4U88 A;  2ID6 A;  1EF4 A;  2M1B A;  5HLT A;  1KYW A;  3G71 I;  1Y0U A;  4O6J A;  4AYB A;  3N4M A;  1ETO A;  1XB4 A;  3FK7 A;  1WHU A;  4QIW N;  1UAA A;  4II3 A;  4L0Z B;  3HHH A;  4CGZ A;  2HOT A;  1IZ1 A;  2R7V A;  3I71 A;  3V4G A;  2HVR A;  5GAE J;  2MC4 A;  3HPG A;  4A93 J;  1WJD A;  1F4K A;  4NDL A;  4HOB A;  2W1O A;  2VUM J;  3KFW X;  4HPQ A;  5D5X B;  5LFA A;  1JTX A;  4XSZ F;  3L9F A;  2X0L A;  1IN6 A;  4U7B A;  3C18 A;  1RUN A;  2MC3 A;  3QOD A;  4L5J A;  4CSW A;  3DBR B;  4NNJ A;  1VQ4 I;  1G4D A;  1TTY A;  3QPT A;  4HNV A;  2ESN A;  4U0W A;  2NNN A;  4CYD A;  3A01 B;  5H6Q A;  1Z6R A;  1V5G A;  2EK5 A;  4CYC B;  1F5T A;  4ZYH A;  2RVC A;  2CU7 A;  2EH3 A;  3GLL A;  1F1Z A;  5BOX A;  3AG3 H;  2ME6 A;  3DLL F;  1IN4 A;  3WGH A;  2O8K A;  2P81 A;  1UB9 A;  3F9K A;  3BR2 A;  1OLT A;  2ZJP F;  3CUQ A;  2CYY A;  1D8J A;  2JWT A;  3JRE A;  4KMF A;  1Z05 A;  1ZGJ A;  3VYS B;  4IL6 C;  5LD2 C;  1ETV A;  3ZQC A;  1REP C;  2HFH A;  1O3T A;  5BS6 A;  1XDU A;  4KT6 A;  4KIC A;  3LSG A;  3KLO A;  2ME0 A;  4WXC A;  4U7D A;  3OS0 A;  1EH6 A;  1FTT A;  1GT0 C;  1MJB A;  2DMQ A;  3HKZ A;  1QPM A;  4P9F A;  2BXZ A;  3FXO A;  1OYW A;  5IT3 A;  2TDX A;  4Y15 A;  3X2Q H;  5CQG A; 
#chains in the Genus database with same CATH homology
 3K4M A;  5JHF A;  1X1D A;  4F92 B;  1WJ5 A;  4PJM A;  4ZYA A;  2WA0 A;  4BE0 A;  2F4I A;  4BU2 A;  3OYL A;  3L2W A;  4Y3O A;  4PUS A;  4ZTF A;  3LMM A;  2JA2 A;  3OY9 A;  2DT7 B;  4J01 A;  3OWT A;  4NC8 A;  4RLQ A;  4BQO A;  4BQN A;  3VSL A;  2IGK A;  5HOO A;  4HNU A;  4BDY A;  3D5S C;  2L2O A;  3VYU B;  3OYJ A;  2Z1D A;  4DOZ A;  2M4G A;  3H35 A;  1YX5 A;  3AL0 B;  4LIT A;  2MAB A;  1ZEL A;  2IGO A;  4PJL A;  4D9J A;  2UV1 A;  3M1C A;  4CH7 A;  1X1A A;  3E1S A;  2X1E A;  2VJI A;  3SDB A;  1WJC A;  1WJA A;  1W36 C;  4BE1 A;  3ZRG A;  2VIX A;  3OYD A;  2BVM A;  5FRM A;  3PL8 A;  4IZZ A;  2VXZ A;  4ITV A;  2GOX B;  1UEL B;  3L2U A;  2Q1Z B;  2VKH A;  1YE9 A;  3QYF A;  2W00 A;  1X4O A;  1MMG A;  3H5N A;  4E7I A;  1MMD A;  1EA3 A;  2XSJ C;  2E5N A;  2CV1 A;  2WY8 Q;  3RCO A;  1BR4 A;  2KQR A;  3H9J A;  1D0Z A;  1UG0 A;  2R7T A;  4D1Q A;  4NQW B;  2M7A A;  4XLC A;  2LOO A;  5KCM A;  3K4L A;  3K10 A;  4C2T A;  2OUM A;  1BR2 A;  3ZGK A;  3L2Q A;  2DT6 A;  3EPZ A;  2X1D A;  3KEY A;  4OAY A;  1BR1 A;  2R7Q A;  2R7R A;  4XKB A;  3HC7 A;  3OYA A;  2VL8 A;  2X6W A;  3W3C A;  3CJQ B;  4P1W A;  3DKX A;  3MMY B;  2VQG A;  1J09 A;  3K70 C;  1QHH D;  3EUH C;  3C2G A;  1MND A;  2A6T A;  3A2K A;  1X19 A;  2E60 A;  3EUA A;  2WAF A;  5HVQ C;  4ZDL A;  3DTK A;  2IS6 A;  3D5L A;  2WB1 A;  4GRI A;  3SEQ A;  4JQF A;  4LIV A;  2IS2 A;  5HNH A;  1LVK A;  3DPL C;  3PNT A;  3IAS 2;  1BOB A;  2CMP A;  2KRH A;  1X4P A;  1Z3X A;  2JUG A;  5HNF A;  1LKX A;  3AKZ A;  2DCE A;  3K4B A;  3HOT A;  3QYE A;  3OYE A;  1WJE A;  3K4N A;  4ZTJ A;  5FRO A;  3FKJ A;  2HDW A;  1OR7 C;  5CKT A;  4HEA 2;  3OYK A;  3L2R A;  4RM2 A;  2UWM A;  2F5V A;  3OOU A;  3OL3 A;  2E1M C;  2CUJ A;  1IRX A;  3MKZ A;  3CJR B;  4E7L A;  4B43 A;  4XLE A;  2WBM A;  1SFK A;  2W82 A;  1K6Y A;  3PNY A;  4BEH B;  2K9L A;  2WY7 Q;  3HL2 A;  2R7S A;  3OYI A;  2MYS A;  2KDO A;  2HVQ A;  2HU9 A;  4E7K A;  2IGN A;  3PSF A;  2BVL A;  2L5Q A;  2X6Y A;  4BEH A;  2RNG A;  5TGT A;  3OL4 A;  3VYR B;  2XAU A;  4C9Y A;  4CUG A;  1D1A A;  4BDZ A;  3DPU A;  3SYT A;  3S3M A;  2OC6 A;  2NOJ B;  1YX3 A;  3D5R C;  3HOS A;  3OYB A;  2M4K A;  2VQC A;  3DKY A;  4OWR B;  4B3X A;  1Z3Y A;  1KON A;  2XDV A;  1R6R A;  3H9G A;  4BE2 A;  4U87 A;  1MNE A;  3S93 A;  4BAC A;  2VAS A;  3K4K A;  3BLY A;  4DBQ A;  4E4H A;  4RMN A;  3OYM A;  4F55 A;  2RRE A;  3TL4 X;  3BCB A;  2VJ4 A;  2KLO A;  1E0E A;  4E6K G;  1WJF A;  2KZV A;  4N4N B;  4FET A;  3SEZ A;  4C30 A;  2W7N A;  2I8D A;  4YEL A;  4E7S A;  2LH9 A;  2V6E A;  4BJ5 C;  2V26 A;  1S9H A;  1D0Y A;  1TT0 A;  1T0F C;  2X85 A;  1SAU A;  3W2W A;  4CCK A;  4BJ6 C;  2V9K A;  2WAE A;  1N78 A;  2WAQ A;  4HG2 A;  1HA8 A;  4XMY A;  3S8P A;  2W4S A;  4C2U A;  3AL0 C;  4H4K C;  4HST A;  4F52 A;  1GLN A;  2K9M A;  4DGW B;  4BGD A;  2CS3 A;  3DLA A;  2Q2E B;  2KL4 A;  2V1N A;  3C2H A;  1N75 A;  3FDY A;  3ZR8 X;  3HXL A;  3BC8 A;  2MD0 A;  3IAM 2;  4BL0 B;  4DJA A;  3MKW B;  2FUG 2;  4EAT A;  1FMW A;  2IGM A;  4BXF A;  2ZXH A;  1DGR M;  2IXS A;  1TZL A;  2KPM A;  1JI8 A;  1W36 D;  1DQU A;  2Z2S B;  4XOR A;  4CA0 A;  2IS1 A;  3PSI A;  2VQH A;  4BUP A;  4KJZ A;  3CMM A;  2VPL A;  2HNH A;  3DU5 A;  2VB6 A;  4F93 B;  2M7B A;  2P0W A;  4E7H A;  2KMU A;  2L9N A;  3OR1 C;  4XLA A;  3PUB A;  2GOM A;  3RPU D;  2LG4 A;  1Y56 A;  3LSI A;  3VWB A;  2L9S A;  2M0M A;  2VKD A;  4XON A;  2KRC A;  4Y33 A;  4PJJ A;  2RQQ A;  3V42 A;  1NG6 A;  4XNF A;  3W2A A;  2R7X A;  4MLO A;  2CFO A;  2KHM A;  4IQ4 A;  1Z7L A;  3TMO A;  2BW3 B;  1MMA A;  1D1B A;  3H5A A;  3VDX A;  4CCN A;  4CCO A;  3UR3 C;  3GBG A;  3QYB A;  2ELJ A;  4J00 A;  4N4O B;  1G8X A;  2R7O A;  3RQ4 A;  4ANJ A;  1MMN A;  3RSN A;  3KYL A;  1WJB A;  2L7K A;  3I9V 2;  2KP6 A;  4PFP A;  4Y4R A;  4XKV A;  3LSM A;  2HZD A;  1D1C A;  3G2B A;  3DU6 A;  3U21 A;  3IP4 B;  2CV2 A;  2XF7 A;  2IS4 A;  1T95 A;  4XN3 A;  4RM3 A;  2K3P A;  4DIQ A;  2JSP A;  4RLF A;  3KX2 A;  5CQE A;  3LSK A;  3DWL E;  3MD2 A;  3DTI A;  2R7W A;  3BCA A;  2O5R A;  3PNV A;  3DEE A;  3ZCO A;  2CH0 A;  4FAS D;  2QKL B;  3TBI A;  2PMZ A;  1AA7 A;  2X1C A;  1P9Q C;  4XM3 A;  4JOM A;  3A1Y A;  4ZDO A;  4XQF A;  3VSK A;  2XC7 A;  2X6X A;  1N77 A;  3DTE A;  3CES A;  3AFH A;  3SZG A;  4PSX A;  2E5Z A;  3FBI B;  4NUB A;  1Y6I A;  4CCJ A;  4BS9 A;  2LRE A;  3CP2 A;  2LYC A;  3J7A Y;  4YRV A;  4HSR A;  3ZXS A;  3DPT A;  2UUZ A;  3CF2 A;  2DJI A;  4XOP A;  4CCM A;  4AU7 A;  2BOL A;  3NWT A;  2HVS A;  3OYG A;  4LIU A;  3UNG C;  4E7Z A;  4KIT B;  4QPQ A;  2VQL A;  4KIS A;  4XLF A;  3S3N A;  4R79 A;  2X51 A;  1V5E A;  1DP3 A;  2CW7 A;  3E0J B;  1WFX A;  3I3L A;  4DBR A;  3FHN A;  3PJR A;  4XOT A;  5KHD A;  2WAD A;  2DXI A;  4ZJZ A;  2ZFU A;  3ZQQ A;  4BQQ A;  2M3A A;  2OV7 A;  1G59 A;  2LRD A;  1FMV A;  3EUK L;  3H0D A;  3OYC A;  3DQV C;  3S3O A;  3W2V A;  1Z21 A;  2JVH A;  3N05 A;  5KNL A;  3OYN A;  3CZ6 A;  3HUG B;  4XN0 A;  1V5F A;  4HRI A;  2Z16 A;  3BG7 A;  4CZC A;  4IX7 A;  4HNT A;  2A5W A;  2HPM A;  5CPR B;  4XR6 A;  1LFP A;  3A4C A;  3M8J A;  3BG6 A;  3K4J A;  4II2 A;  4B44 A;  4CCL A;  2QKM B;  3OYF A;  2R7U A;  4NC7 A;  3H5R A;  3HG9 A;  3RTR A;  2ZSI B;  4F3Q A;  2XF6 A;  5HLT A;  4ZDP A;  1X1B A;  4AYB A;  2VJJ A;  4B48 A;  3NWS A;  1UAA A;  5FRN A;  4II3 A;  2AQE A;  2K5C A;  4IKF A;  4XKW A;  2CUZ A;  4QPO A;  2R7V A;  3OS1 A;  3OIP A;  3H9Q A;  2LBF B;  2HVR A;  4ZC3 A;  2MC4 A;  2VJ5 A;  2VXD A;  3HPG A;  1WJD A;  4PJN A;  2W1O A;  2R4G A;  1MW7 A;  2LY2 A;  4HPQ A;  5LFA A;  3VYT B;  2LBF A;  1DGW Y;  2BW3 A;  4U7B A;  2ZSH B;  1U0J A;  2HQA A;  4X0G A;  4LG3 A;  1LDK B;  2JVG A;  4OAZ A;  2AQF A;  3LL7 A;  3QOD A;  3OS2 A;  4PFO A;  3HPH A;  4CSW A;  3OR2 C;  4NNJ A;  2V7F A;  3LSH A;  3K70 D;  2E1M B;  1PJR A;  1QHG A;  2MFZ A;  4G6T B;  2LC2 A;  3LFU A;  2DOA A;  4E7J A;  2VLA A;  1V5G A;  4P5O A;  3CP8 A;  3L2V A;  2XF5 A;  3OYH A;  3FBN B;  4BJT A;  4F91 B;  2PJR B;  2F6C A;  4PK4 A;  2CW8 A;  3K4C A;  4AVZ A;  1NG7 A;  1ERD A;  4XLH A;  1PYV A;  2LY1 A;  4XKC A;  2ZXI A;  3F9K A;  1OLT A;  2PJR A;  2CV0 A;  2V4J C;  3VYS B;  5LD2 C;  3PFY A;  4YEJ A;  3S32 A;  1X1C A;  3ONQ A;  3OMY A;  1QU3 A;  4PSW A;  4KT6 A;  3LSG A;  2Y0S A;  3IUO A;  3OIQ A;  3OS0 A;  3K6G A;  3HKZ A;  4XL9 A;  3QOE A;  1VZ0 A;  2HPI A;  4IQJ A;  4B47 A;  1D0X A;  5CQG A;  3MKY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...