3G2BA

Crystal structure of pqqd from xanthomonas campestris
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
TISRDSCPALRAGVRLQHDRARDQWVLLAPERVVELDDIALVVAQRYDGTQSLAQIAQTLAAEFDADASEIETDVIELTTTLHQKRLLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xanthomonas campestris PqqD in the pyrroloquinoline quinone biosynthesis operon adopts a novel saddle-like fold that possibly serves as a PQQ carrier
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Biosynthetic protein
molecule keywords Coenzyme PQQ synthesis protein D
total genus 21
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05402 PqqD Coenzyme PQQ synthesis protein D (PqqD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3g2bA00
3G2BA
chains in the Genus database with same CATH superfamily
2F4OB 2YPRA 3OYEA 1S9HA 3S93A 4A3LJ 3KETA 4ZDLA 4YEJA 2BEOA 1X1CA 3GFMA 4XL9A 4ZDOA 2DT5A 4ZTFA 2E35A 3VDXA 1OISA 3EUHA 4Y33A 3UR3C 1MBGA 1X2NA 2HGCA 4XMYA 3L2VA 2R7WA 1SC7A 1NTCA 3Q5FA 2JT1A 1Y56A 3E6CC 1IW7F 3HOUJ 2YSRA 2BYVE 1WJCA 1R6RA 3PNVA 3GLXA 1D5VA 1Y0UA 1A36A 3JRGA 4YIFA 5IT9Z 3WE3A 4F52A 1BJZA 1GT0C 2JMWA 3E5QA 4HSTA 2R5ZB 2NVXJ 1VQNI 4JP0A 3BY6A 1VQ8I 1SFUA 2E7XA 1YITI 2DDBA 3C1DA 2O0YA 4XLHA 2HXIA 3QPLA 2VJ4A 1GVJA 1S72I 1XN7A 4HRIA 3BR5A 3CCQI 4HOBA 1KU3A 3OYBA 2MLGA 2GXGA 4KFCA 4C9YA 5IY5H 2FBHA 5GAEJ 3CCEI 1YRNA 2JSPA 1BI0A 1OYWA 1LDDA 2LLKA 4Y52J 2E5NA 3ZMUA 4HF1A 1R7JA 1DU6A 1RRJA 4ITVA 5J4VA 4YIRX 2JA6J 2VQCA 3FK7A 5EEHA 3TO6A 3JRCA 4IPAA 1Z3XA 4B09A 2P7CB 1XGMA 2Z33A 1W1WE 2IP2A 3LSIA 3U21A 1ZHFA 4UHTA 2RKHA 1LE8A 2OTJI 4L18B 2WAFA 3CCYA 3QP6A 1FJLA 1TTYA 2XRLA 2VT2A 4BJTA 3DKYA 4BQNA 3CMAI 1WSUA 3V4GA 5HLGA 3F8MA 2XB0X 4E7LA 1YS7A 4G7ZF 2GM4A 4YRVA 3MKLA 2GOXB 1X2MA 5JVTA 2A6HF 3TBIA 1ZRCA 2F5FA 5EDNA 3CO7C 2BY2A 4M9SA 2XPVA 4PFPA 4S04A 2FE3A 2STWA 1DP3A 3OOUA 3NARA 3V8JA 4EJWA 5BMZA 3P9CA 2W85A 2CW7A 1ETOA 3OSFA 3DF8A 3GLLA 1QGPA 2EV6A 4S0HB 4AD9A 3CJQB 3IKVA 3I59B 4LK0F 1DP7P 2Y0MA 3IC7A 3M8FA 4M3GA 3BR2A 4J19A 3O8GA 4XLPF 1S29A 2DFFA 1WJ5A 3K0LA 3VPRA 2L9NA 2DPDA 2K4JA 1I3AA 2XGXA 3P5JA 1J7KA 4QTRA 4WK8F 4NQWA 2L02A 2R92J 1STZA 1BA5A 1ZH5A 2IS6A 5JHUA 5M5XJ 3I4NJ 5EEGA 3G3ZA 3CCVI 3BCBA 2QVOA 4W1UA 3IH4A 3TW6A 4BBRJ 1ONVA 5IYDJ 3CC4I 3T0YA 4HLYA 4FETA 3I59A 4HDVA 2HYGD 2PJRB 3WU1B 3L09A 5K1YA 1MH4A 2H09A 3G1MA 2GA1A 4OAZA 1YJNI 4CUGA 1FYMA 2QBYA 3ELKA 4BXXJ 2DA6A 1F5TA 2B7EA 1R5GA 1REPC 2FMLA 1I3QJ 2K9NA 4HAMA 2XRNA 3WTVC 3ZXSA 4FCYA 1JXSA 3JTHA 1IXRC 4W97A 5J40A 3CESA 2KHMA 5D6EA 1DPUA 4ZYAA 1LJ9A 1J5YA 3J80K 2BY1A 3DLAA 2ZNZA 2Y48A 4HEA2 3DPTA 3H9QA 2OBPA 2HNHA 3LA3A 3DWLE 3M7GA 2OJED 2JRMA 1C0WA 4PGGA 5LBQA 3S1MJ 1BN5A 2V6CA 4OIQF 1XDSA 2NS7A 2KKOA 1FWZA 3HOWJ 1PYVA 4JX4A 1X1PA 1ODDA 2MYSA 5J8FA 4FE4A 1ZG3A 5FD6A 3B73A 4I98B 3PIOF 3KZZA 1ETQA 3CUQA 1R1TA 4G12A 4FTHA 4CHUA 3LSTA 4IOAF 2EK5A 4KITB 2DO7A 1R49A 2XPWA 4UVAA 3ZQQA 1EH7A 2VE8A 2GXAA 2BW3B 1GHCA 1QVUA 2ZO4A 1H89C 1FNNA 1W36D 5E8GA 2L5QA 3V42A 1YW7A 1YE9A 1FOKA 6PAXA 2R3SA 2E1CA 1KU2A 4I09A 3RDIA 2WBMA 1HLVA 3E97A 3B6CA 5LRRA 3JRIA 2IAIA 2M1BA 4A12A 1U78A 1YX3A 2HOTA 2JPBA 4LLNA 2OAZA 5CQEA 4U7DA 5IT3A 5LGUA 2RV8A 3HRTA 3LFKA 4RAYA 1XGOA 3R61A 2E34A 1BOAA 1IZ1A 1SFKA 4Y7NJ 5K7FA 1K4TA 3BCAA 3LA7A 4E7SA 4UUSA 2E1NA 2KL4A 2RC4A 4Y13A 1P4XA 2EWNA 2YS9A 1R5ID 2CRGA 2M4KA 5EZGA 3S32A 4XBFA 5FLXK 1FMVA 2V7FA 3ABKH 4C30A 1X3WB 5KHDA 3K1NA 3MVPA 5DCMA 1FY7A 1GXPA 2LK2A 4WXDA 4I0AA 2O8KA 2QSFX 5A2QZ 2RGVA 2ZFUA 3NWSA 2DAOA 3HDDA 3G2BA 5E3OA 1R22A 3WG9A 3DXJF 1FSHA 2DN0A 2Z3YA 4G9YA 1HCRA 2W00A 1TZLA 2NS0A 4C3JJ 2O3FA 1KQ0A 1VQPI 4XRSG 1OKRA 1V54H 5E79C 3JSPA 3SXYA 3CP8A 2LY2A 2YX4A 3KE2A 4KMUX 1XB4A 2QKLB 1MMGA 2EINH 2JVGA 2FA5A 1Y8QB 1Z6TA 3L2QA 3ZCOA 3I4MJ 3OOPA 2JA2A 3M1CA 3WTYC 1YW9A 4C2MJ 2A5WA 1ETVA 2MW8A 2JUGA 3GFJA 2KIQA 1B1BA 2XAJA 1ACIA 2CV0A 4A3MJ 4KJZA 3JTGA 2VPRA 1BR4A 2HKOA 1JE8A 2VASA 2F48A 3BR0A 4IO9F 5GAHJ 2L9RA 3K4CA 2EFPA 3L2UA 3R6SA 2XASA 3NWTA 4WXCA 2M2EA 3KP5A 3CDIA 5HDGA 3OL4A 4EJUA 1EA3A 4XLEA 4E4HA 4IL6C 1RESA 4RA2A 3EYYA 3T1BA 2JQ7A 4KT6A 4UUVA 4BUPA 1IRXA 3JAMK 3ABMH 2LP0A 1ZQ3P 1B9NA 2DK8A 2NVTJ 4U7BA 1QNTA 5F0FA 2K9MA 2QQ9A 1ETXA 3VSKA 3VYTB 3J7ZI 1WH5A 2VOOA 1U5TA 1PVEA 2XVCA 2H94A 2CQ7A 2NVYJ 4M6VA 2MFZA 3I3LA 1E3HA 3DTIA 2KJCA 3GFLA 2COMA 4WCGA 1HQCA 5JLWA 3DV8A 3RI4A 1FT9A 4NC6A 1JTXA 1YQAA 3KP6A 1ZRDA 2HXOA 2R93J 1NG6A 1XCVA 3C3WA 1JJ8C 1YTYA 2NVUB 1VF9A 5L3CA 3Q0UA 3ZMDA 3HIFA 3H92A 4PFOA 5F1RA 2L7KA 4EVIA 2LR8A 1BI1A 1FP2A 2DODA 2ZMEA 2L54A 3HPGA 1YG2A 1MW7A 3RCOA 4RGSA 1K78B 1BOBA 4YFNF 4QWQA 1FTZA 1R36A 3BG6A 1P92A 1FMWA 2R5ZA 3V7SA 2IW5A 4BYYA 2OZUA 1FIPA 3GVAA 3LA2A 4HF2A 2VJJA 4CSWA 3I4PA 2Y0SN 4TV7A 2R7XA 1UAAA 2A05A 3BPXA 4C2UA 5F0HA 4UVBA 4A3DJ 3KIOA 1F1ZA 3CF5F 1K78A 3PSFA 1WJEA 2CV1A 4BH9A 4HNTA 3AL0B 2XC7A 3AL0C 3HJEA 1B4AA 1WFXA 2PI0A 5LEKA 2CJJA 3CJNA 3R0JA 1S3JA 3M4OJ 2ME6A 1TNTA 3BQYA 2UV1A 4CO8A 4HX4A 3HHGA 2ZJ2A 1IV8A 1EV7A 4NC8A 1IJWC 4Q48A 2K27A 1IXCA 3LSPA 3H5RA 1YJ9I 4PK4A 2VKVA 2QKMB 1WPKA 2XGDA 2FF4A 3GBGA 1UG0A 2E36A 5IYBJ 1SAXA 5D8LB 3SQNA 1CQTA 3HUGB 5LD2C 4YELA 4XIDA 2LY9A 2CYYA 3Q9VA 1ZKGA 4XQFA 3TO7A 2OUMA 3D0SA 4OIRF 3HSEA 1SFOJ 4HLXA 2V26A 4NC7A 4EQQA 2TCTA 2E2IJ 2Z16A 3QP5A 2HDDA 2E60A 3GFIA 4M71A 4ZYEA 3OYNA 1RETA 4HV6A 4RAZA 3FKIJ 2LBFA 1PUFB 1RI7A 3O3KA 5FB2A 1Q1VA 2MG4A 3J80Z 2H8RA 2ME0A 2DFHA 4BQQA 3OYLA 2H6CA 2P6TA 4DBQA 2GOMA 3GF2A 5HS8A 1W5CC 5D8KB 3VYRB 3C18A 1Y6IA 2M5WA 2ACJA 1LEAA 4GGGA 2ZSIB 1MJAA 2XF7A 3VB2A 3I55I 3FBIB 2ZJRF 2CUFA 2VKDA 4IZZA 1QPMA 4XRSA 3E7LA 4KICA 1PUFA 3EQLF 3FM3A 3QRFF 1VQ4I 5E3LA 2L4MA 3OMYA 2XAHA 1MMDA 2KZVA 1QZEA 1SD7A 2LTPA 1FBUA 4ZH4F 2NVQJ 9ANTA 4O5VA 3K9TA 3R0AA 2PMZN 3ESWB 2E2HJ 1R23A 1HC8A 2ZFWA 5IP7J 1WRJA 1T2KA 2BBYA 2LDUA 1Y39A 3WGGA 1KU9A 1AKHB 4M72A 1LVAA 2DBBA 4DBRA 3BC8A 2QCOA 5HNHA 2ZC2A 3RKWA 2J5PA 3HOTA 4AIJA 2G0EA 2HFHA 3CDLA 3BG5A 4GDFA 2V9KA 3KP2A 3DU6A 5K5OA 3GTPJ 3E6MA 3ZOBA 1OCZH 2JA5J 2JK3A 2QWWA 1IN7A 2WAEA 3BG9A 3MN2A 5DV5A 2ISZA 1TQIA 1YLFA 3R60A 3K69A 4XOTA 2W4SA 4N0BA 2FOKA 4ZZDA 2AS5F 3FXLA 5E18F 3DEUA 4ZDPA 4A3KJ 4BXUA 3A0BC 3ZMZA 4FASD 2NOGA 4QLCU 2RQQA 1HF0A 2LOOA 1F4KA 5IOYA 4C3HJ 1HKSA 1VQ9I 3RPUA 3UNGC 5K5RA 1WGXA 1BC7C 3L2WA 4XRMA 2K9QA 1J59A 5HNFA 2M7BA 2V4JC 2ADUA 3CUOA 2NOJB 1U5TC 2COBA 3I71A 3ML6A 4A93J 1X3ZB 1RR8C 1H9TA 2EIJH 5E3NA 1IAWA 2YU3A 4P96A 5ICGA 2PJPA 2M9HA 4X1EA 2XF5A 1T33A 1MBEA 1BIAA 4BBSJ 4AVPA 4GYGA 4BE1A 1ZARA 1OPCA 2O03A 4A5NA 1O3QA 4EV0A 3GTOJ 2GXBA 1YYVA 2A07F 4IOCF 3QYEA 2M0MA 1T95A 4LGWA 4M73A 3QYFA 2DMTA 1HW2A 1Y0NA 4IXAA 4KYWA 5K5QA 2AQFA 5FRMA 1FP1D 2BW3A 2CU7A 3CMMA 5GPAA 4PJNA 2CH0A 1SVOA 3GXOA 3MD2A 2IXSA 2XUBA 2KDZA 4QPOA 2C6YA 4OMZA 1PDNC 3KYLA 2K9SA 4MGRA 3E1SA 4K2EA 1GV5A 3U1KA 4F92B 2ZNYA 4E7KA 3TKYA 2Y0SA 4ZZLA 2H8WA 4D7NA 1W7PA 5DD4A 2PQ8A 3MZHA 3E3VA 2M87A 3U2RA 1WHUA 3ERED 4P1WA 3GTKJ 1DU0A 1SANA 1WCMJ 2R7TA 1JTYA 2FBKA 2VKHA 3PL8A 3BPVA 1MMSA 3MEXA 4RDUA 4JBAA 1O3TA 4M3BA 3HPHA 3TDZC 2XAUA 1ZLJA 2LY1A 2ID3A 1OCRH 1ORKA 5EEAA 3S3NA 4E70A 2A61A 2NNYA 3CD6I 1HDPA 4IVNA 4CYDA 1VQOI 1SD5A 2VOPA 2XIGA 5IP6A 4ANJA 2K5CA 4RM2A 5L3DA 1HDDC 1FYKA 4V19K 2UWMA 3MKWB 4AWXB 3TO9A 2KPMA 3CDHA 1QBJA 1G6NA 4LB6B 4R79A 1LB2A 2L7MP 4KA4A 4C2TA 2CS3A 4RB0A 1IGNA 4HDUA 1IV6A 1UG2A 5HOOA 4ENNA 1ERDA 1P4AA 2ETHA 1O57A 5ED4A 4BHPA 3TEDA 4P9UA 3SZGA 4EEFG 1WI3A 2E1MB 3HG9A 1WJFA 1I5ZA 3OS2A 2OD5A 3GTGJ 2BY0A 1D8KA 5DD8A 1XC5A 2P8TA 4OWRB 5L3FA 3RZOJ 1XS9A 1G8XA 2LBFB 2OF7A 3F9KA 2V9PA 3PUBA 2KIFA 1CGPA 1G3WA 5F6FA 4LIUA 1A6IA 5EG0A 1FEXA 1IUFA 2DQLA 1SMTA 4U0WA 3I9V2 3MQ0A 2M8GX 2EFNA 3L2CA 1FX7A 2ZB9A 3PQJA 4Q47A 1K6OA 3M8EA 1U0JA 1WQ2A 4IHWA 4Y15A 2O8XA 4BXFA 1I27A 3K70D 2R7DA 2Q8KA 4L5IA 4G8XA 2WAQN 2Y9YA 5CYVA 2V6EA 4UB6C 4A3JJ 1BM9A 1HXDA 5LHHA 4LG0A 3GW2A 2LG4A 3CTAA 3HB9A 5E1WA 5ILUA 4IRGA 3DFGA 3N05A 5JI6A 3M07A 1AKHA 3PO2J 1ULYA 3FKJA 4U87A 4CH7A 1UJ8A 2HVQA 1SFEA 3KFWX 2ECCA 3S14J 1FYLA 4X6AJ 4D1QA 1MD0A 2I10A 3HSRA 1QVTA 3GYHX 2HVSA 3WU0A 3ABTA 1HW1A 1OYYA 1IRZA 2QGUA 5B3SH 1Z9CA 3F72A 4MQ9F 3DBLB 5CPRB 4AU7A 4DNCA 1T6SA 3GUDA 3OIOA 1IRGA 2F5EA 2QSGX 4UUSB 3W2AA 1WWXA 3H3VK 1X58A 4BDYA 4Y17A 1J75A 3W6VA 2GWRA 1BL0A 4MFEA 3F8BA 3G6EI 1KQ8A 2VI6A 3DKXA 4KIGA 2F6CA 4HX7A 1GLNA 1V5GA 2Y31A 1NK3P 5H20A 3BR6A 3FHZA 3K4KA 2D2WA 1CF7B 4F93B 1XSXA 3BT9A 3HOVJ 1RZ4A 1HBXG 4ON0A 5FGMA 3EUHC 1F36A 5BNGA 5LRSA 2VJ5A 2AO9A 1KYWA 4H0EA 4AYBN 1LNWA 1Z21A 3FXMA 4J01A 2W25A 1FPQA 3G71I 3J7AY 5FLVA 5CVJA 2A6EF 1TP4A 3J7AO 5BS6A 3CCLI 1W7PB 1YHQI 2OQRA 1VFCA 3K4MA 2J5OA 4MQVA 4BJ5C 1D1BA 3OS1A 1SVMA 4M74A 4BNCA 4E6KG 3HOZJ 1XGSA 2FQ3A 2NNNA 4A5MA 3A01A 3DU5A 1J09A 1Y1VJ 3JRAA 1KGSA 1HSJA 4LK1F 3IUOA 2VQLA 2DOAA 5EZHA 5J8CA 2KDOA 2X9DA 5DCFA 1RKWA 2WY7Q 2ZKZA 1AA7A 3JRDA 4EGYA 5FD5A 3W2WA 2G7UA 2D5VA 3OR1C 2DCEA 1WVRA 2ZXJA 4LB5A 5D4SA 2CFOA 1O7LA 3ZP5A 1PUEE 2MA3A 2M3AA 3C7JA 4A6DA 2BE5F 4MEYF 2DA2A 3QQAA 3FXOA 3OY9A 2ZJQF 4XSZF 2JSCA 4M6XA 2Q2EA 4P5OA 2LREA 2QQ8A 1MH3A 3PM1A 1GV2A 1JI8A 4KISA 2Z5UA 1MBKA 5L3EA 2X48A 5KNLA 4NBQA 1ZR2A 1O3RA 2K3PA 3HZJA 1ETKA 3GZ6A 2IRFG 4RLQA 2LD5A 2P0WA 3SFZA 1N78A 2OU2A 3I5UA 4DYQA 4MTEA 3Q0VA 1QZZA 3UKGA 1UFMA 1RIOH 4L9JA 2O61A 3TW7A 3K70C 3HYIA 3PUFA 5H6QA 4ESBA 3BR3A 2JWTA 4XKCA 1NHAA 2LKXA 1BI3A 3A1YA 4Y3OA 1MIJA 4IRIA 2FXAA 2FMYA 3BJ6A 3EDPA 2NYXA 1U8BA 5IYCJ 3HOYJ 4DYRA 1AOYA 2Y69H 4XORA 2EA4A 1G3SA 1B8IB 2X51A 4UVCA 2N8GA 1G59A 4CGZA 3CJTB 1OMIA 3RPQA 4PJJA 1RR7A 2LF8A 1GUUA 2LKPA 3J81K 1HOMA 5BPIA 2X4HA 2OPTA 4I01A 1A31A 3MMYB 5EF6A 4KT5C 2EB7A 1KQ9A 1EJ9A 3KYDB 2DYSH 3RKQA 2EJRA 4B44A 1KZHA 2V79A 4KIFA 2EIKH 2WV0A 2DYRH 2Y9ZA 1JJ6C 4L9TA 2HPIA 4RAFA 5D4RA 3OV8A 4Q4ZF 4BS9A 1VQMI 4BHCA 2YU9J 1KU7A 3RYRA 1H0MA 2ZMEB 2Z1DA 3LAJA 2QEXI 3RQ4A 4OIOF 3MKZA 1MBJA 3D5LA 3E6DA 3JAMZ 2R7QA 4EJVA 3BROA 2CO5A 3DEWA 1E2XA 3W2VA 3O6BB 5JR3A 1IC8A 2DA4A 2CMPA 2DOFA 2EFWA 3I0TA 4B43A 4L5EA 3AG1H 1D0ZA 2ELJA 4AUXA 1V55H 3N4MA 4ENKA 5AIPA 1R71A 2IJLA 5DS9A 3LSHA 2FUG2 2KT0A 2GIZA 2ID6A 1LKXA 2XAGA 3IH2A 5IPAA 3CC2I 1EH8A 1T8IA 4RM3A 3OYCA 4IQ4A 3TP0A 4FHTA 3WG7H 4AIKA 1Q1HA 4DYCA 5LHGA 4OU0A 1BC8C 4HNVA 2Y30A 1D1CA 1RUNA 2WAQA 2F2EA 3HGGA 4LG0B 4EMSA 5F0CA 1Z7LA 3FXRA 1DQUA 1ZK8A 1TWFJ 1N77A 1FBSA 1H9GA 2X1CA 1U3EM 2DW4A 3HGYA 1LUJB 1W5SA 2XAQA 2KMUA 3I64A 2MD5A 2IVMA 3BTLA 1WI9A 5CKTA 4A3GJ 1V5EA 4UUTA 5CVIA 1O3SA 4AIHA 2PMHA 1Z67A 4IX7A 1LVKA 4DGWB 3M8JA 3S17J 4CCOA 2W84A 4UNOA 2WB1A 2DDAA 2ICWG 4V2GA 3RYPA 2WV1A 5B1AH 4MIMA 5C4XJ 1FZPB 5BPDA 4HSRA 2MBFA 3AG4H 1T0FA 1JUPA 3ZMTA 4BY7J 2HTSA 3FDYA 5DM7F 2EZLA 3RJPA 3VODA 3BTCA 3KZYA 1Y8RB 4ZC3A 4GFBA 2BOLA 4A69C 3BTIA 1H88C 2ELHA 5FROA 3DQVC 2VT3A 3ZQFA 1S6LA 1RNLA 3H0DA 2EQRA 4N4OB 2HYJA 2IBDA 4NQWB 1T98A 1MZBA 1VQ5I 5HS7A 1ETWA 3ZN1A 2ZBKA 3JR9A 2QM3A 2EH3A 1TW2A 2PEXA 4V2FA 1ZRFA 3KEOA 1BI2A 2VONA 1VQKI 4IQJA 1A35A 3SZTA 3MKYB 3HC7A 4IEJA 1O7FA 5JFRA 4LMYA 2OC6A 3HBLA 4A0ZA 2YX7A 3H3UA 1DUXC 3ERMA 5B1BH 2WA0A 2VLAA 4G7OF 3OWTA 3JCUC 4PUSA 3P9IA 5F08A 5F27A 2PLYA 3AFHA 3BP8A 3W6JB 2IS2A 3K4LA 5DUKA 1DPRA 1TQPA 3IL2A 3F3XA 4ESJA 2OZ6A 4ZYDA 2CV2A 1UHWA 2FBIA 2R5YB 3H36A 1XX5A 3CCMI 5TJJA 2XROA 3PIPF 3LOCA 4RGUA 1RPWA 1UB9A 4CCLA 1ZR4A 2Q0OA 1Z6RA 3OYFA 1ON1A 2QENA 1JKRC 2IT0A 2B63J 3BQZA 3K10A 3I56I 3IH3A 4KN4X 2V1NA 3SFIA 4AM3A 3FMQA 3PFYA 2HEOA 2DMNA 4EGZA 2EPFA 1MJ9A 3AKZA 1I1GA 4F3QA 2MH9A 2DPUA 1IXSB 4B4CA 1QPIA 5FRNA 5DYMA 5J1YA 5M5YJ 1F43A 1XDUA 4R8HA 4BE0A 4LIVA 4XOPA 3LMMA 2M8EA 2XV4S 3OL3A 3LSMA 1Z91A 3CUQC 4EATA 1LPQA 1IDYA 1JT6A 5HDKA 2JN6A 1B8IA 1QHHD 2BXYA 2LKSA 5EGOA 4BQAA 3GEZA 4I76A 4CCMA 3FHNA 4HYEA 1KYZA 2G7HA 2R4GA 5H2FC 2JJ7A 4KUMA 3WGHA 4BHBA 3QAHA 2V1XA 3F22A 1K83J 2YR2A 3J81Z 3JW4A 3VYSB 1XSDA 2G9WA 3PNTA 2P5LC 3N97A 1TBXA 3W3CA 3E6BA 3H5AA 1PP7U 3SJMA 4WF2A 1X4OA 3HKZA 4CCKA 4RB1A 3SDBA 5K7HA 1BIBA 1SD4A 4LD5A 2VXDA 5J47A 1IDZA 2Z9OA 1NK2P 1V3FA 4PJLA 1WJBA 4II3A 5EYRA 3EPZA 2F5CA 3S2WA 1IRFA 4LOCA 5D5VB 3WHCA 1LFPA 1J9IA 2KJBA 4R1HA 4J00A 2I8DA 3BG3A 1A5JA 4BQOA 4G6TB 5FFZA 4DZPA 2B0LA 3K4BA 1OJLA 3JRHA 2O6GE 5L3BA 3VYUB 3WTWC 3B02A 4Z2YA 3E5XA 2EV0A 5AONA 3D5SC 1FBQA 3H0GJ 1ZN2A 5DCMB 1A6QA 4A0XA 1MNMC 1LFUP 1PJRA 1Z7UA 5LFAA 5ICEA 5J1RA 3PO3J 4B47A 3FF5A 1OYIA 2Q2EB 4ZYGA 1KA8A 2IA2A 2BV6A 2P6SA 3I53A 1P9QC 2MD0A 2K3FA 4XICA 4OOIA 4M3FA 4HNUA 1Z77A 3H9GA 2BVMA 5D5XB 4ZYHA 3DEEA 4S05A 1YW8A 5FLMJ 2WWYA 2X6YA 5KAIC 1ZYRF 5E3MA 4YIIA 3MZYA 1JGGA 1IN6A 2AHQA 1SMYF 2HI3A 4CA0A 1JUSA 3SYTA 3TL4X 2DT6A 2Q1ZB 4GXOA 4XN3A 2XKOA 4PCQA 4Y4RA 2CW0F 4FX0A 4HV5A 2ECBA 3BZ6A 3S16J 4GCVA 1JUMA 5CVVA 5K7ZA 2ISYA 4GYIA 4RBOA 3LQQA 2JRTA 2DOEA 1VQLI 1U2WA 2EZKA 2NS8A 1SFXA 1X1AA 2OA4A 3CZ6A 1GXQA 4BEHA 2D1HA 2RQPA 3C2GA 5EJCA 3OYAA 3LSKA 3QPTA 3ZR8X 3LSGA 2CQXA 1MBHA 3M1EA 2L4AA 5JHFA 2DTRA 1MSEC 2RAEA 2IGOA 4DQ2A 1D0YA 1XG1A 2VN2A 4PJMA 3DCFA 1I39A 5TISC 4A0YA 1UZCA 4E7ZA 4IHVA 4L5JA 2HOEA 3S1QJ 2M7AA 3FMRA 2VQGA 3OYKA 1QO0D 2HZDA 4BEHB 4HBLA 4NDLA 1HA8A 1KONA 2E5ZA 2IGNA 4P55A 1S7OA 1APLC 2VODA 1DGRM 4XLFA 5F04A 3G73A 2IS1A 2VB6A 1AWCA 1X1BA 5J6XA 5ILSA 1T39A 2GQQA 1J0RA 4M3EA 5E20A 3CCUI 4XN0A 3SEQA 4GO1A 5CVRA 3D5RC 4DW6A 2CQQA 4A3EJ 4B3AA 3TOBA 2HWVA 3HHHA 4I7HA 3CUQB 1QA6A 3O2PE 3ZQCA 1YO5C 2R7OA 1XSVA 3W6KB 2EBIA 4A3FJ 2GZWA 3LSJA 2H6BA 2ZCWA 2VC1A 2LVSA 2O7OA 2CFXA 1ZAOA 4G6DA 1GDTA 4UXNA 3CO6C 3E0JB 2A3SA 2BY3A 1LDJA 3GX4X 3KP3A 1TWCJ 3MAJA 3S1NJ 1IUYA 2L9VA 3CC7I 1YOVB 3EETA 2HQRA 2A69F 4L0YB 2L2OA 2EIMH 3QOPA 5IOZA 3A2KA 1LDKB 1LQ1A 3F23A 5FKKA 1OR7C 4PSWA 4CCNA 1FOYA 1XMAA 4XRFA 3ZGKA 3CQZJ 2KP6A 2KRHA 4BU2A 2P81A 2RN7A 2X0LA 3OIPA 1X3UA 4AYBA 2V9VA 1USTA 5DUIA 5FKNA 4MTDA 1RC9A 3QPSA 3SZPA 1SAUA 2H1KA 1T38A 4KNYA 1V5FA 3RIRA 2Z2SB 2BHZA 3QWLA 1MGTA 4WX9A 1TT0A 2P7VB 2E1OA 3ASNH 3V8KA 3A01B 5D6FA 5J3LA 1P2FA 2R7UA 3QODA 4CZCA 3CCSI 1U9OA 2P4WA 3F8CA 2MC4A 2DI3A 3A02A 5B5EC 2IGMA 4DZJA 1MMNA 4D5CA 1W0UA 1W36C 3U1DA 5C4JJ 2EV5A 1ON2A 2DJNA 1HKQA 1UCRA 2MSYA 3WTSC 3WTUC 3PQKA 1MMAA 5FO5A 2UXNA 3GTMJ 3DTKA 3DPLC 4A3IJ 1L0OC 1MBFA 2TRTA 1VZ0A 2WY8Q 3FX3A 5ILVA 1UHSA 1XMXA 2LFBA 2QQAA 1ZGWA 4ZTJA 1JHFA 5GAGJ 2EFQA 4P9FA 2FX0A 3G1OA 2LF7A 3MFKA 1CF7A 5HVQC 1S7AA 4IHXA 3ONQA 1PP8F 4DIQA 3JRBA 4BL0B 1B72B 1UMQA 1MNDA 3K2AA 4LG3A 2ESHA 2A5YB 4II2A 2IS4A 2R7SA 2D45A 2H1LA 4E7HA 5DEQA 2PBIA 3JSOA 2RNJA 3KEQA 2LMDA 5FFXA 1A04A 1FLIA 3ZQIA 2JTVA 1ZG5A 2HYFA 2NAZA 5FLXZ 1L3LA 4KIBA 1B72A 1IN5A 1USSA 1OLTA 4X0GA 4JYKA 1VTNC 2HU9A 3L7WA 2CUEA 2WC2A 2STTA 3I58A 1EKEA 1H8AC 2A68F 3S8PA 4B8XA 2TDXA 2VPLA 4FX4A 3LNQA 1BBYA 2QYOA 3IAS2 3H5NA 1R1VA 2DFIA 2CSOA 2PMUA 3S15J 3WTZA 2JA8J 5DTDA 3K7AJ 4ENMA 3OSGA 3T8RA 4ABZA 4ZJZA 1P4WA 1S8NA 5KK1A 2HDCA 1MNEA 4I02A 3CMYA 1TQMA 1TLHB 2CW8A 1TW3A 2WADA 4PGHA 2QSHX 2DA7A 2WTEA 4YFKF 1E17A 5H6RA 4G7HF 4HA8A 1TNSA 2IEKA 3FIWA 3HL2A 2FOWA 2KISA 3IAM2 1POGA 2VC0A 2W82A 4A3BJ 3P9KA 4MNUA 1I1SA 1SEUA 2GAUA 2JUCA 3NQOA 2BVLA 2XAFA 4LFUA 2VBYA 1TWAJ 1T0FC 2QZ8A 3QU6A 4RMNA 3QU3A 3HOXJ 3RPUD 4BDZA 4D9JA 1OCTC 1R5HA 3KPHA 4N9IA 2AXLA 4L0ZB 2GA2A 1ZTRA 2DA3A 3E5UA 3V7CA 2MH2A 1VNDA 4B1RA 3CLQA 3KLNA 2IGKA 4I2OA 1J2XA 1YIJI 2ZXIA 2DMUA 3G1LA 4H4KC 5CJ9A 1N25A 3KYCB 2P5VA 5DDGA 2CQNA 5JLXA 1R4MB 2L9SA 3ABUA 1IG7A 1I50J 3LFUA 1XTAA 2HVRA 3H3ZA 5EG0B 3BR1A 1VI0A 4RS8A 5BQTA 2M0CA 4EJTA 3V7RA 3RTRA 3X2QH 3GTQJ 4BACA 2PN6A 2Z99A 1RUOA 1ETYA 1XPXA 2MGQA 2ZJPF 3QYBA 4I0BA 2M45A 3DBHB 3A03A 1E3OC 3OYGA 3HRMA 3BLYA 3I54A 5GPCA 3EUAA 1F9NA 2AQEA 1QHGA 4IHYA 3GTLJ 1DGWY 2V1UA 1B59A 2CGPA 1R1UA 3ROUA 1YRNB 4QIWN 1YS6A 3ABLH 4B48A 2WB1N 1S5LC 4IKFA 2EZIA 5GP9A 2FD5A 3KP7A 5LHIA 3IHUA 3AAFA 3COAC 1YFHA 4U88A 3AG2H 2MLKA 4G6QA 1U6GA 4NUBA 4HW0A 2DFEA 4A2UA 2EFOA 2QLZA 3RSNA 2EILH 2IPQX 5A2QK 4XONA 1OR7A 2VKEA 3VSLA 4KMFA 5J1UA 1W7PD 5GTIC 4XLAA 3EUKL 2F5DA 4UB8C 1T08B 2F5VA 4HZFA 4CDGA 1SD6A 1QU3A 3BTJA 1Z1DA 3BOQA 4FISA 4CYCA 1I6HJ 1M1EB 1OFCX 3K1PA 1WZ2A 1WJAA 5GADJ 3F6VA 4PDKA 4NHJA 1D0XA 3L1PA 5KVRA 2PX9A 2OCCH 4EM0B 1K7AA 1WJDA 4FE7A 3R4KA 4IHSA 2W7NA 3MCZA 1VQ6I 3VOEA 1XGNA 4XSXF 1HSTA 2RDPA 2RVCA 3F8NA 3ECOA 4NB5A 1QZYA 3VWBA 5C44J 5LLQA 2CUJA 1XCBA 1JKPC 4OMYA 1NG7A 1JGSA 5FJ8J 1QQIA 2ZSHB 3BJAA 3K6GA 1N75A 4N9HA 1TT5B 1T56A 4PSXA 2BHYA 1MKMA 2JVHA 1FC3A 3OYHA 2HOSA 1YIOA 2L7FP 2UZKA 4CYCB 3ZMSA 5HLTA 4A6EA 3OYJA 3CCRI 3ZPLA 1ZGJA 4AIDA 3TGNA 3F6OA 3FXKA 3SEZA 2MC3A 4MLOA 3T5XA 3MWMA 2W57A 3OYMA 5IP9J 2DA1A 3LL7A 4XR6A 3HEFA 4MEXF 2QBYB 4YG2F 4PZJA 3BDDA 5DM6F 1TWHJ 4UV9A 3A4CA 3REOA 2HKXA 1U5TB 1IN8A 4XLCA 4CXFA 4BY1J 2PG4A 3NEUA 2K7LA 2F4MB 1IF1A 2L3DA 3WU2C 1OCPA 2HQNA 3F0CA 2LYCA 4N4NB 3FZVA 3FM5A 3HM5A 3DLLF 5EGOB 3U9GA 5E1ZB 2IA1A 1P7IA 2B9SA 4ESFA 2DJIA 5KCMA 2W48A 1G3YA 3S3OA 1I6XA 4A3CJ 2V1DA 4QPQA 3DKWA 5FKLA 4HPQA 3HSFA 1X1DA 3H1CA 2VIXA 3WTTC 4RGRA 1K6YA 2X6XA 3NAUA 4LITA 3FISA 3P7NA 4HQEA 3ZQHA 2E7WA 1BR2A 4FQGA 2CG4A 5ICCA 3FBNB 2FQ4A 3KEYA 3D1NI 2XDVA 3HKZN 1MDMA 2R0QC 5D5UB 2K40A 1VQ7I 1X19A 4I99C 4L9VA 4BGDA 2VUMJ 2FJ1A 2DT7B 5C3EJ 1E3PA 5HLIA 2OTLI 5KAFC 1MSFC 2NXNB 1Z0XA 3KX2A 2VBWA 3GZ5A 3M9AA 5AIQA 2O5RA 3PNYA 1JHHA 1S7EA 3WODF 1YX5A 5IT9K 3M3YJ 2VL8A 1W4MA 1IN4A 5CQGA 3O8HA 4F91B 5J4YA 2E1MC 2ZXWH 2HS5A 5M3MJ 4Z6YA 2MABA 2X1DA 4LJZF 4M6YA 3RKYA 3IKTA 2GIVA 5JVGF 2KRFA 1EF4A 3B6AA 1QRYA 2UXXA 3K4JA 4HX8A 3VEPA 1E0EA 3BJOA 1D8JA 4IJAA 2Y75A 2E19A 3FXJA 4ASNA 1ZLKA 2X6WA 1D5YA 4BJ6C 5E17F 2FU4A 1R58A 3CP2A 3K1MA 3V8LA 3GTJJ 4CCJA 3FXUA 3DTEA 1Y1WJ 5F1JA 4EM2A 1LE8B 2O9LA 1K4SA 1BR1A 3HXLA 3RZDJ 2W1OA 4HQMA 1YI2I 1K79A 3TQNA 3BZKA 2KIMA 5M5WJ 2DLLA 3TDUC 2K85A 1U9NA 2VXZA 4RGXA 4JOMA 1XMKA 2NRAC 4RB2C 2DTZA 2RNGA 1GVDA 2OV7A 4Q5SF 4EM1A 4IRHA 1D3YA 2E2JJ 1WH7A 2LSOA 2L7ZA 3BWGA 2QQBA 4AVZA 3L9FA 4EJOA 5FKMA 2K9LA 2K4BA 4OINF 4PJ0C 3OYDA 4O3MA 1WKMA 1BW5A 2KRCA 5HLHA 1FSEA 3RKXA 1B6AA 4C3IJ 2R7ZJ 3WGIA 1DDNA 4RB3C 4L9NA 4BKXA 2M34A 3ZN0A 2XHKA 4I6ZA 3K4NA 3KCCA 1OQYA 1ZELA 4FT8A 3LSRA 2X6OA 2GBYA 2L0KA 3OS0A 1TWGJ 3VFZA 4XNFA 1Z3YA 4NNJA 3IRRA 4XK4A 2K02A 3CLOA 2JPCA 2XSJC 3LWFA 4B3XA 3OYIA 2VQHA 3S2DJ 3TMOA 2KIUA 4ETSA 3F21A 3WHBA 5ICFA 2F4IA 2R7RA 2XKPA 4E7IA 4XKBA 3GO5A 3F8FA 3K2ZA 2KLOA 3FK6A 5LEJA 1O4XA 3SHFA 1LEBA 5F64A 3SDGA 3EYIA 3PJRA 1W5TA 2FEZA 3ULQB 4M3DA 2KQRA 1D1AA 2HOAA 1OCOH 2YUSA 4G94A 2FSWA 2HQAA 4E7JA 3ASOH 3OIQA 4HG2A 3CJRB 3TOAA 2IA0A 1FTTA 4RLFA 3DBRB 2E71A 1TL8A 3A0HC 3IWFA 2XGCA 1HW5A 3ZRGA 2D1VA 2EZHA 2ZXHA 3S2HJ 2PFBA 4MHGA 5GTHC 2DXIA 4ENJA 5LGTA 3ECHA 2VE9A 5ERIA 2LRDA 4LLGF 2QUFA 4JK1X 5HODA 4HF0A 2AXTC 5E1XA 1XD7A 2DK5A 3ISPA 2L01A 1G4DA 2QA4I 2HQ5A 3BG7A 2XSDC 1U8RA 3RQIA 3GWZA 3HUGA 1G2HA 3JREA 1RKTA 5LGNA 3Q9SA 1Z05A 4JX5A 4D0PA 4U0YA 3HRUA 1LFBA 4KN7X 4OIPF 2XB5A 5HS9A 5BOXA 3FWEA 1BJAA 1JKQC 2QF7A 3ZQ7A 4YFXF 3ZQLA 1NH3A 1FOXA 3DPUA 3S3MA 1EH6A 3LQRA 2LC2A 1ENHA 3KLOA 3CF2A 4XKWA 2RREA 1B9MA 1R4NB 4BE2A 3MZ8A 3H35A 5CLSA 2VJIA 5CVUA 1TC3C 2BGCA 3HRSA 4KDPA 3IP4B 1MJBA 4WXHA 3HOSA 3CMEI 3C2HA 4UV8A 3ZQGA 5B66C 5HDNA 2Y2ZA 5TGTA 1OCCH 1MDMB 4GRIA 3FMSA 1AU7A 4UY8I 3PFIA 3BZCA 4F55A 2LNBA 1X4PA 3HTSB 2FRHA 1ZGAA 1FIAA 4O6JA 3KZIC 4MO7A 2DMQA 4D5FA 1IO2A 1BW6A 2A6TA 2OQGA 3AG3H 5D5WB 1K61A 2FNAA 1P6RA 1R00A 4M9ZA 3L00A 1W0TA 2CUZA 2ZMEC 2XGEA 4DJAA 3QPHA 2DA5A 4JQFA 4CZZA 3C2BA 1FOWA 3DP7A 2KFDA 3OR2C 2CQKA 2BZTA 2VBZA 3QOEA 3IRQA 2VBXA 4BAYA 2M30A 4CICA 1ZREA 1V4RA 5L3GA 4U0VA 4XLNF 3TP3A 2FNPA 2I5UA 2W24A 2ELKA 2H27A 2K86A 1R9TJ 3L2RA 3WTXC 3IWZA 5M3FJ 4DOZA 5TRDA 4IHTA 3T8TA 2OCEA 1UHMA 1ZG1A 4LLLA 3GMEA 3HTUA 2KZGA 2X85A 3Q3SA 2BXZA 2P5KA 1P7JA 2HDWA 2R7VA 2XF6A 2R7FA 2DQRA 3ZMVA 3G4SI 3WE2A 5FKOA 2HR3A 1JT0A 3GZNB 4AC0A 2R5YA 3NRVA 2EA2A 1UELB 2UUZA 2CWEA 3LAPA 2HPMA 2JA7J 2DU9A 2HTJA 4M9XA 1JKOC 4MFDA 4RAGA 2PMZA 2M4GA 2HZTA 4XKVA 3CCJI 1G3TA 2X1EA 3Q0WA 4OAYA 1SVLA 3FXQA 4XM3A 5E8IA 2GLOA 1AHDP 4IF4A 2JZYA 3H9JA 1YJWI 3J7YJ 4D7MA 1HKTA 2XPUA 4WWCA 4F7ZA 3JRFA 4QSHA 3GCMA 2DMPA 2LH9A 3KP4A 3IV5A 2PJRA 4JX6A 3S1RJ 2ESNA 3PSIA 1ITYA
chains in the Genus database with same CATH topology
3OYEA 1S9HA 3S93A 3RTRA 3FDYA 4ZDLA 4YEJA 1X1CA 4XL9A 4BACA 4ZDOA 3OMYA 4ZTFA 1MMDA 2KZVA 3VDXA 4ZC3A 3QYBA 2BOLA 4Y33A 3UR3C 3OYGA 3L2VA 4XMYA 3BLYA 3EUAA 2AQEA 1QHGA 2R7WA 5FROA 1DGWY 3DQVC 1Y56A 3H0DA 4N4OB 4NQWB 4B48A 1WJCA 1R6RA 3PNVA 4IKFA 4DBRA 3BC8A 5HNHA 3HOTA 2V9KA 3DU6A 4F52A 4NUBA 2WAEA 3RSNA 4HSTA 4IQJA 4XONA 4XOTA 3VSLA 3MKYB 2W4SA 3HC7A 4XLAA 3EUKL 2OC6A 4XLHA 2F5VA 1QU3A 4ZDPA 2VJ4A 2WA0A 2VLAA 3OWTA 4FASD 4HRIA 4PUSA 3OYBA 2RQQA 3AFHA 4C9YA 1WJAA 2LOOA 2JSPA 2IS2A 1D0XA 3K4LA 3UNGC 2E5NA 3L2WA 2CV2A 1WJDA 4ITVA 5HNFA 2M7BA 2W7NA 2V4JC 2VQCA 2NOJB 1Z3XA 4CCLA 3OYFA 3LSIA 3U21A 3VWBA 2CUJA 2WAFA 1NG7A 3K10A 2ZSHB 3K6GA 4BJTA 3DKYA 4BQNA 1N75A 2V1NA 2XF5A 3PFYA 4PSXA 4E7LA 2JVHA 4YRVA 2GOXB 3AKZA 3OYHA 3TBIA 4F3QA 4BE1A 5HLTA 5FRNA 4PFPA 3OYJA 1DP3A 3OOUA 4BE0A 4LIVA 4XOPA 3SEZA 3QYEA 3LMMA 3OL3A 2M0MA 1T95A 2CW7A 4MLOA 3QYFA 3LSMA 4EATA 3OYMA 3CJQB 4XR6A 3LL7A 1QHHD 2AQFA 5FRMA 4CCMA 2BW3A 3FHNA 3CMMA 1WJ5A 2R4GA 4PJNA 2L9NA 2CH0A 3A4CA 3MD2A 2IXSA 4QPOA 4XLCA 3KYLA 3VYSB 3E1SA 3PNTA 2IS6A 3W3CA 4F92B 4E7KA 3H5AA 2Y0SA 3BCBA 2LYCA 4N4NB 1X4OA 3HKZA 4CCKA 4FETA 3SDBA 2PJRB 2VXDA 2DJIA 4P1WA 4PJLA 5KCMA 1WJBA 4II3A 4OAZA 3EPZA 4CUGA 3S3OA 2R7TA 1LFPA 2VKHA 3PL8A 4QPQA 4J00A 3HPHA 2I8DA 4HPQA 3ZXSA 1X1DA 4BQOA 2XAUA 2LY1A 2VIXA 4G6TB 3K4BA 1K6YA 2X6XA 3CESA 2KHMA 3VYUB 3S3NA 4ZYAA 4LITA 3D5SC 4ANJA 2K5CA 3DLAA 1BR2A 4RM2A 4HEA2 3DPTA 3H9QA 1PJRA 2UWMA 2HNHA 5LFAA 3DWLE 3FBNB 3MKWB 2KPMA 3KEYA 2XDVA 4B47A 2Q2EB 4R79A 1X19A 4C2TA 4BGDA 2CS3A 1P9QC 1PYVA 2MD0A 2DT7B 2MYSA 5HOOA 3KX2A 4HNUA 1ERDA 3H9GA 2BVMA 2O5RA 3PNYA 3SZGA 3DEEA 1YX5A 2VL8A 5CQGA 4F91B 2E1MC 2X6YA 2E1MB 1WJFA 3HG9A 3OS2A 4KITB 4CA0A 2MABA 2X1DA 3SYTA 3ZQQA 3TL4X 2DT6A 2Q1ZB 4OWRB 2BW3B 4XN3A 1G8XA 4Y4RA 3PUBA 3F9KA 2LBFB 1W36D 4LIUA 2L5QA 3K4JA 3V42A 1YE9A 1E0EA 3I9V2 2WBMA 1X1AA 1YX3A 1U0JA 2X6WA 4BJ6C 3CZ6A 5CQEA 4BXFA 4BEHA 3K70D 3C2GA 3OYAA 3CP2A 3LSKA 4CCJA 3ZR8X 1SFKA 3DTEA 3LSGA 5JHFA 2V6EA 1BR1A 2IGOA 3BCAA 3HXLA 2W1OA 1D0YA 2LG4A 4E7SA 4PJMA 3N05A 3FKJA 2KL4A 4U87A 4CH7A 2HVQA 4E7ZA 2M4KA 4D1QA 2M7AA 2VXZA 4JOMA 2VQGA 3OYKA 2HVSA 2HZDA 3S32A 4BEHB 1HA8A 1KONA 1FMVA 2E5ZA 2V7FA 2IGNA 2RNGA 5CPRB 2OV7A 4C30A 4AU7A 5KHDA 1DGRM 4XLFA 3W2AA 2IS1A 4AVZA 2VB6A 4BDYA 1X1BA 2ZFUA 3NWSA 2K9LA 3G2BA 3DKXA 3OYDA 2F6CA 1GLNA 1V5GA 2KRCA 4XN0A 3SEQA 2W00A 1TZLA 3D5RC 3K4KA 4F93B 3K4NA 1ZELA 3OS0A 3EUHC 2VJ5A 2LY2A 1Z3YA 3CP8A 4XNFA 2QKLB 1MMGA 4NNJA 2R7OA 2JVGA 1Z21A 2XSJC 4J01A 4B3XA 3OYIA 2VQHA 3TMOA 3J7AY 3L2QA 3ZCOA 2F4IA 2JA2A 2R7RA 3M1CA 4E7IA 4XKBA 2A5WA 3K4MA 2KLOA 2JUGA 2CV0A 3E0JB 4BJ5C 1D1BA 3OS1A 4E6KG 3PJRA 4KJZA 1BR4A 3DU5A 1J09A 2KQRA 1D1AA 2VASA 2HQAA 3IUOA 2VQLA 4E7JA 3K4CA 3L2UA 3OIQA 4HG2A 2DOAA 3CJRB 2L2OA 3A2KA 4RLFA 2KDOA 1LDKB 3NWTA 2WY7Q 1AA7A 1OR7C 3W2WA 4PSWA 4CCNA 3ZGKA 3OR1C 2DCEA 3OL4A 3ZRGA 2KP6A 1EA3A 2KRHA 2ZXHA 4XLEA 4E4HA 4BU2A 2DXIA 2CFOA 4AYBA 3OIPA 2LRDA 2M3AA 1SAUA 1V5FA 2Z2SB 4KT6A 4BUPA 3OY9A 1IRXA 1TT0A 3BG7A 4U7BA 2R7UA 4P5OA 2LREA 3VSKA 2K9MA 3QODA 4CZCA 3VYTB 1JI8A 2MC4A 4KISA 2IGMA 1MMNA 1W36C 5KNLA 2MFZA 2K3PA 3I3LA 3DTIA 4RLQA 2P0WA 1N78A 3DPUA 1MMAA 3S3MA 2LC2A 3DTKA 3DPLC 1NG6A 3CF2A 4XKWA 1VZ0A 2RREA 2WY8Q 3K70C 4BE2A 4PFOA 4XKCA 4ZTJA 2L7KA 3A1YA 3H35A 4Y3OA 2VJIA 5HVQC 3IP4B 3HPGA 3RCOA 1MW7A 3ONQA 3HOSA 1BOBA 4XORA 4BL0B 4DIQA 3C2HA 2X51A 3BG6A 1G59A 1MNDA 4LG3A 1FMWA 5TGTA 4II2A 4PJJA 2IS4A 4GRIA 2R7SA 4F55A 1X4PA 2VJJA 4E7HA 3MMYB 4CSWA 2R7XA 1UAAA 4B44A 4C2UA 2A6TA 2HPIA 4BS9A 3PSFA 1OLTA 1WJEA 4X0GA 2CV1A 4HNTA 2Z1DA 2HU9A 2CUZA 2XC7A 3AL0B 3AL0C 3RQ4A 1WFXA 4DJAA 3MKZA 3D5LA 4JQFA 2R7QA 3S8PA 3OR2C 3W2VA 2UV1A 2VPLA 3IAS2 3QOEA 3H5NA 2CMPA 4NC8A 4B43A 1D0ZA 2ELJA 4ZJZA 3H5RA 4PK4A 1MNEA 3LSHA 2FUG2 2QKMB 1LKXA 2CW8A 2WADA 4RM3A 3GBGA 3OYCA 1UG0A 4IQ4A 3L2RA 4DOZA 3HUGB 5LD2C 4YELA 3HL2A 3IAM2 2X85A 4XQFA 2W82A 2OUMA 1D1CA 2BVLA 2HDWA 2WAQA 2R7VA 2XF6A 2V26A 4NC7A 1T0FC 2Z16A 1Z7LA 1DQUA 2E60A 4RMNA 1N77A 2X1CA 3OYNA 1UELB 3RPUD 4BDZA 4D9JA 2UUZA 2LBFA 2KMUA 2HPMA 5CKTA 1V5EA 2PMZA 2M4GA 4XKVA 4BQQA 2X1EA 4OAYA 2IGKA 3OYLA 4XM3A 4IX7A 2ZXIA 4DBQA 1LVKA 2GOMA 3H9JA 3M8JA 4DGWB 4H4KC 4CCOA 2WB1A 3VYRB 1Y6IA 2L9SA 2ZSIB 3LFUA 2XF7A 2LH9A 4HSRA 2HVRA 2PJRA 3FBIB 2VKDA 4IZZA 3PSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2B A; 
#chains in the Genus database with same CATH topology
 2F4O B;  2YPR A;  3OYE A;  1S9H A;  3S93 A;  4A3L J;  3KET A;  4ZDL A;  4YEJ A;  2BEO A;  1X1C A;  3GFM A;  4XL9 A;  4ZDO A;  2DT5 A;  4ZTF A;  2E35 A;  3VDX A;  1OIS A;  3EUH A;  4Y33 A;  3UR3 C;  1MBG A;  1X2N A;  2HGC A;  4XMY A;  3L2V A;  2R7W A;  1SC7 A;  1NTC A;  3Q5F A;  2JT1 A;  1Y56 A;  3E6C C;  1IW7 F;  3HOU J;  2YSR A;  2BYV E;  1WJC A;  1R6R A;  3PNV A;  3GLX A;  1D5V A;  1Y0U A;  1A36 A;  3JRG A;  4YIF A;  5IT9 Z;  3WE3 A;  4F52 A;  1BJZ A;  1GT0 C;  2JMW A;  3E5Q A;  4HST A;  2R5Z B;  2NVX J;  1VQN I;  4JP0 A;  3BY6 A;  1VQ8 I;  1SFU A;  2E7X A;  1YIT I;  2DDB A;  3C1D A;  2O0Y A;  4XLH A;  2HXI A;  3QPL A;  2VJ4 A;  1GVJ A;  1S72 I;  1XN7 A;  4HRI A;  3BR5 A;  3CCQ I;  4HOB A;  1KU3 A;  3OYB A;  2MLG A;  2GXG A;  4KFC A;  4C9Y A;  5IY5 H;  2FBH A;  5GAE J;  3CCE I;  1YRN A;  2JSP A;  1BI0 A;  1OYW A;  1LDD A;  2LLK A;  4Y52 J;  2E5N A;  3ZMU A;  4HF1 A;  1R7J A;  1DU6 A;  1RRJ A;  4ITV A;  5J4V A;  4YIR X;  2JA6 J;  2VQC A;  3FK7 A;  5EEH A;  3TO6 A;  3JRC A;  4IPA A;  1Z3X A;  4B09 A;  2P7C B;  1XGM A;  2Z33 A;  1W1W E;  2IP2 A;  3LSI A;  3U21 A;  1ZHF A;  4UHT A;  2RKH A;  1LE8 A;  2OTJ I;  4L18 B;  2WAF A;  3CCY A;  3QP6 A;  1FJL A;  1TTY A;  2XRL A;  2VT2 A;  4BJT A;  3DKY A;  4BQN A;  3CMA I;  1WSU A;  3V4G A;  5HLG A;  3F8M A;  2XB0 X;  4E7L A;  1YS7 A;  4G7Z F;  2GM4 A;  4YRV A;  3MKL A;  2GOX B;  1X2M A;  5JVT A;  2A6H F;  3TBI A;  1ZRC A;  2F5F A;  5EDN A;  3CO7 C;  2BY2 A;  4M9S A;  2XPV A;  4PFP A;  4S04 A;  2FE3 A;  2STW A;  1DP3 A;  3OOU A;  3NAR A;  3V8J A;  4EJW A;  5BMZ A;  3P9C A;  2W85 A;  2CW7 A;  1ETO A;  3OSF A;  3DF8 A;  3GLL A;  1QGP A;  2EV6 A;  4S0H B;  4AD9 A;  3CJQ B;  3IKV A;  3I59 B;  4LK0 F;  1DP7 P;  2Y0M A;  3IC7 A;  3M8F A;  4M3G A;  3BR2 A;  4J19 A;  3O8G A;  4XLP F;  1S29 A;  2DFF A;  1WJ5 A;  3K0L A;  3VPR A;  2L9N A;  2DPD A;  2K4J A;  1I3A A;  2XGX A;  3P5J A;  1J7K A;  4QTR A;  4WK8 F;  4NQW A;  2L02 A;  2R92 J;  1STZ A;  1BA5 A;  1ZH5 A;  2IS6 A;  5JHU A;  5M5X J;  3I4N J;  5EEG A;  3G3Z A;  3CCV I;  3BCB A;  2QVO A;  4W1U A;  3IH4 A;  3TW6 A;  4BBR J;  1ONV A;  5IYD J;  3CC4 I;  3T0Y A;  4HLY A;  4FET A;  3I59 A;  4HDV A;  2HYG D;  2PJR B;  3WU1 B;  3L09 A;  5K1Y A;  1MH4 A;  2H09 A;  3G1M A;  2GA1 A;  4OAZ A;  1YJN I;  4CUG A;  1FYM A;  2QBY A;  3ELK A;  4BXX J;  2DA6 A;  1F5T A;  2B7E A;  1R5G A;  1REP C;  2FML A;  1I3Q J;  2K9N A;  4HAM A;  2XRN A;  3WTV C;  3ZXS A;  4FCY A;  1JXS A;  3JTH A;  1IXR C;  4W97 A;  5J40 A;  3CES A;  2KHM A;  5D6E A;  1DPU A;  4ZYA A;  1LJ9 A;  1J5Y A;  3J80 K;  2BY1 A;  3DLA A;  2ZNZ A;  2Y48 A;  4HEA 2;  3DPT A;  3H9Q A;  2OBP A;  2HNH A;  3LA3 A;  3DWL E;  3M7G A;  2OJE D;  2JRM A;  1C0W A;  4PGG A;  5LBQ A;  3S1M J;  1BN5 A;  2V6C A;  4OIQ F;  1XDS A;  2NS7 A;  2KKO A;  1FWZ A;  3HOW J;  1PYV A;  4JX4 A;  1X1P A;  1ODD A;  2MYS A;  5J8F A;  4FE4 A;  1ZG3 A;  5FD6 A;  3B73 A;  4I98 B;  3PIO F;  3KZZ A;  1ETQ A;  3CUQ A;  1R1T A;  4G12 A;  4FTH A;  4CHU A;  3LST A;  4IOA F;  2EK5 A;  4KIT B;  2DO7 A;  1R49 A;  2XPW A;  4UVA A;  3ZQQ A;  1EH7 A;  2VE8 A;  2GXA A;  2BW3 B;  1GHC A;  1QVU A;  2ZO4 A;  1H89 C;  1FNN A;  1W36 D;  5E8G A;  2L5Q A;  3V42 A;  1YW7 A;  1YE9 A;  1FOK A;  6PAX A;  2R3S A;  2E1C A;  1KU2 A;  4I09 A;  3RDI A;  2WBM A;  1HLV A;  3E97 A;  3B6C A;  5LRR A;  3JRI A;  2IAI A;  2M1B A;  4A12 A;  1U78 A;  1YX3 A;  2HOT A;  2JPB A;  4LLN A;  2OAZ A;  5CQE A;  4U7D A;  5IT3 A;  5LGU A;  2RV8 A;  3HRT A;  3LFK A;  4RAY A;  1XGO A;  3R61 A;  2E34 A;  1BOA A;  1IZ1 A;  1SFK A;  4Y7N J;  5K7F A;  1K4T A;  3BCA A;  3LA7 A;  4E7S A;  4UUS A;  2E1N A;  2KL4 A;  2RC4 A;  4Y13 A;  1P4X A;  2EWN A;  2YS9 A;  1R5I D;  2CRG A;  2M4K A;  5EZG A;  3S32 A;  4XBF A;  5FLX K;  1FMV A;  2V7F A;  3ABK H;  4C30 A;  1X3W B;  5KHD A;  3K1N A;  3MVP A;  5DCM A;  1FY7 A;  1GXP A;  2LK2 A;  4WXD A;  4I0A A;  2O8K A;  2QSF X;  5A2Q Z;  2RGV A;  2ZFU A;  3NWS A;  2DAO A;  3HDD A;  3G2B A;  5E3O A;  1R22 A;  3WG9 A;  3DXJ F;  1FSH A;  2DN0 A;  2Z3Y A;  4G9Y A;  1HCR A;  2W00 A;  1TZL A;  2NS0 A;  4C3J J;  2O3F A;  1KQ0 A;  1VQP I;  4XRS G;  1OKR A;  1V54 H;  5E79 C;  3JSP A;  3SXY A;  3CP8 A;  2LY2 A;  2YX4 A;  3KE2 A;  4KMU X;  1XB4 A;  2QKL B;  1MMG A;  2EIN H;  2JVG A;  2FA5 A;  1Y8Q B;  1Z6T A;  3L2Q A;  3ZCO A;  3I4M J;  3OOP A;  2JA2 A;  3M1C A;  3WTY C;  1YW9 A;  4C2M J;  2A5W A;  1ETV A;  2MW8 A;  2JUG A;  3GFJ A;  2KIQ A;  1B1B A;  2XAJ A;  1ACI A;  2CV0 A;  4A3M J;  4KJZ A;  3JTG A;  2VPR A;  1BR4 A;  2HKO A;  1JE8 A;  2VAS A;  2F48 A;  3BR0 A;  4IO9 F;  5GAH J;  2L9R A;  3K4C A;  2EFP A;  3L2U A;  3R6S A;  2XAS A;  3NWT A;  4WXC A;  2M2E A;  3KP5 A;  3CDI A;  5HDG A;  3OL4 A;  4EJU A;  1EA3 A;  4XLE A;  4E4H A;  4IL6 C;  1RES A;  4RA2 A;  3EYY A;  3T1B A;  2JQ7 A;  4KT6 A;  4UUV A;  4BUP A;  1IRX A;  3JAM K;  3ABM H;  2LP0 A;  1ZQ3 P;  1B9N A;  2DK8 A;  2NVT J;  4U7B A;  1QNT A;  5F0F A;  2K9M A;  2QQ9 A;  1ETX A;  3VSK A;  3VYT B;  3J7Z I;  1WH5 A;  2VOO A;  1U5T A;  1PVE A;  2XVC A;  2H94 A;  2CQ7 A;  2NVY J;  4M6V A;  2MFZ A;  3I3L A;  1E3H A;  3DTI A;  2KJC A;  3GFL A;  2COM A;  4WCG A;  1HQC A;  5JLW A;  3DV8 A;  3RI4 A;  1FT9 A;  4NC6 A;  1JTX A;  1YQA A;  3KP6 A;  1ZRD A;  2HXO A;  2R93 J;  1NG6 A;  1XCV A;  3C3W A;  1JJ8 C;  1YTY A;  2NVU B;  1VF9 A;  5L3C A;  3Q0U A;  3ZMD A;  3HIF A;  3H92 A;  4PFO A;  5F1R A;  2L7K A;  4EVI A;  2LR8 A;  1BI1 A;  1FP2 A;  2DOD A;  2ZME A;  2L54 A;  3HPG A;  1YG2 A;  1MW7 A;  3RCO A;  4RGS A;  1K78 B;  1BOB A;  4YFN F;  4QWQ A;  1FTZ A;  1R36 A;  3BG6 A;  1P92 A;  1FMW A;  2R5Z A;  3V7S A;  2IW5 A;  4BYY A;  2OZU A;  1FIP A;  3GVA A;  3LA2 A;  4HF2 A;  2VJJ A;  4CSW A;  3I4P A;  2Y0S N;  4TV7 A;  2R7X A;  1UAA A;  2A05 A;  3BPX A;  4C2U A;  5F0H A;  4UVB A;  4A3D J;  3KIO A;  1F1Z A;  3CF5 F;  1K78 A;  3PSF A;  1WJE A;  2CV1 A;  4BH9 A;  4HNT A;  3AL0 B;  2XC7 A;  3AL0 C;  3HJE A;  1B4A A;  1WFX A;  2PI0 A;  5LEK A;  2CJJ A;  3CJN A;  3R0J A;  1S3J A;  3M4O J;  2ME6 A;  1TNT A;  3BQY A;  2UV1 A;  4CO8 A;  4HX4 A;  3HHG A;  2ZJ2 A;  1IV8 A;  1EV7 A;  4NC8 A;  1IJW C;  4Q48 A;  2K27 A;  1IXC A;  3LSP A;  3H5R A;  1YJ9 I;  4PK4 A;  2VKV A;  2QKM B;  1WPK A;  2XGD A;  2FF4 A;  3GBG A;  1UG0 A;  2E36 A;  5IYB J;  1SAX A;  5D8L B;  3SQN A;  1CQT A;  3HUG B;  5LD2 C;  4YEL A;  4XID A;  2LY9 A;  2CYY A;  3Q9V A;  1ZKG A;  4XQF A;  3TO7 A;  2OUM A;  3D0S A;  4OIR F;  3HSE A;  1SFO J;  4HLX A;  2V26 A;  4NC7 A;  4EQQ A;  2TCT A;  2E2I J;  2Z16 A;  3QP5 A;  2HDD A;  2E60 A;  3GFI A;  4M71 A;  4ZYE A;  3OYN A;  1RET A;  4HV6 A;  4RAZ A;  3FKI J;  2LBF A;  1PUF B;  1RI7 A;  3O3K A;  5FB2 A;  1Q1V A;  2MG4 A;  3J80 Z;  2H8R A;  2ME0 A;  2DFH A;  4BQQ A;  3OYL A;  2H6C A;  2P6T A;  4DBQ A;  2GOM A;  3GF2 A;  5HS8 A;  1W5C C;  5D8K B;  3VYR B;  3C18 A;  1Y6I A;  2M5W A;  2ACJ A;  1LEA A;  4GGG A;  2ZSI B;  1MJA A;  2XF7 A;  3VB2 A;  3I55 I;  3FBI B;  2ZJR F;  2CUF A;  2VKD A;  4IZZ A;  1QPM A;  4XRS A;  3E7L A;  4KIC A;  1PUF A;  3EQL F;  3FM3 A;  3QRF F;  1VQ4 I;  5E3L A;  2L4M A;  3OMY A;  2XAH A;  1MMD A;  2KZV A;  1QZE A;  1SD7 A;  2LTP A;  1FBU A;  4ZH4 F;  2NVQ J;  9ANT A;  4O5V A;  3K9T A;  3R0A A;  2PMZ N;  3ESW B;  2E2H J;  1R23 A;  1HC8 A;  2ZFW A;  5IP7 J;  1WRJ A;  1T2K A;  2BBY A;  2LDU A;  1Y39 A;  3WGG A;  1KU9 A;  1AKH B;  4M72 A;  1LVA A;  2DBB A;  4DBR A;  3BC8 A;  2QCO A;  5HNH A;  2ZC2 A;  3RKW A;  2J5P A;  3HOT A;  4AIJ A;  2G0E A;  2HFH A;  3CDL A;  3BG5 A;  4GDF A;  2V9K A;  3KP2 A;  3DU6 A;  5K5O A;  3GTP J;  3E6M A;  3ZOB A;  1OCZ H;  2JA5 J;  2JK3 A;  2QWW A;  1IN7 A;  2WAE A;  3BG9 A;  3MN2 A;  5DV5 A;  2ISZ A;  1TQI A;  1YLF A;  3R60 A;  3K69 A;  4XOT A;  2W4S A;  4N0B A;  2FOK A;  4ZZD A;  2AS5 F;  3FXL A;  5E18 F;  3DEU A;  4ZDP A;  4A3K J;  4BXU A;  3A0B C;  3ZMZ A;  4FAS D;  2NOG A;  4QLC U;  2RQQ A;  1HF0 A;  2LOO A;  1F4K A;  5IOY A;  4C3H J;  1HKS A;  1VQ9 I;  3RPU A;  3UNG C;  5K5R A;  1WGX A;  1BC7 C;  3L2W A;  4XRM A;  2K9Q A;  1J59 A;  5HNF A;  2M7B A;  2V4J C;  2ADU A;  3CUO A;  2NOJ B;  1U5T C;  2COB A;  3I71 A;  3ML6 A;  4A93 J;  1X3Z B;  1RR8 C;  1H9T A;  2EIJ H;  5E3N A;  1IAW A;  2YU3 A;  4P96 A;  5ICG A;  2PJP A;  2M9H A;  4X1E A;  2XF5 A;  1T33 A;  1MBE A;  1BIA A;  4BBS J;  4AVP A;  4GYG A;  4BE1 A;  1ZAR A;  1OPC A;  2O03 A;  4A5N A;  1O3Q A;  4EV0 A;  3GTO J;  2GXB A;  1YYV A;  2A07 F;  4IOC F;  3QYE A;  2M0M A;  1T95 A;  4LGW A;  4M73 A;  3QYF A;  2DMT A;  1HW2 A;  1Y0N A;  4IXA A;  4KYW A;  5K5Q A;  2AQF A;  5FRM A;  1FP1 D;  2BW3 A;  2CU7 A;  3CMM A;  5GPA A;  4PJN A;  2CH0 A;  1SVO A;  3GXO A;  3MD2 A;  2IXS A;  2XUB A;  2KDZ A;  4QPO A;  2C6Y A;  4OMZ A;  1PDN C;  3KYL A;  2K9S A;  4MGR A;  3E1S A;  4K2E A;  1GV5 A;  3U1K A;  4F92 B;  2ZNY A;  4E7K A;  3TKY A;  2Y0S A;  4ZZL A;  2H8W A;  4D7N A;  1W7P A;  5DD4 A;  2PQ8 A;  3MZH A;  3E3V A;  2M87 A;  3U2R A;  1WHU A;  3ERE D;  4P1W A;  3GTK J;  1DU0 A;  1SAN A;  1WCM J;  2R7T A;  1JTY A;  2FBK A;  2VKH A;  3PL8 A;  3BPV A;  1MMS A;  3MEX A;  4RDU A;  4JBA A;  1O3T A;  4M3B A;  3HPH A;  3TDZ C;  2XAU A;  1ZLJ A;  2LY1 A;  2ID3 A;  1OCR H;  1ORK A;  5EEA A;  3S3N A;  4E70 A;  2A61 A;  2NNY A;  3CD6 I;  1HDP A;  4IVN A;  4CYD A;  1VQO I;  1SD5 A;  2VOP A;  2XIG A;  5IP6 A;  4ANJ A;  2K5C A;  4RM2 A;  5L3D A;  1HDD C;  1FYK A;  4V19 K;  2UWM A;  3MKW B;  4AWX B;  3TO9 A;  2KPM A;  3CDH A;  1QBJ A;  1G6N A;  4LB6 B;  4R79 A;  1LB2 A;  2L7M P;  4KA4 A;  4C2T A;  2CS3 A;  4RB0 A;  1IGN A;  4HDU A;  1IV6 A;  1UG2 A;  5HOO A;  4ENN A;  1ERD A;  1P4A A;  2ETH A;  1O57 A;  5ED4 A;  4BHP A;  3TED A;  4P9U A;  3SZG A;  4EEF G;  1WI3 A;  2E1M B;  3HG9 A;  1WJF A;  1I5Z A;  3OS2 A;  2OD5 A;  3GTG J;  2BY0 A;  1D8K A;  5DD8 A;  1XC5 A;  2P8T A;  4OWR B;  5L3F A;  3RZO J;  1XS9 A;  1G8X A;  2LBF B;  2OF7 A;  3F9K A;  2V9P A;  3PUB A;  2KIF A;  1CGP A;  1G3W A;  5F6F A;  4LIU A;  1A6I A;  5EG0 A;  1FEX A;  1IUF A;  2DQL A;  1SMT A;  4U0W A;  3I9V 2;  3MQ0 A;  2M8G X;  2EFN A;  3L2C A;  1FX7 A;  2ZB9 A;  3PQJ A;  4Q47 A;  1K6O A;  3M8E A;  1U0J A;  1WQ2 A;  4IHW A;  4Y15 A;  2O8X A;  4BXF A;  1I27 A;  3K70 D;  2R7D A;  2Q8K A;  4L5I A;  4G8X A;  2WAQ N;  2Y9Y A;  5CYV A;  2V6E A;  4UB6 C;  4A3J J;  1BM9 A;  1HXD A;  5LHH A;  4LG0 A;  3GW2 A;  2LG4 A;  3CTA A;  3HB9 A;  5E1W A;  5ILU A;  4IRG A;  3DFG A;  3N05 A;  5JI6 A;  3M07 A;  1AKH A;  3PO2 J;  1ULY A;  3FKJ A;  4U87 A;  4CH7 A;  1UJ8 A;  2HVQ A;  1SFE A;  3KFW X;  2ECC A;  3S14 J;  1FYL A;  4X6A J;  4D1Q A;  1MD0 A;  2I10 A;  3HSR A;  1QVT A;  3GYH X;  2HVS A;  3WU0 A;  3ABT A;  1HW1 A;  1OYY A;  1IRZ A;  2QGU A;  5B3S H;  1Z9C A;  3F72 A;  4MQ9 F;  3DBL B;  5CPR B;  4AU7 A;  4DNC A;  1T6S A;  3GUD A;  3OIO A;  1IRG A;  2F5E A;  2QSG X;  4UUS B;  3W2A A;  1WWX A;  3H3V K;  1X58 A;  4BDY A;  4Y17 A;  1J75 A;  3W6V A;  2GWR A;  1BL0 A;  4MFE A;  3F8B A;  3G6E I;  1KQ8 A;  2VI6 A;  3DKX A;  4KIG A;  2F6C A;  4HX7 A;  1GLN A;  1V5G A;  2Y31 A;  1NK3 P;  5H20 A;  3BR6 A;  3FHZ A;  3K4K A;  2D2W A;  1CF7 B;  4F93 B;  1XSX A;  3BT9 A;  3HOV J;  1RZ4 A;  1HBX G;  4ON0 A;  5FGM A;  3EUH C;  1F36 A;  5BNG A;  5LRS A;  2VJ5 A;  2AO9 A;  1KYW A;  4H0E A;  4AYB N;  1LNW A;  1Z21 A;  3FXM A;  4J01 A;  2W25 A;  1FPQ A;  3G71 I;  3J7A Y;  5FLV A;  5CVJ A;  2A6E F;  1TP4 A;  3J7A O;  5BS6 A;  3CCL I;  1W7P B;  1YHQ I;  2OQR A;  1VFC A;  3K4M A;  2J5O A;  4MQV A;  4BJ5 C;  1D1B A;  3OS1 A;  1SVM A;  4M74 A;  4BNC A;  4E6K G;  3HOZ J;  1XGS A;  2FQ3 A;  2NNN A;  4A5M A;  3A01 A;  3DU5 A;  1J09 A;  1Y1V J;  3JRA A;  1KGS A;  1HSJ A;  4LK1 F;  3IUO A;  2VQL A;  2DOA A;  5EZH A;  5J8C A;  2KDO A;  2X9D A;  5DCF A;  1RKW A;  2WY7 Q;  2ZKZ A;  1AA7 A;  3JRD A;  4EGY A;  5FD5 A;  3W2W A;  2G7U A;  2D5V A;  3OR1 C;  2DCE A;  1WVR A;  2ZXJ A;  4LB5 A;  5D4S A;  2CFO A;  1O7L A;  3ZP5 A;  1PUE E;  2MA3 A;  2M3A A;  3C7J A;  4A6D A;  2BE5 F;  4MEY F;  2DA2 A;  3QQA A;  3FXO A;  3OY9 A;  2ZJQ F;  4XSZ F;  2JSC A;  4M6X A;  2Q2E A;  4P5O A;  2LRE A;  2QQ8 A;  1MH3 A;  3PM1 A;  1GV2 A;  1JI8 A;  4KIS A;  2Z5U A;  1MBK A;  5L3E A;  2X48 A;  5KNL A;  4NBQ A;  1ZR2 A;  1O3R A;  2K3P A;  3HZJ A;  1ETK A;  3GZ6 A;  2IRF G;  4RLQ A;  2LD5 A;  2P0W A;  3SFZ A;  1N78 A;  2OU2 A;  3I5U A;  4DYQ A;  4MTE A;  3Q0V A;  1QZZ A;  3UKG A;  1UFM A;  1RIO H;  4L9J A;  2O61 A;  3TW7 A;  3K70 C;  3HYI A;  3PUF A;  5H6Q A;  4ESB A;  3BR3 A;  2JWT A;  4XKC A;  1NHA A;  2LKX A;  1BI3 A;  3A1Y A;  4Y3O A;  1MIJ A;  4IRI A;  2FXA A;  2FMY A;  3BJ6 A;  3EDP A;  2NYX A;  1U8B A;  5IYC J;  3HOY J;  4DYR A;  1AOY A;  2Y69 H;  4XOR A;  2EA4 A;  1G3S A;  1B8I B;  2X51 A;  4UVC A;  2N8G A;  1G59 A;  4CGZ A;  3CJT B;  1OMI A;  3RPQ A;  4PJJ A;  1RR7 A;  2LF8 A;  1GUU A;  2LKP A;  3J81 K;  1HOM A;  5BPI A;  2X4H A;  2OPT A;  4I01 A;  1A31 A;  3MMY B;  5EF6 A;  4KT5 C;  2EB7 A;  1KQ9 A;  1EJ9 A;  3KYD B;  2DYS H;  3RKQ A;  2EJR A;  4B44 A;  1KZH A;  2V79 A;  4KIF A;  2EIK H;  2WV0 A;  2DYR H;  2Y9Z A;  1JJ6 C;  4L9T A;  2HPI A;  4RAF A;  5D4R A;  3OV8 A;  4Q4Z F;  4BS9 A;  1VQM I;  4BHC A;  2YU9 J;  1KU7 A;  3RYR A;  1H0M A;  2ZME B;  2Z1D A;  3LAJ A;  2QEX I;  3RQ4 A;  4OIO F;  3MKZ A;  1MBJ A;  3D5L A;  3E6D A;  3JAM Z;  2R7Q A;  4EJV A;  3BRO A;  2CO5 A;  3DEW A;  1E2X A;  3W2V A;  3O6B B;  5JR3 A;  1IC8 A;  2DA4 A;  2CMP A;  2DOF A;  2EFW A;  3I0T A;  4B43 A;  4L5E A;  3AG1 H;  1D0Z A;  2ELJ A;  4AUX A;  1V55 H;  3N4M A;  4ENK A;  5AIP A;  1R71 A;  2IJL A;  5DS9 A;  3LSH A;  2FUG 2;  2KT0 A;  2GIZ A;  2ID6 A;  1LKX A;  2XAG A;  3IH2 A;  5IPA A;  3CC2 I;  1EH8 A;  1T8I A;  4RM3 A;  3OYC A;  4IQ4 A;  3TP0 A;  4FHT A;  3WG7 H;  4AIK A;  1Q1H A;  4DYC A;  5LHG A;  4OU0 A;  1BC8 C;  4HNV A;  2Y30 A;  1D1C A;  1RUN A;  2WAQ A;  2F2E A;  3HGG A;  4LG0 B;  4EMS A;  5F0C A;  1Z7L A;  3FXR A;  1DQU A;  1ZK8 A;  1TWF J;  1N77 A;  1FBS A;  1H9G A;  2X1C A;  1U3E M;  2DW4 A;  3HGY A;  1LUJ B;  1W5S A;  2XAQ A;  2KMU A;  3I64 A;  2MD5 A;  2IVM A;  3BTL A;  1WI9 A;  5CKT A;  4A3G J;  1V5E A;  4UUT A;  5CVI A;  1O3S A;  4AIH A;  2PMH A;  1Z67 A;  4IX7 A;  1LVK A;  4DGW B;  3M8J A;  3S17 J;  4CCO A;  2W84 A;  4UNO A;  2WB1 A;  2DDA A;  2ICW G;  4V2G A;  3RYP A;  2WV1 A;  5B1A H;  4MIM A;  5C4X J;  1FZP B;  5BPD A;  4HSR A;  2MBF A;  3AG4 H;  1T0F A;  1JUP A;  3ZMT A;  4BY7 J;  2HTS A;  3FDY A;  5DM7 F;  2EZL A;  3RJP A;  3VOD A;  3BTC A;  3KZY A;  1Y8R B;  4ZC3 A;  4GFB A;  2BOL A;  4A69 C;  3BTI A;  1H88 C;  2ELH A;  5FRO A;  3DQV C;  2VT3 A;  3ZQF A;  1S6L A;  1RNL A;  3H0D A;  2EQR A;  4N4O B;  2HYJ A;  2IBD A;  4NQW B;  1T98 A;  1MZB A;  1VQ5 I;  5HS7 A;  1ETW A;  3ZN1 A;  2ZBK A;  3JR9 A;  2QM3 A;  2EH3 A;  1TW2 A;  2PEX A;  4V2F A;  1ZRF A;  3KEO A;  1BI2 A;  2VON A;  1VQK I;  4IQJ A;  1A35 A;  3SZT A;  3MKY B;  3HC7 A;  4IEJ A;  1O7F A;  5JFR A;  4LMY A;  2OC6 A;  3HBL A;  4A0Z A;  2YX7 A;  3H3U A;  1DUX C;  3ERM A;  5B1B H;  2WA0 A;  2VLA A;  4G7O F;  3OWT A;  3JCU C;  4PUS A;  3P9I A;  5F08 A;  5F27 A;  2PLY A;  3AFH A;  3BP8 A;  3W6J B;  2IS2 A;  3K4L A;  5DUK A;  1DPR A;  1TQP A;  3IL2 A;  3F3X A;  4ESJ A;  2OZ6 A;  4ZYD A;  2CV2 A;  1UHW A;  2FBI A;  2R5Y B;  3H36 A;  1XX5 A;  3CCM I;  5TJJ A;  2XRO A;  3PIP F;  3LOC A;  4RGU A;  1RPW A;  1UB9 A;  4CCL A;  1ZR4 A;  2Q0O A;  1Z6R A;  3OYF A;  1ON1 A;  2QEN A;  1JKR C;  2IT0 A;  2B63 J;  3BQZ A;  3K10 A;  3I56 I;  3IH3 A;  4KN4 X;  2V1N A;  3SFI A;  4AM3 A;  3FMQ A;  3PFY A;  2HEO A;  2DMN A;  4EGZ A;  2EPF A;  1MJ9 A;  3AKZ A;  1I1G A;  4F3Q A;  2MH9 A;  2DPU A;  1IXS B;  4B4C A;  1QPI A;  5FRN A;  5DYM A;  5J1Y A;  5M5Y J;  1F43 A;  1XDU A;  4R8H A;  4BE0 A;  4LIV A;  4XOP A;  3LMM A;  2M8E A;  2XV4 S;  3OL3 A;  3LSM A;  1Z91 A;  3CUQ C;  4EAT A;  1LPQ A;  1IDY A;  1JT6 A;  5HDK A;  2JN6 A;  1B8I A;  1QHH D;  2BXY A;  2LKS A;  5EGO A;  4BQA A;  3GEZ A;  4I76 A;  4CCM A;  3FHN A;  4HYE A;  1KYZ A;  2G7H A;  2R4G A;  5H2F C;  2JJ7 A;  4KUM A;  3WGH A;  4BHB A;  3QAH A;  2V1X A;  3F22 A;  1K83 J;  2YR2 A;  3J81 Z;  3JW4 A;  3VYS B;  1XSD A;  2G9W A;  3PNT A;  2P5L C;  3N97 A;  1TBX A;  3W3C A;  3E6B A;  3H5A A;  1PP7 U;  3SJM A;  4WF2 A;  1X4O A;  3HKZ A;  4CCK A;  4RB1 A;  3SDB A;  5K7H A;  1BIB A;  1SD4 A;  4LD5 A;  2VXD A;  5J47 A;  1IDZ A;  2Z9O A;  1NK2 P;  1V3F A;  4PJL A;  1WJB A;  4II3 A;  5EYR A;  3EPZ A;  2F5C A;  3S2W A;  1IRF A;  4LOC A;  5D5V B;  3WHC A;  1LFP A;  1J9I A;  2KJB A;  4R1H A;  4J00 A;  2I8D A;  3BG3 A;  1A5J A;  4BQO A;  4G6T B;  5FFZ A;  4DZP A;  2B0L A;  3K4B A;  1OJL A;  3JRH A;  2O6G E;  5L3B A;  3VYU B;  3WTW C;  3B02 A;  4Z2Y A;  3E5X A;  2EV0 A;  5AON A;  3D5S C;  1FBQ A;  3H0G J;  1ZN2 A;  5DCM B;  1A6Q A;  4A0X A;  1MNM C;  1LFU P;  1PJR A;  1Z7U A;  5LFA A;  5ICE A;  5J1R A;  3PO3 J;  4B47 A;  3FF5 A;  1OYI A;  2Q2E B;  4ZYG A;  1KA8 A;  2IA2 A;  2BV6 A;  2P6S A;  3I53 A;  1P9Q C;  2MD0 A;  2K3F A;  4XIC A;  4OOI A;  4M3F A;  4HNU A;  1Z77 A;  3H9G A;  2BVM A;  5D5X B;  4ZYH A;  3DEE A;  4S05 A;  1YW8 A;  5FLM J;  2WWY A;  2X6Y A;  5KAI C;  1ZYR F;  5E3M A;  4YII A;  3MZY A;  1JGG A;  1IN6 A;  2AHQ A;  1SMY F;  2HI3 A;  4CA0 A;  1JUS A;  3SYT A;  3TL4 X;  2DT6 A;  2Q1Z B;  4GXO A;  4XN3 A;  2XKO A;  4PCQ A;  4Y4R A;  2CW0 F;  4FX0 A;  4HV5 A;  2ECB A;  3BZ6 A;  3S16 J;  4GCV A;  1JUM A;  5CVV A;  5K7Z A;  2ISY A;  4GYI A;  4RBO A;  3LQQ A;  2JRT A;  2DOE A;  1VQL I;  1U2W A;  2EZK A;  2NS8 A;  1SFX A;  1X1A A;  2OA4 A;  3CZ6 A;  1GXQ A;  4BEH A;  2D1H A;  2RQP A;  3C2G A;  5EJC A;  3OYA A;  3LSK A;  3QPT A;  3ZR8 X;  3LSG A;  2CQX A;  1MBH A;  3M1E A;  2L4A A;  5JHF A;  2DTR A;  1MSE C;  2RAE A;  2IGO A;  4DQ2 A;  1D0Y A;  1XG1 A;  2VN2 A;  4PJM A;  3DCF A;  1I39 A;  5TIS C;  4A0Y A;  1UZC A;  4E7Z A;  4IHV A;  4L5J A;  2HOE A;  3S1Q J;  2M7A A;  3FMR A;  2VQG A;  3OYK A;  1QO0 D;  2HZD A;  4BEH B;  4HBL A;  4NDL A;  1HA8 A;  1KON A;  2E5Z A;  2IGN A;  4P55 A;  1S7O A;  1APL C;  2VOD A;  1DGR M;  4XLF A;  5F04 A;  3G73 A;  2IS1 A;  2VB6 A;  1AWC A;  1X1B A;  5J6X A;  5ILS A;  1T39 A;  2GQQ A;  1J0R A;  4M3E A;  5E20 A;  3CCU I;  4XN0 A;  3SEQ A;  4GO1 A;  5CVR A;  3D5R C;  4DW6 A;  2CQQ A;  4A3E J;  4B3A A;  3TOB A;  2HWV A;  3HHH A;  4I7H A;  3CUQ B;  1QA6 A;  3O2P E;  3ZQC A;  1YO5 C;  2R7O A;  1XSV A;  3W6K B;  2EBI A;  4A3F J;  2GZW A;  3LSJ A;  2H6B A;  2ZCW A;  2VC1 A;  2LVS A;  2O7O A;  2CFX A;  1ZAO A;  4G6D A;  1GDT A;  4UXN A;  3CO6 C;  3E0J B;  2A3S A;  2BY3 A;  1LDJ A;  3GX4 X;  3KP3 A;  1TWC J;  3MAJ A;  3S1N J;  1IUY A;  2L9V A;  3CC7 I;  1YOV B;  3EET A;  2HQR A;  2A69 F;  4L0Y B;  2L2O A;  2EIM H;  3QOP A;  5IOZ A;  3A2K A;  1LDK B;  1LQ1 A;  3F23 A;  5FKK A;  1OR7 C;  4PSW A;  4CCN A;  1FOY A;  1XMA A;  4XRF A;  3ZGK A;  3CQZ J;  2KP6 A;  2KRH A;  4BU2 A;  2P81 A;  2RN7 A;  2X0L A;  3OIP A;  1X3U A;  4AYB A;  2V9V A;  1UST A;  5DUI A;  5FKN A;  4MTD A;  1RC9 A;  3QPS A;  3SZP A;  1SAU A;  2H1K A;  1T38 A;  4KNY A;  1V5F A;  3RIR A;  2Z2S B;  2BHZ A;  3QWL A;  1MGT A;  4WX9 A;  1TT0 A;  2P7V B;  2E1O A;  3ASN H;  3V8K A;  3A01 B;  5D6F A;  5J3L A;  1P2F A;  2R7U A;  3QOD A;  4CZC A;  3CCS I;  1U9O A;  2P4W A;  3F8C A;  2MC4 A;  2DI3 A;  3A02 A;  5B5E C;  2IGM A;  4DZJ A;  1MMN A;  4D5C A;  1W0U A;  1W36 C;  3U1D A;  5C4J J;  2EV5 A;  1ON2 A;  2DJN A;  1HKQ A;  1UCR A;  2MSY A;  3WTS C;  3WTU C;  3PQK A;  1MMA A;  5FO5 A;  2UXN A;  3GTM J;  3DTK A;  3DPL C;  4A3I J;  1L0O C;  1MBF A;  2TRT A;  1VZ0 A;  2WY8 Q;  3FX3 A;  5ILV A;  1UHS A;  1XMX A;  2LFB A;  2QQA A;  1ZGW A;  4ZTJ A;  1JHF A;  5GAG J;  2EFQ A;  4P9F A;  2FX0 A;  3G1O A;  2LF7 A;  3MFK A;  1CF7 A;  5HVQ C;  1S7A A;  4IHX A;  3ONQ A;  1PP8 F;  4DIQ A;  3JRB A;  4BL0 B;  1B72 B;  1UMQ A;  1MND A;  3K2A A;  4LG3 A;  2ESH A;  2A5Y B;  4II2 A;  2IS4 A;  2R7S A;  2D45 A;  2H1L A;  4E7H A;  5DEQ A;  2PBI A;  3JSO A;  2RNJ A;  3KEQ A;  2LMD A;  5FFX A;  1A04 A;  1FLI A;  3ZQI A;  2JTV A;  1ZG5 A;  2HYF A;  2NAZ A;  5FLX Z;  1L3L A;  4KIB A;  1B72 A;  1IN5 A;  1USS A;  1OLT A;  4X0G A;  4JYK A;  1VTN C;  2HU9 A;  3L7W A;  2CUE A;  2WC2 A;  2STT A;  3I58 A;  1EKE A;  1H8A C;  2A68 F;  3S8P A;  4B8X A;  2TDX A;  2VPL A;  4FX4 A;  3LNQ A;  1BBY A;  2QYO A;  3IAS 2;  3H5N A;  1R1V A;  2DFI A;  2CSO A;  2PMU A;  3S15 J;  3WTZ A;  2JA8 J;  5DTD A;  3K7A J;  4ENM A;  3OSG A;  3T8R A;  4ABZ A;  4ZJZ A;  1P4W A;  1S8N A;  5KK1 A;  2HDC A;  1MNE A;  4I02 A;  3CMY A;  1TQM A;  1TLH B;  2CW8 A;  1TW3 A;  2WAD A;  4PGH A;  2QSH X;  2DA7 A;  2WTE A;  4YFK F;  1E17 A;  5H6R A;  4G7H F;  4HA8 A;  1TNS A;  2IEK A;  3FIW A;  3HL2 A;  2FOW A;  2KIS A;  3IAM 2;  1POG A;  2VC0 A;  2W82 A;  4A3B J;  3P9K A;  4MNU A;  1I1S A;  1SEU A;  2GAU A;  2JUC A;  3NQO A;  2BVL A;  2XAF A;  4LFU A;  2VBY A;  1TWA J;  1T0F C;  2QZ8 A;  3QU6 A;  4RMN A;  3QU3 A;  3HOX J;  3RPU D;  4BDZ A;  4D9J A;  1OCT C;  1R5H A;  3KPH A;  4N9I A;  2AXL A;  4L0Z B;  2GA2 A;  1ZTR A;  2DA3 A;  3E5U A;  3V7C A;  2MH2 A;  1VND A;  4B1R A;  3CLQ A;  3KLN A;  2IGK A;  4I2O A;  1J2X A;  1YIJ I;  2ZXI A;  2DMU A;  3G1L A;  4H4K C;  5CJ9 A;  1N25 A;  3KYC B;  2P5V A;  5DDG A;  2CQN A;  5JLX A;  1R4M B;  2L9S A;  3ABU A;  1IG7 A;  1I50 J;  3LFU A;  1XTA A;  2HVR A;  3H3Z A;  5EG0 B;  3BR1 A;  1VI0 A;  4RS8 A;  5BQT A;  2M0C A;  4EJT A;  3V7R A;  3RTR A;  3X2Q H;  3GTQ J;  4BAC A;  2PN6 A;  2Z99 A;  1RUO A;  1ETY A;  1XPX A;  2MGQ A;  2ZJP F;  3QYB A;  4I0B A;  2M45 A;  3DBH B;  3A03 A;  1E3O C;  3OYG A;  3HRM A;  3BLY A;  3I54 A;  5GPC A;  3EUA A;  1F9N A;  2AQE A;  1QHG A;  4IHY A;  3GTL J;  1DGW Y;  2V1U A;  1B59 A;  2CGP A;  1R1U A;  3ROU A;  1YRN B;  4QIW N;  1YS6 A;  3ABL H;  4B48 A;  2WB1 N;  1S5L C;  4IKF A;  2EZI A;  5GP9 A;  2FD5 A;  3KP7 A;  5LHI A;  3IHU A;  3AAF A;  3COA C;  1YFH A;  4U88 A;  3AG2 H;  2MLK A;  4G6Q A;  1U6G A;  4NUB A;  4HW0 A;  2DFE A;  4A2U A;  2EFO A;  2QLZ A;  3RSN A;  2EIL H;  2IPQ X;  5A2Q K;  4XON A;  1OR7 A;  2VKE A;  3VSL A;  4KMF A;  5J1U A;  1W7P D;  5GTI C;  4XLA A;  3EUK L;  2F5D A;  4UB8 C;  1T08 B;  2F5V A;  4HZF A;  4CDG A;  1SD6 A;  1QU3 A;  3BTJ A;  1Z1D A;  3BOQ A;  4FIS A;  4CYC A;  1I6H J;  1M1E B;  1OFC X;  3K1P A;  1WZ2 A;  1WJA A;  5GAD J;  3F6V A;  4PDK A;  4NHJ A;  1D0X A;  3L1P A;  5KVR A;  2PX9 A;  2OCC H;  4EM0 B;  1K7A A;  1WJD A;  4FE7 A;  3R4K A;  4IHS A;  2W7N A;  3MCZ A;  1VQ6 I;  3VOE A;  1XGN A;  4XSX F;  1HST A;  2RDP A;  2RVC A;  3F8N A;  3ECO A;  4NB5 A;  1QZY A;  3VWB A;  5C44 J;  5LLQ A;  2CUJ A;  1XCB A;  1JKP C;  4OMY A;  1NG7 A;  1JGS A;  5FJ8 J;  1QQI A;  2ZSH B;  3BJA A;  3K6G A;  1N75 A;  4N9H A;  1TT5 B;  1T56 A;  4PSX A;  2BHY A;  1MKM A;  2JVH A;  1FC3 A;  3OYH A;  2HOS A;  1YIO A;  2L7F P;  2UZK A;  4CYC B;  3ZMS A;  5HLT A;  4A6E A;  3OYJ A;  3CCR I;  3ZPL A;  1ZGJ A;  4AID A;  3TGN A;  3F6O A;  3FXK A;  3SEZ A;  2MC3 A;  4MLO A;  3T5X A;  3MWM A;  2W57 A;  3OYM A;  5IP9 J;  2DA1 A;  3LL7 A;  4XR6 A;  3HEF A;  4MEX F;  2QBY B;  4YG2 F;  4PZJ A;  3BDD A;  5DM6 F;  1TWH J;  4UV9 A;  3A4C A;  3REO A;  2HKX A;  1U5T B;  1IN8 A;  4XLC A;  4CXF A;  4BY1 J;  2PG4 A;  3NEU A;  2K7L A;  2F4M B;  1IF1 A;  2L3D A;  3WU2 C;  1OCP A;  2HQN A;  3F0C A;  2LYC A;  4N4N B;  3FZV A;  3FM5 A;  3HM5 A;  3DLL F;  5EGO B;  3U9G A;  5E1Z B;  2IA1 A;  1P7I A;  2B9S A;  4ESF A;  2DJI A;  5KCM A;  2W48 A;  1G3Y A;  3S3O A;  1I6X A;  4A3C J;  2V1D A;  4QPQ A;  3DKW A;  5FKL A;  4HPQ A;  3HSF A;  1X1D A;  3H1C A;  2VIX A;  3WTT C;  4RGR A;  1K6Y A;  2X6X A;  3NAU A;  4LIT A;  3FIS A;  3P7N A;  4HQE A;  3ZQH A;  2E7W A;  1BR2 A;  4FQG A;  2CG4 A;  5ICC A;  3FBN B;  2FQ4 A;  3KEY A;  3D1N I;  2XDV A;  3HKZ N;  1MDM A;  2R0Q C;  5D5U B;  2K40 A;  1VQ7 I;  1X19 A;  4I99 C;  4L9V A;  4BGD A;  2VUM J;  2FJ1 A;  2DT7 B;  5C3E J;  1E3P A;  5HLI A;  2OTL I;  5KAF C;  1MSF C;  2NXN B;  1Z0X A;  3KX2 A;  2VBW A;  3GZ5 A;  3M9A A;  5AIQ A;  2O5R A;  3PNY A;  1JHH A;  1S7E A;  3WOD F;  1YX5 A;  5IT9 K;  3M3Y J;  2VL8 A;  1W4M A;  1IN4 A;  5CQG A;  3O8H A;  4F91 B;  5J4Y A;  2E1M C;  2ZXW H;  2HS5 A;  5M3M J;  4Z6Y A;  2MAB A;  2X1D A;  4LJZ F;  4M6Y A;  3RKY A;  3IKT A;  2GIV A;  5JVG F;  2KRF A;  1EF4 A;  3B6A A;  1QRY A;  2UXX A;  3K4J A;  4HX8 A;  3VEP A;  1E0E A;  3BJO A;  1D8J A;  4IJA A;  2Y75 A;  2E19 A;  3FXJ A;  4ASN A;  1ZLK A;  2X6W A;  1D5Y A;  4BJ6 C;  5E17 F;  2FU4 A;  1R58 A;  3CP2 A;  3K1M A;  3V8L A;  3GTJ J;  4CCJ A;  3FXU A;  3DTE A;  1Y1W J;  5F1J A;  4EM2 A;  1LE8 B;  2O9L A;  1K4S A;  1BR1 A;  3HXL A;  3RZD J;  2W1O A;  4HQM A;  1YI2 I;  1K79 A;  3TQN A;  3BZK A;  2KIM A;  5M5W J;  2DLL A;  3TDU C;  2K85 A;  1U9N A;  2VXZ A;  4RGX A;  4JOM A;  1XMK A;  2NRA C;  4RB2 C;  2DTZ A;  2RNG A;  1GVD A;  2OV7 A;  4Q5S F;  4EM1 A;  4IRH A;  1D3Y A;  2E2J J;  1WH7 A;  2LSO A;  2L7Z A;  3BWG A;  2QQB A;  4AVZ A;  3L9F A;  4EJO A;  5FKM A;  2K9L A;  2K4B A;  4OIN F;  4PJ0 C;  3OYD A;  4O3M A;  1WKM A;  1BW5 A;  2KRC A;  5HLH A;  1FSE A;  3RKX A;  1B6A A;  4C3I J;  2R7Z J;  3WGI A;  1DDN A;  4RB3 C;  4L9N A;  4BKX A;  2M34 A;  3ZN0 A;  2XHK A;  4I6Z A;  3K4N A;  3KCC A;  1OQY A;  1ZEL A;  4FT8 A;  3LSR A;  2X6O A;  2GBY A;  2L0K A;  3OS0 A;  1TWG J;  3VFZ A;  4XNF A;  1Z3Y A;  4NNJ A;  3IRR A;  4XK4 A;  2K02 A;  3CLO A;  2JPC A;  2XSJ C;  3LWF A;  4B3X A;  3OYI A;  2VQH A;  3S2D J;  3TMO A;  2KIU A;  4ETS A;  3F21 A;  3WHB A;  5ICF A;  2F4I A;  2R7R A;  2XKP A;  4E7I A;  4XKB A;  3GO5 A;  3F8F A;  3K2Z A;  2KLO A;  3FK6 A;  5LEJ A;  1O4X A;  3SHF A;  1LEB A;  5F64 A;  3SDG A;  3EYI A;  3PJR A;  1W5T A;  2FEZ A;  3ULQ B;  4M3D A;  2KQR A;  1D1A A;  2HOA A;  1OCO H;  2YUS A;  4G94 A;  2FSW A;  2HQA A;  4E7J A;  3ASO H;  3OIQ A;  4HG2 A;  3CJR B;  3TOA A;  2IA0 A;  1FTT A;  4RLF A;  3DBR B;  2E71 A;  1TL8 A;  3A0H C;  3IWF A;  2XGC A;  1HW5 A;  3ZRG A;  2D1V A;  2EZH A;  2ZXH A;  3S2H J;  2PFB A;  4MHG A;  5GTH C;  2DXI A;  4ENJ A;  5LGT A;  3ECH A;  2VE9 A;  5ERI A;  2LRD A;  4LLG F;  2QUF A;  4JK1 X;  5HOD A;  4HF0 A;  2AXT C;  5E1X A;  1XD7 A;  2DK5 A;  3ISP A;  2L01 A;  1G4D A;  2QA4 I;  2HQ5 A;  3BG7 A;  2XSD C;  1U8R A;  3RQI A;  3GWZ A;  3HUG A;  1G2H A;  3JRE A;  1RKT A;  5LGN A;  3Q9S A;  1Z05 A;  4JX5 A;  4D0P A;  4U0Y A;  3HRU A;  1LFB A;  4KN7 X;  4OIP F;  2XB5 A;  5HS9 A;  5BOX A;  3FWE A;  1BJA A;  1JKQ C;  2QF7 A;  3ZQ7 A;  4YFX F;  3ZQL A;  1NH3 A;  1FOX A;  3DPU A;  3S3M A;  1EH6 A;  3LQR A;  2LC2 A;  1ENH A;  3KLO A;  3CF2 A;  4XKW A;  2RRE A;  1B9M A;  1R4N B;  4BE2 A;  3MZ8 A;  3H35 A;  5CLS A;  2VJI A;  5CVU A;  1TC3 C;  2BGC A;  3HRS A;  4KDP A;  3IP4 B;  1MJB A;  4WXH A;  3HOS A;  3CME I;  3C2H A;  4UV8 A;  3ZQG A;  5B66 C;  5HDN A;  2Y2Z A;  5TGT A;  1OCC H;  1MDM B;  4GRI A;  3FMS A;  1AU7 A;  4UY8 I;  3PFI A;  3BZC A;  4F55 A;  2LNB A;  1X4P A;  3HTS B;  2FRH A;  1ZGA A;  1FIA A;  4O6J A;  3KZI C;  4MO7 A;  2DMQ A;  4D5F A;  1IO2 A;  1BW6 A;  2A6T A;  2OQG A;  3AG3 H;  5D5W B;  1K61 A;  2FNA A;  1P6R A;  1R00 A;  4M9Z A;  3L00 A;  1W0T A;  2CUZ A;  2ZME C;  2XGE A;  4DJA A;  3QPH A;  2DA5 A;  4JQF A;  4CZZ A;  3C2B A;  1FOW A;  3DP7 A;  2KFD A;  3OR2 C;  2CQK A;  2BZT A;  2VBZ A;  3QOE A;  3IRQ A;  2VBX A;  4BAY A;  2M30 A;  4CIC A;  1ZRE A;  1V4R A;  5L3G A;  4U0V A;  4XLN F;  3TP3 A;  2FNP A;  2I5U A;  2W24 A;  2ELK A;  2H27 A;  2K86 A;  1R9T J;  3L2R A;  3WTX C;  3IWZ A;  5M3F J;  4DOZ A;  5TRD A;  4IHT A;  3T8T A;  2OCE A;  1UHM A;  1ZG1 A;  4LLL A;  3GME A;  3HTU A;  2KZG A;  2X85 A;  3Q3S A;  2BXZ A;  2P5K A;  1P7J A;  2HDW A;  2R7V A;  2XF6 A;  2R7F A;  2DQR A;  3ZMV A;  3G4S I;  3WE2 A;  5FKO A;  2HR3 A;  1JT0 A;  3GZN B;  4AC0 A;  2R5Y A;  3NRV A;  2EA2 A;  1UEL B;  2UUZ A;  2CWE A;  3LAP A;  2HPM A;  2JA7 J;  2DU9 A;  2HTJ A;  4M9X A;  1JKO C;  4MFD A;  4RAG A;  2PMZ A;  2M4G A;  2HZT A;  4XKV A;  3CCJ I;  1G3T A;  2X1E A;  3Q0W A;  4OAY A;  1SVL A;  3FXQ A;  4XM3 A;  5E8I A;  2GLO A;  1AHD P;  4IF4 A;  2JZY A;  3H9J A;  1YJW I;  3J7Y J;  4D7M A;  1HKT A;  2XPU A;  4WWC A;  4F7Z A;  3JRF A;  4QSH A;  3GCM A;  2DMP A;  2LH9 A;  3KP4 A;  3IV5 A;  2PJR A;  4JX6 A;  3S1R J;  2ESN A;  3PSI A;  1ITY A; 
#chains in the Genus database with same CATH homology
 3OYE A;  1S9H A;  3S93 A;  3RTR A;  3FDY A;  4ZDL A;  4YEJ A;  1X1C A;  4XL9 A;  4BAC A;  4ZDO A;  3OMY A;  4ZTF A;  1MMD A;  2KZV A;  3VDX A;  4ZC3 A;  3QYB A;  2BOL A;  4Y33 A;  3UR3 C;  3OYG A;  3L2V A;  4XMY A;  3BLY A;  3EUA A;  2AQE A;  1QHG A;  2R7W A;  5FRO A;  1DGW Y;  3DQV C;  1Y56 A;  3H0D A;  4N4O B;  4NQW B;  4B48 A;  1WJC A;  1R6R A;  3PNV A;  4IKF A;  4DBR A;  3BC8 A;  5HNH A;  3HOT A;  2V9K A;  3DU6 A;  4F52 A;  4NUB A;  2WAE A;  3RSN A;  4HST A;  4IQJ A;  4XON A;  4XOT A;  3VSL A;  3MKY B;  2W4S A;  3HC7 A;  4XLA A;  3EUK L;  2OC6 A;  4XLH A;  2F5V A;  1QU3 A;  4ZDP A;  2VJ4 A;  2WA0 A;  2VLA A;  3OWT A;  4FAS D;  4HRI A;  4PUS A;  3OYB A;  2RQQ A;  3AFH A;  4C9Y A;  1WJA A;  2LOO A;  2JSP A;  2IS2 A;  1D0X A;  3K4L A;  3UNG C;  2E5N A;  3L2W A;  2CV2 A;  1WJD A;  4ITV A;  5HNF A;  2M7B A;  2W7N A;  2V4J C;  2VQC A;  2NOJ B;  1Z3X A;  4CCL A;  3OYF A;  3LSI A;  3U21 A;  3VWB A;  2CUJ A;  2WAF A;  1NG7 A;  3K10 A;  2ZSH B;  3K6G A;  4BJT A;  3DKY A;  4BQN A;  1N75 A;  2V1N A;  2XF5 A;  3PFY A;  4PSX A;  4E7L A;  2JVH A;  4YRV A;  2GOX B;  3AKZ A;  3OYH A;  3TBI A;  4F3Q A;  4BE1 A;  5HLT A;  5FRN A;  4PFP A;  3OYJ A;  1DP3 A;  3OOU A;  4BE0 A;  4LIV A;  4XOP A;  3SEZ A;  3QYE A;  3LMM A;  3OL3 A;  2M0M A;  1T95 A;  2CW7 A;  4MLO A;  3QYF A;  3LSM A;  4EAT A;  3OYM A;  3CJQ B;  4XR6 A;  3LL7 A;  1QHH D;  2AQF A;  5FRM A;  4CCM A;  2BW3 A;  3FHN A;  3CMM A;  1WJ5 A;  2R4G A;  4PJN A;  2L9N A;  2CH0 A;  3A4C A;  3MD2 A;  2IXS A;  4QPO A;  4XLC A;  3KYL A;  3VYS B;  3E1S A;  3PNT A;  2IS6 A;  3W3C A;  4F92 B;  4E7K A;  3H5A A;  2Y0S A;  3BCB A;  2LYC A;  4N4N B;  1X4O A;  3HKZ A;  4CCK A;  4FET A;  3SDB A;  2PJR B;  2VXD A;  2DJI A;  4P1W A;  4PJL A;  5KCM A;  1WJB A;  4II3 A;  4OAZ A;  3EPZ A;  4CUG A;  3S3O A;  2R7T A;  1LFP A;  2VKH A;  3PL8 A;  4QPQ A;  4J00 A;  3HPH A;  2I8D A;  4HPQ A;  3ZXS A;  1X1D A;  4BQO A;  2XAU A;  2LY1 A;  2VIX A;  4G6T B;  3K4B A;  1K6Y A;  2X6X A;  3CES A;  2KHM A;  3VYU B;  3S3N A;  4ZYA A;  4LIT A;  3D5S C;  4ANJ A;  2K5C A;  3DLA A;  1BR2 A;  4RM2 A;  4HEA 2;  3DPT A;  3H9Q A;  1PJR A;  2UWM A;  2HNH A;  5LFA A;  3DWL E;  3FBN B;  3MKW B;  2KPM A;  3KEY A;  2XDV A;  4B47 A;  2Q2E B;  4R79 A;  1X19 A;  4C2T A;  4BGD A;  2CS3 A;  1P9Q C;  1PYV A;  2MD0 A;  2DT7 B;  2MYS A;  5HOO A;  3KX2 A;  4HNU A;  1ERD A;  3H9G A;  2BVM A;  2O5R A;  3PNY A;  3SZG A;  3DEE A;  1YX5 A;  2VL8 A;  5CQG A;  4F91 B;  2E1M C;  2X6Y A;  2E1M B;  1WJF A;  3HG9 A;  3OS2 A;  4KIT B;  4CA0 A;  2MAB A;  2X1D A;  3SYT A;  3ZQQ A;  3TL4 X;  2DT6 A;  2Q1Z B;  4OWR B;  2BW3 B;  4XN3 A;  1G8X A;  4Y4R A;  3PUB A;  3F9K A;  2LBF B;  1W36 D;  4LIU A;  2L5Q A;  3K4J A;  3V42 A;  1YE9 A;  1E0E A;  3I9V 2;  2WBM A;  1X1A A;  1YX3 A;  1U0J A;  2X6W A;  4BJ6 C;  3CZ6 A;  5CQE A;  4BXF A;  4BEH A;  3K70 D;  3C2G A;  3OYA A;  3CP2 A;  3LSK A;  4CCJ A;  3ZR8 X;  1SFK A;  3DTE A;  3LSG A;  5JHF A;  2V6E A;  1BR1 A;  2IGO A;  3BCA A;  3HXL A;  2W1O A;  1D0Y A;  2LG4 A;  4E7S A;  4PJM A;  3N05 A;  3FKJ A;  2KL4 A;  4U87 A;  4CH7 A;  2HVQ A;  4E7Z A;  2M4K A;  4D1Q A;  2M7A A;  2VXZ A;  4JOM A;  2VQG A;  3OYK A;  2HVS A;  2HZD A;  3S32 A;  4BEH B;  1HA8 A;  1KON A;  1FMV A;  2E5Z A;  2V7F A;  2IGN A;  2RNG A;  5CPR B;  2OV7 A;  4C30 A;  4AU7 A;  5KHD A;  1DGR M;  4XLF A;  3W2A A;  2IS1 A;  4AVZ A;  2VB6 A;  4BDY A;  1X1B A;  2ZFU A;  3NWS A;  2K9L A;  3G2B A;  3DKX A;  3OYD A;  2F6C A;  1GLN A;  1V5G A;  2KRC A;  4XN0 A;  3SEQ A;  2W00 A;  1TZL A;  3D5R C;  3K4K A;  4F93 B;  3K4N A;  1ZEL A;  3OS0 A;  3EUH C;  2VJ5 A;  2LY2 A;  1Z3Y A;  3CP8 A;  4XNF A;  2QKL B;  1MMG A;  4NNJ A;  2R7O A;  2JVG A;  1Z21 A;  2XSJ C;  4J01 A;  4B3X A;  3OYI A;  2VQH A;  3TMO A;  3J7A Y;  3L2Q A;  3ZCO A;  2F4I A;  2JA2 A;  2R7R A;  3M1C A;  4E7I A;  4XKB A;  2A5W A;  3K4M A;  2KLO A;  2JUG A;  2CV0 A;  3E0J B;  4BJ5 C;  1D1B A;  3OS1 A;  4E6K G;  3PJR A;  4KJZ A;  1BR4 A;  3DU5 A;  1J09 A;  2KQR A;  1D1A A;  2VAS A;  2HQA A;  3IUO A;  2VQL A;  4E7J A;  3K4C A;  3L2U A;  3OIQ A;  4HG2 A;  2DOA A;  3CJR B;  2L2O A;  3A2K A;  4RLF A;  2KDO A;  1LDK B;  3NWT A;  2WY7 Q;  1AA7 A;  1OR7 C;  3W2W A;  4PSW A;  4CCN A;  3ZGK A;  3OR1 C;  2DCE A;  3OL4 A;  3ZRG A;  2KP6 A;  1EA3 A;  2KRH A;  2ZXH A;  4XLE A;  4E4H A;  4BU2 A;  2DXI A;  2CFO A;  4AYB A;  3OIP A;  2LRD A;  2M3A A;  1SAU A;  1V5F A;  2Z2S B;  4KT6 A;  4BUP A;  3OY9 A;  1IRX A;  1TT0 A;  3BG7 A;  4U7B A;  2R7U A;  4P5O A;  2LRE A;  3VSK A;  2K9M A;  3QOD A;  4CZC A;  3VYT B;  1JI8 A;  2MC4 A;  4KIS A;  2IGM A;  1MMN A;  1W36 C;  5KNL A;  2MFZ A;  2K3P A;  3I3L A;  3DTI A;  4RLQ A;  2P0W A;  1N78 A;  3DPU A;  1MMA A;  3S3M A;  2LC2 A;  3DTK A;  3DPL C;  1NG6 A;  3CF2 A;  4XKW A;  1VZ0 A;  2RRE A;  2WY8 Q;  3K70 C;  4BE2 A;  4PFO A;  4XKC A;  4ZTJ A;  2L7K A;  3A1Y A;  3H35 A;  4Y3O A;  2VJI A;  5HVQ C;  3IP4 B;  3HPG A;  3RCO A;  1MW7 A;  3ONQ A;  3HOS A;  1BOB A;  4XOR A;  4BL0 B;  4DIQ A;  3C2H A;  2X51 A;  3BG6 A;  1G59 A;  1MND A;  4LG3 A;  1FMW A;  5TGT A;  4II2 A;  4PJJ A;  2IS4 A;  4GRI A;  2R7S A;  4F55 A;  1X4P A;  2VJJ A;  4E7H A;  3MMY B;  4CSW A;  2R7X A;  1UAA A;  4B44 A;  4C2U A;  2A6T A;  2HPI A;  4BS9 A;  3PSF A;  1OLT A;  1WJE A;  4X0G A;  2CV1 A;  4HNT A;  2Z1D A;  2HU9 A;  2CUZ A;  2XC7 A;  3AL0 B;  3AL0 C;  3RQ4 A;  1WFX A;  4DJA A;  3MKZ A;  3D5L A;  4JQF A;  2R7Q A;  3S8P A;  3OR2 C;  3W2V A;  2UV1 A;  2VPL A;  3IAS 2;  3QOE A;  3H5N A;  2CMP A;  4NC8 A;  4B43 A;  1D0Z A;  2ELJ A;  4ZJZ A;  3H5R A;  4PK4 A;  1MNE A;  3LSH A;  2FUG 2;  2QKM B;  1LKX A;  2CW8 A;  2WAD A;  4RM3 A;  3GBG A;  3OYC A;  1UG0 A;  4IQ4 A;  3L2R A;  4DOZ A;  3HUG B;  5LD2 C;  4YEL A;  3HL2 A;  3IAM 2;  2X85 A;  4XQF A;  2W82 A;  2OUM A;  1D1C A;  2BVL A;  2HDW A;  2WAQ A;  2R7V A;  2XF6 A;  2V26 A;  4NC7 A;  1T0F C;  2Z16 A;  1Z7L A;  1DQU A;  2E60 A;  4RMN A;  1N77 A;  2X1C A;  3OYN A;  1UEL B;  3RPU D;  4BDZ A;  4D9J A;  2UUZ A;  2LBF A;  2KMU A;  2HPM A;  5CKT A;  1V5E A;  2PMZ A;  2M4G A;  4XKV A;  4BQQ A;  2X1E A;  4OAY A;  2IGK A;  3OYL A;  4XM3 A;  4IX7 A;  2ZXI A;  4DBQ A;  1LVK A;  2GOM A;  3H9J A;  3M8J A;  4DGW B;  4H4K C;  4CCO A;  2WB1 A;  3VYR B;  1Y6I A;  2L9S A;  2ZSI B;  3LFU A;  2XF7 A;  2LH9 A;  4HSR A;  2HVR A;  2PJR A;  3FBI B;  2VKD A;  4IZZ A;  3PSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...