3G2BA

Crystal structure of pqqd from xanthomonas campestris
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
TISRDSCPALRAGVRLQHDRARDQWVLLAPERVVELDDIALVVAQRYDGTQSLAQIAQTLAAEFDADASEIETDVIELTTTLHQKRLLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein D
publication title Xanthomonas campestris PqqD in the pyrroloquinoline quinone biosynthesis operon adopts a novel saddle-like fold that possibly serves as a PQQ carrier
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Biosynthetic protein
total genus 21
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05402 PqqD Coenzyme PQQ synthesis protein D (PqqD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3g2bA00
3G2BA
chains in the Genus database with same CATH superfamily
3LSMA 3V7RA 1USTA 3CCLI 1R7JA 2AQEA 2XAUA 2Y69H 1H88C 1PUFA 2Z2SB 3GZ6A 2DMQA 4Y52J 1XTAA 3VPRA 3DFGA 3MFKA 4Q48A 2L0KA 5K7ZA 4WX9A 1VQ4I 4LLNA 3P7NA 5IYDJ 3K69A 1GXPA 4BXFA 1IG7A 3OYHA 1ODDA 2XIGA 1K4SA 4OWRB 3OR2C 3LAJA 1WVRA 2KRFA 2RREA 3E6DA 3B6AA 1BL0A 4ZYEA 3F6OA 3MN2A 2QVOA 4QLCU 4U7BA 5K7FA 2OZ6A 3CDLA 1OCCH 3TW6A 3GTJJ 3CF2A 1BA5A 1KQ8A 4HYEA 1R1VA 4QTRA 3E6BA 2IA1A 2EB7A 1XGOA 3S1RJ 2E1MC 3C2HA 2WAQA 1TQIA 5ILUA 1W5TA 3ZN0A 2UXNA 4XL9A 1P9QC 5A2QK 2R7VA 3JAMZ 3WTUC 3DCFA 2R7ZJ 3LAPA 3JSPA 3ECOA 1D8JA 1XPXA 1V5FA 2DA5A 2DI3A 2DYSH 5DDGA 2XPWA 2NNYA 3LWFA 1B9NA 2A05A 3BZCA 5HODA 4Q4ZF 1YQAA 2WV1A 2IXSA 1OR7A 4XLCA 2HI3A 2LRDA 3GFJA 4E7LA 5L3DA 1U8RA 3HOTA 4ZZLA 4HLYA 4G8XA 3A01B 1T0FA 4I76A 1I39A 2VJ5A 1HW1A 4CO8A 2K02A 1P4XA 1MNDA 2ACJA 3WTSC 5ICGA 3E5XA 1V5EA 4C3IJ 3BG3A 2ELJA 3G1LA 3GO5A 3DV8A 3CUQA 1D1AA 3FM3A 1RKTA 3E5UA 1TC3C 4AM3A 2JA2A 2DODA 2QKMB 1WPKA 2ZBKA 3EUAA 2OCCH 2BV6A 3BR5A 3IL2A 1S8NA 3HUGB 1QO0D 4M3EA 3OYEA 4Z2YA 4ZTFA 1ZRDA 1BW5A 2HS5A 2KMUA 5FKMA 4E4HA 2VXDA 1IW7F 1YYVA 1Z91A 5IP9J 4BL0B 5F0CA 3V42A 5EG0A 1PJRA 3A03A 3J80Z 1H0MA 3E6MA 2Y75A 3DWLE 4BQOA 2MSYA 2PG4A 3O3KA 3CCJI 2UXXA 4BXUA 4GGGA 5LEJA 4FQGA 2BZTA 2IP2A 5DUKA 4AU7A 1LVKA 4B48A 1QZYA 2CQXA 3U21A 4ASNA 1LDKB 2DFHA 3EYYA 4A5MA 3HM5A 2J5OA 2L4MA 3SZGA 1ONVA 4G6DA 4CXFA 4JX6A 5EEGA 5JHFA 1KONA 2XV4S 3E97A 4OAZA 4D5FA 2K4JA 2G9WA 2DJIA 2ESNA 4NBQA 2ZFUA 4U0VA 3HG9A 4JK1X 4PDKA 1MNEA 3TOBA 1QA6A 5HNHA 2P4WA 2B63J 3KYDB 3H9QA 1J9IA 3W6VA 3BG7A 3EUHC 2MBFA 4HV6A 2XAQA 4B09A 3ABLH 2DMTA 1FOXA 1J75A 2YPRA 4XN3A 4LMYA 3CLQA 2VODA 3UKGA 1JKQC 1KYZA 3GUDA 2CQQA 2R7QA 3PQKA 4KT6A 3BDDA 1YI2I 4IHVA 1I5ZA 1A04A 2QENA 4IF4A 2CO5A 2HQRA 3OSGA 2W85A 4L5EA 3HPGA 1Y1WJ 1AKHA 1ZGAA 3SYTA 4U0WA 4HQMA 3W3CA 5KAIC 3BTCA 1L0OC 5D5UB 5EZGA 1X4OA 4EJOA 1WJBA 2E60A 3HGYA 4PCQA 1FTTA 3MKYB 1VQPI 4CCLA 3U2RA 2JPCA 4B1RA 4DW6A 3BCAA 4M3GA 1CF7B 1BW6A 2JJ7A 3BR2A 3WGIA 4HZFA 4UY8I 1K79A 4MNUA 2QA4I 1XMAA 2HDCA 4HRIA 4XN0A 3DPLC 2EZKA 2EILH 5H2FC 1B72A 5EYRA 4PFPA 5CVJA 3M4OJ 2STTA 1R9TJ 3VFZA 4EJWA 1JHHA 1I50J 3EETA 2VBZA 3R6SA 3MMYB 4KMFA 1HXDA 2CYYA 3S17J 1QZEA 2QUFA 4L5JA 2YSRA 4RAYA 3RIRA 2HNHA 2KP6A 4HF1A 3J80K 1J0RA 5CVRA 2IT0A 2Y0SA 3JRAA 4K2EA 3Q9VA 3W6JB 4A3IJ 1O3QA 3KEQA 4IRIA 1EH6A 5CJ9A 4HSRA 1F43A 4ZDLA 2DYRH 3QPLA 2EQRA 2I8DA 5J47A 3DKYA 4M74A 2QKLB 5DCMB 3W2VA 3HTSB 2ZCWA 3D5SC 3F23A 3CMMA 3KEOA 3FMSA 2HPMA 1J7KA 2D5VA 3CTAA 4PSXA 3MAJA 2KT0A 2A68F 1AU7A 1Y8QB 3M7GA 2NOJB 2P6TA 3H3ZA 1NG6A 5TJJA 3BR0A 2ID6A 1YLFA 4CICA 3QP5A 4QPQA 1R22A 1R1UA 1N77A 1OCPA 1LKXA 1STZA 4RM2A 1X1BA 2FBHA 3TW7A 5IY5H 2MFZA 3BG9A 1D0YA 4A3DJ 2TCTA 4E70A 3KZYA 1P4WA 3K9TA 4L9JA 3HL2A 1G4DA 1UJ8A 2IJLA 2DO7A 3J7AO 3ABMH 4WF2A 3T5XA 1TWCJ 3IKTA 1W7PB 1ZN2A 2HKOA 4H4KC 1TL8A 1W0TA 2HR3A 2RV8A 1OISA 5L3FA 1K78B 3QPHA 3ZMZA 1Q1VA 2M45A 3RPQA 3SDBA 4MO7A 1BR2A 3NWTA 1F1ZA 3TP0A 3CCMI 2FNAA 2LH9A 5ILVA 1SFKA 5HOOA 2AQFA 3GZ5A 3HRTA 4LIUA 2R7WA 5LGUA 1XDUA 2EZHA 2KIMA 4RLQA 3PNTA 4FHTA 4P9FA 3N05A 1TT0A 5F08A 4LK1F 1GXQA 4BY7J 3MZHA 3SZTA 2W7NA 4HNUA 3BJAA 1U2WA 1FYMA 4LB5A 5CQEA 3S3OA 5JLXA 2LP0A 1YG2A 3L2QA 3QU6A 3FDYA 2XAHA 3C1DA 3VYTB 2JUGA 4S04A 1GV2A 5E3LA 1ULYA 4EVIA 2XGDA 5CVUA 2NXNB 1E3PA 1LB2A 2OU2A 5EEAA 2LOOA 4NDLA 2V6EA 1S9HA 1U8BA 1B4AA 5D5VB 1PP7U 4NQWA 2XHKA 4XQFA 3QQAA 4BXXJ 3L00A 4NB5A 2V9PA 3ML6A 5JHUA 1WH7A 2H8WA 2FXAA 3BC8A 4UUSB 3LMMA 2QF7A 1WGXA 1GHCA 1OQYA 2JN6A 3A1YA 3G3ZA 1RC9A 2ME0A 4NC7A 2M3AA 1NG7A 3TDUC 2JA6J 5ICFA 1T0FC 2PQ8A 2BY2A 2HU9A 2VKDA 5D6FA 5LRSA 4AIJA 4ZYAA 2XPUA 1FY7A 1KU9A 2HOTA 1YW9A 2LMDA 3GWZA 1VQ6I 1S7AA 2J5PA 3MZYA 4I0BA 4YEJA 4CCKA 1EV7A 1YJWI 1LDJA 2M0MA 1BIBA 4V2GA 4RB3C 4Y13A 2L7KA 3ERED 3KP6A 3ZP5A 2NOGA 5D8LB 1FWZA 2RQPA 4F91B 1LFUP 1Y8RB 5EEHA 5LD2C 1FPQA 2JSCA 4IHTA 3I58A 3RPUD 5HDNA 2KDOA 2WADA 4C3HJ 1YRNB 3BT9A 2MYSA 3OYDA 1R71A 5E8IA 1Z6RA 3FXUA 2I10A 5FO5A 2O3FA 3L9FA 3K4JA 4A3LJ 2HZTA 1VQMI 3LNQA 2K9NA 5E18F 5JLWA 2VQCA 1ZG3A 2DMPA 4A12A 3K0LA 5AIQA 3JRHA 3FXRA 4DZPA 1DU6A 3K4CA 4UB8C 2R7UA 3LA2A 3GTQJ 3MEXA 2HVQA 3LFKA 3MKWB 4PSWA 4DIQA 5IOYA 3ZMDA 2IGMA 3FXOA 1B6AA 3LSIA 4CSWA 4MIMA 2BGCA 2QM3A 3I54A 4BAYA 4IHWA 4Q5SF 4AUXA 1Z9CA 2O5RA 2QSFX 5H6QA 2E1CA 4HBLA 4BKXA 2NVTJ 3WTZA 4NHJA 1TWFJ 3QWLA 2B7EA 3BJ6A 3NARA 3SHFA 3HOUJ 3HSEA 1U6GA 2NS7A 1Z6TA 5M3MJ 4WXDA 2H8RA 5B1BH 1KQ0A 2KZGA 5BMZA 3DBHB 2D45A 4DQ2A 2A3SA 3IH2A 3GZNB 2DLLA 4XRFA 1MMNA 2X0LA 4XRSA 2QEXI 2FF4A 2L7MP 2BBYA 1YX3A 2EINH 3BLYA 3M8EA 6PAXA 2OCEA 4B3AA 2DOAA 4HNTA 4CHUA 1WH5A 3AG2H 1I6XA 2Y48A 2XB5A 4BE1A 4CGZA 2UUZA 1P4AA 5FB2A 4DJAA 2VKVA 3LOCA 2DT7B 2M30A 2BW3A 2L9VA 3TBIA 2UZKA 3ESWB 1LEBA 5B3SH 2ZKZA 2VKHA 1YHQI 2PJRA 1JJ6C 3FXJA 4KN4X 1Y6IA 2XAJA 4XLPF 1MJBA 1YO5C 2JUCA 2ADUA 3CDIA 4KUMA 1HKSA 3Q0WA 5ICCA 1D1BA 4HW0A 2HEOA 1G59A 4M73A 2DFFA 4N9IA 5D4SA 1MBEA 2PMUA 3MVPA 2RN7A 1FZPB 2NS0A 1REPC 2MABA 1U5TB 4JQFA 3IV5A 2K9SA 4HAMA 1U3EM 1JE8A 2E7XA 2Z5UA 4L5IA 5FRMA 3L7WA 3DPTA 1QQIA 3H9JA 1JKPC 2ELHA 1JT0A 1IUFA 3I53A 2F48A 1NK3P 4IRHA 3H5NA 5J4VA 4OU0A 2GQQA 2P5LC 1J2XA 1PDNC 4YFKF 3VEPA 3CCRI 2JMWA 3OL3A 2BHZA 1TW3A 4KITB 1FC3A 3SXYA 2A61A 2MH9A 3DEWA 1TP4A 3DLLF 4I7HA 4XLFA 2JA5J 2LG4A 2LDUA 2WC2A 1E3OC 4LK0F 2A6TA 4ESFA 4A3EJ 2H1LA 2EFWA 3N97A 2FOWA 1XSXA 5JVTA 3WG9A 1B8IA 4M3BA 3GLXA 1FP1D 3TL4X 4QWQA 4DZJA 3NQOA 1SD7A 2V1UA 3O6BB 4H0EA 2AXLA 3K4MA 1IXSB 5JR3A 5EF6A 1RRJA 3L09A 4HX4A 4IVNA 2RKHA 4UUVA 4YFNF 1JTXA 3H35A 1UG2A 2GIZA 1FIPA 1ZYRF 4ZTJA 2P8TA 3FXLA 2C6YA 2EK5A 3WE3A 1O3SA 4P5OA 2VT2A 3KPHA 3L1PA 2W82A 2VN2A 1Y56A 1ON1A 1QBJA 3DTEA 3KP3A 5M3FJ 4KA4A 2ZJ2A 4G6TB 4II2A 2QSHX 1VQ9I 2ZXJA 2DAOA 1FIAA 3CJQB 5IYCJ 2M8EA 2LREA 2ZMEB 4XKVA 3TMOA 5DM6F 4S05A 4S0HB 4BNCA 1U9OA 2DA2A 4OIPF 3K6GA 2GIVA 1YITI 4HDVA 1MH4A 1RR8C 3WU2C 2ZO4A 4A5NA 2R5YB 3F8NA 2CQNA 1G3WA 4M71A 1YX5A 2KIFA 1IJWC 1YRNA 3CC4I 1W36C 2WB1A 3BTLA 2JVHA 1JT6A 3F21A 5E8GA 3BQYA 5F0FA 3JR9A 4UXNA 4XONA 5C4JJ 2YX4A 4G7OF 3TEDA 1Y0NA 2F2EA 4JX5A 3LSRA 2GA2A 2CV2A 5K1YA 3G73A 4FX4A 2CV0A 1LNWA 2DBBA 4A3FJ 3VWBA 4OIOF 2X6YA 3IRRA 2QSGX 3TOAA 3VYUB 1JGGA 1TNTA 4F93B 3L2VA 1YTYA 2HPIA 3OIQA 3FXMA 1DU0A 4P96A 3GMEA 2JRMA 2NVUB 3CCVI 3RPUA 3V8KA 2IS1A 1O57A 1Z3YA 3OIOA 4JOMA 4I0AA 3RKXA 3KZZA 2P81A 2WV0A 3FK6A 1KU3A 2FMYA 3CJRB 1VFCA 1FP2A 2R7TA 3WHCA 2W1OA 2BY1A 1ETVA 2E1NA 2XKOA 2DTZA 2M34A 2XUBA 4RBOA 4MEXF 3M1CA 3RKQA 1UZCA 3BQZA 2LBFB 3ROUA 4XIDA 1XS9A 4XRSG 4CYCA 5LGNA 4M6YA 3LFUA 4ZYHA 2ECBA 4A0YA 3VSKA 4EM2A 4PK4A 2PJPA 2V1NA 1S7OA 4HOBA 1O3RA 1W0UA 4PJJA 1Y1VJ 3K1PA 3H1CA 1Z05A 4FT8A 4AWXB 1E17A 1VQOI 4BU2A 5FLMJ 3CQZJ 2X6XA 3GTGJ 1WJCA 1W36D 5HS9A 2LYCA 3OYFA 2IVMA 2IGOA 2BEOA 2X1DA 2CUJA 3I71A 2DTRA 4MHGA 5L3EA 1IN5A 2MLGA 1TZLA 1FMVA 1K7AA 4ENMA 1IRFA 1SD5A 4ON0A 3AL0B 5E3NA 4WK8F 4N4NB 4LG0B 3BZ6A 1T95A 4CUGA 3I59A 3TDZC 4F52A 5GAEJ 5BPIA 4JX4A 4IO9F 5LHIA 1XD7A 2M4KA 1Q1HA 5L3BA 3TQNA 4KMUX 1TQPA 5DV5A 2PN6A 5DYMA 4L0ZB 3A0HC 3PM1A 4G9YA 5FFXA 2KQRA 4LLLA 4BYYA 4RGUA 5DD8A 1LUJB 3BR1A 3BY6A 3GVAA 3HBLA 5E1XA 4DOZA 3HOVJ 2OTLI 1Z67A 1X58A 3OYJA 4XORA 2EV6A 5GTHC 4QSHA 2RQQA 4BHBA 1NHAA 4EGYA 2LLKA 3Q0UA 1QRYA 2EFOA 2GXAA 3U1KA 1HDPA 2LTPA 5GPAA 4M9XA 3HKZA 3TKYA 3H36A 4IHSA 3DEEA 1T33A 4B4CA 1MDMB 1JUMA 2JZYA 2DQRA 1APLC 3GLLA 3CO6C 2LKXA 1N25A 1K6YA 4BGDA 3S2HJ 3H5RA 5GPCA 5J4YA 1XDSA 4XLEA 2DXIA 5FRNA 2QQBA 1LE8B 3K4BA 3T1BA 2VC0A 2FNPA 1YFHA 3WHBA 5F64A 3C3WA 4X1EA 1FSHA 3ZR8X 1PYVA 1MZBA 4HA8A 1X1CA 1KYWA 2K9MA 1T98A 2P7VB 2XRNA 4GO1A 3OS0A 3BCBA 3GFMA 5LBQA 3G71I 1XMXA 3AKZA 1LDDA 4WXHA 5D8KB 4CZCA 3CMYA 1Z21A 3ZQCA 1T2KA 2M87A 4L9VA 1FOWA 4I6ZA 4HF0A 3U1DA 2M1BA 1RKWA 1ZH5A 4GYGA 4RS8A 1YIOA 1JUSA 2PMZN 1ORKA 2DJNA 2VI6A 2O03A 4P1WA 4PFOA 3L2RA 3Q5FA 4RAFA 2OZUA 2L9NA 1OJLA 2BVMA 4U0YA 2ZMEA 1NH3A 3M1EA 2Q2EA 5KNLA 2H1KA 1FX7A 4CCMA 1P7IA 1RI7A 1XGNA 2FE3A 1D0ZA 2WA0A 1H9TA 3ULQB 1SFEA 4XKWA 3L2CA 3FXKA 3IH4A 1UFMA 2DA3A 1ZKGA 2ESHA 4PGHA 5ED4A 3V7CA 2KDZA 4PUSA 1UHSA 2DMNA 1OMIA 3PUBA 3ZMSA 3D0SA 1BIAA 2FMLA 2M8GX 1HC8A 3VOEA 3OYBA 2Y2ZA 1I1SA 4BJ6C 4UB6C 2H09A 4XLAA 1DDNA 3HXLA 2O0YA 5M5YJ 4BHPA 2YX7A 4RB2C 5D4RA 4D1QA 2CWEA 3CD6I 3R61A 3S2DJ 2DU9A 3M3YJ 2BE5F 3PIPF 2R7FA 1T8IA 2FJ1A 3BG5A 2DOEA 1L3LA 2MC3A 3E1SA 2XF5A 3D5LA 2I5UA 4CYDA 3HTUA 1O4XA 2ZJPF 1SVOA 4IXAA 2V9VA 2Z16A 1UMQA 3PQJA 2XPVA 1ZG1A 4A93J 2V7FA 4BQNA 1OCZH 1W7PD 2GZWA 2JSPA 2HOSA 2HQNA 1DGWY 5FROA 3PSIA 1UG0A 2KJBA 5DD4A 5GADJ 1K61A 2O8XA 4E7IA 2VJIA 3JCUC 3H3VK 1HCRA 4BACA 4CZZA 3P9CA 1YE9A 3EYIA 3MKZA 4G7ZF 3WTTC 4MTEA 2W48A 3LQRA 2BY3A 2COBA 1D5VA 2PX9A 1WZ2A 1LPQA 2ZNYA 1TW2A 2IA0A 2Y9YA 1BC7C 1DP7P 1T38A 3F72A 2V1DA 2QBYB 1X3UA 2F4IA 2EZIA 4MQVA 1WRJA 2EV0A 2R7OA 3M9AA 1QPIA 1WI3A 2X1EA 4EV0A 4IQJA 5FLXZ 5LFAA 2VB6A 4G7HF 3E0JB 3KX2A 2NAZA 2P6SA 2GOXB 1GVDA 2M2EA 1IV6A 4NC8A 4YRVA 3A01A 5HLTA 1IN6A 3JRFA 2YU9J 2QLZA 1I27A 3K10A 3SQNA 5IP6A 3FISA 3FKJA 2A6HF 2OUMA 3WU0A 4Y7NJ 3WODF 5J6XA 1R36A 1PUEE 4O3MA 1WSUA 5CQGA 3ISPA 5EZHA 1Z0XA 1VI0A 2XC7A 4LOCA 1V55H 3OYGA 4EQQA 3F9KA 4EMSA 3QYEA 3I9V2 4B44A 2R3SA 1MNMC 1W1WE 3LSGA 1VQ7I 2HYFA 2VL8A 5D5WB 1JGSA 1R4NB 4FE7A 2BY0A 5GAGJ 2GXBA 2L01A 9ANTA 2R5ZB 1D0XA 4AYBN 3B6CA 1NTCA 3HUGA 1G2HA 1HKQA 4Y3OA 1SFOJ 1YJNI 3BG6A 2STWA 2IGKA 1X1AA 3I4PA 1IN8A 1ZGJA 4A0ZA 1ZHFA 2H6CA 3NWSA 1RZ4A 1FTZA 2YS9A 2XDVA 4ZYGA 3KCCA 3K70C 4DBQA 1WJEA 1OCRH 4GXOA 4DGWB 4CCJA 2IS2A 1OLTA 2EA2A 1SD6A 3RQ4A 4M6VA 3ZMTA 1H9GA 4GDFA 3S1QJ 1SVMA 1SAXA 4UUTA 4IHXA 2VLAA 2E5NA 3RKYA 3LSTA 4B47A 5E1WA 1LJ9A 4E7ZA 1YJ9I 4RB1A 5FKLA 1JUPA 1G6NA 2F5DA 4OINF 3ASNH 4B3XA 2HDWA 3BPVA 4OIRF 3LSKA 5DUIA 2NS8A 2EWNA 1Y39A 2JA8J 3I0TA 3OY9A 3ZQFA 5KAFC 1P92A 1SMYF 4BE0A 3KEYA 1ETYA 2E2HJ 5CYVA 1VF9A 2K40A 1A6QA 4BJ5C 1TQMA 2F5CA 3ECHA 4Y15A 2HXIA 3DBRB 3DQVC 1ETOA 3CC7I 2OAZA 4D5CA 3A02A 4RGRA 4G12A 4XNFA 1U5TC 3WU1B 1EF4A 4IOCF 2Y30A 2AHQA 3G1OA 3L2WA 3WGGA 5F6FA 2CS3A 1SANA 4CCNA 2E19A 3RKWA 2M5WA 1OYYA 2WBMA 5FLXK 2G7UA 3M8JA 4UV9A 2D1HA 3C7JA 4C30A 3HHHA 2Q0OA 4NC6A 4FX0A 4ABZA 3H3UA 3T0YA 3SFZA 2EZLA 4LD5A 3HHGA 1XN7A 3FXQA 4Y33A 4YELA 4I09A 4XBFA 4LITA 4M6XA 2H27A 2NVXJ 4DYCA 5HVQC 3JTHA 3ZPLA 4ZDOA 2VJJA 3K70D 2WAQN 1ON2A 1KU7A 5BNGA 4BDYA 1X2MA 2X1CA 4IRGA 3S1NJ 1CF7A 1HQCA 3KYCB 1Z3XA 2EBIA 1BM9A 2ECCA 2MA3A 1H89C 2MGQA 2Y31A 5F1JA 5JVGF 1IZ1A 3O2PE 5EGOB 5BPDA 2CG4A 1RESA 1O3TA 1OCTC 3DP7A 3QP6A 4M9ZA 2HDDA 3IC7A 5K7HA 3F0CA 5J1RA 2CGPA 3CCUI 2ZNZA 2PEXA 1TT5B 3OYKA 1LFBA 5FLVA 4HQEA 2R4GA 3K2ZA 2E2JJ 1XGMA 1WFXA 1M1EB 1JTYA 2DA4A 3D1NI 4G94A 3HPHA 5F04A 1PUFB 3CF5F 1NK2P 3UR3C 1LVAA 3HYIA 2VQHA 5L3CA 3EPZA 2P5VA 4Y4RA 3SEZA 1HW5A 5M5WJ 5B1AH 3K4KA 2FU4A 3S1MJ 1O7LA 2IAIA 2PMZA 1IO2A 4HG2A 2A07F 2W24A 3DKXA 1MGTA 5DEQA 1J09A 3HRMA 3OYNA 4KFCA 2E35A 1KGSA 1BJAA 3OR1C 2LFBA 3PFYA 4W97A 4AVZA 2W00A 4RM3A 2ZMEC 3C2GA 5DCMA 3M07A 3TP3A 3ZQ7A 2L02A 4D9JA 3FKIJ 1AWCA 4NNJA 4BDZA 1BOBA 2TDXA 3F8MA 3LSHA 2FA5A 2FD5A 2KHMA 5E79C 2MLKA 5IP7J 4FCYA 3KP2A 4UVAA 1T6SA 2EFNA 1XSVA 1ZLKA 3HSFA 2V26A 4FTHA 2Z99A 2Q8KA 1X1DA 1ZR4A 4R1HA 2HTSA 1JXSA 4EJVA 2WTEA 4ESJA 5GP9A 3CESA 3E7LA 4AIDA 1OKRA 5CPRB 1W7PA 2RC4A 3E3VA 1OFCX 3MZ8A 5LHGA 1Z1DA 1VZ0A 3IAM2 4I01A 4UHTA 3ZQLA 1XGSA 2L54A 1K78A 2DFEA 4PJ0C 2GAUA 3S14J 1FBUA 3RYRA 3WG7H 1ZELA 3CO7C 3BR3A 2OA4A 1MJ9A 2NNNA 5K5OA 1POGA 2TRTA 1I1GA 3GTMJ 3F6VA 4RA2A 2K5CA 3CUQB 3SJMA 3EQLF 4KIBA 2RGVA 3WE2A 3FF5A 1FT9A 3Q0VA 4EM0B 2FQ3A 2JK3A 1TTYA 2XF6A 4YIIA 4D0PA 2ISZA 1R49A 4CH7A 4A3CJ 3IUOA 2L5QA 1VNDA 4KDPA 2LSOA 2LKPA 2M9HA 3COAC 2VQLA 3GYHX 2FBKA 3TO6A 4IOAF 2VUMJ 3REOA 3R0JA 5EG0B 2CFOA 3AAFA 3KFWX 2HVRA 4XKBA 3EUKL 2KIQA 2HZDA 1YIJI 5FD6A 1X3WB 4A3JJ 2CW7A 2DPDA 2LY9A 1S5LC 3H5AA 4UVCA 5FD5A 3GCMA 4IL6C 5TGTA 2W4SA 5H20A 5HLIA 2XGCA 1S7EA 2RAEA 2XRLA 2V1XA 1YW8A 3CJTB 1WQ2A 4OAYA 3SEQA 4C3JJ 4UUSA 1IRXA 4E7KA 4XICA 2R92J 2HQ5A 3VYSB 2GM4A 1IN4A 4EJUA 2XAFA 4HNVA 1JKOC 2PFBA 3DLAA 1WHUA 5HS8A 3QOPA 2DMUA 3AL0C 4KYWA 4O6JA 2M0CA 4KIFA 3BOQA 4R8HA 4DBRA 2PBIA 3OS2A 2X9DA 4ESBA 5E3MA 2MG4A 3J81Z 4XR6A 4ENNA 2GBYA 3DKWA 5GAHJ 3A4CA 3O8GA 4A3MJ 2NRAC 4BUPA 1W5CC 3WTVC 3IWZA 4EJTA 3OYCA 5EJCA 4OIQF 3JRBA 1J5YA 2LVSA 4I98B 4JP0A 3I4MJ 1X1PA 4ZYDA 3JSOA 5L3GA 2O8KA 5IYBJ 3I55I 4O5VA 3ZQIA 1K83J 3HIFA 2AS5F 3B73A 1I6HJ 5LHHA 1AKHB 2EFPA 4F7ZA 3OMYA 5HLHA 3H9GA 4C2UA 3K4NA 1DQUA 1ENHA 4U88A 2VASA 3QAHA 4IQ4A 4YIFA 1A31A 3NAUA 1SVLA 2QWWA 2VONA 3CMEI 3CLOA 2B0LA 2BXYA 4MGRA 4FE4A 4R79A 2Z9OA 5C3EJ 4X6AJ 2MD0A 1ZQ3P 4DYRA 3I3LA 1QU3A 3ZMUA 4TV7A 1B72B 1V54H 1AA7A 1HOMA 2JWTA 2XSJC 3ZQHA 4HF2A 3PO2J 1SEUA 2ZJRF 4RB0A 4EM1A 1J59A 2IBDA 3HOWJ 1AOYA 3PNYA 2CRGA 5CVIA 3SDGA 1UELB 2VKEA 2E1OA 4F55A 3H92A 3WTYC 2DA6A 2E71A 5DS9A 5F0HA 2L9RA 3RJPA 3GXOA 3CUOA 2W25A 3J7ZI 2XF7A 1FLIA 1R4MB 1MSFC 3TGNA 3LA7A 2O9LA 2CUZA 2EA4A 5FKNA 4BHCA 1A36A 1E3HA 1KU2A 4BH9A 4KISA 1ETKA 2FQ4A 2XASA 1PVEA 1ZAOA 5D5XB 5E1ZB 3BZKA 3QODA 1HBXG 2VE9A 4XRMA 2V79A 2CUEA 1WCMJ 3HB9A 3QRFF 3S15J 2DT6A 2DW4A 1MBGA 1R5HA 1FBSA 1VQNI 1U78A 1LQ1A 3X2QH 3EDPA 2A5YB 3LQQA 3S32A 4G6QA 5F1RA 3FWEA 2KISA 4MTDA 3W2WA 2R0QC 2X85A 1UCRA 3ZQGA 3JREA 2CFXA 4M72A 2ELKA 1LEAA 3PIOF 1R23A 4A2UA 3ZRGA 3J81K 4XOTA 3BTJA 3KLNA 4B8XA 2VOPA 3G6EI 2ETHA 5IPAA 2Z3YA 5HDGA 1FMWA 2L7FP 1K4TA 1BI0A 1WJAA 4HSTA 5H6RA 3ZQQA 4UV8A 4ZZDA 4E7JA 1R58A 2XGXA 2D1VA 1B9MA 2VPRA 2AO9A 1EKEA 4LG3A 4ZH4F 1U5TA 3GTLJ 2WWYA 3HRSA 1SFXA 3ABTA 4XLHA 3J7YJ 2Y9ZA 1TNSA 5HDKA 4L0YB 3F8FA 1S6LA 1MBJA 4F3QA 5LEKA 1LFPA 1F4KA 1BC8C 1V4RA 3BWGA 1U9NA 1XC5A 2R7RA 2CH0A 5ILSA 1ZG5A 2BHYA 1IC8A 2M4GA 4BS9A 2EPFA 1GLNA 2YR2A 4U7DA 5FKOA 3MD2A 2H6BA 1Y0UA 1EH7A 1FOYA 1FSEA 2JT1A 2KRCA 3PNVA 2W57A 2LY1A 3T8TA 3F8CA 2VOOA 2LNBA 3ONQA 3P5JA 3CZ6A 2IRFG 4KNYA 4WXCA 5J8CA 3CCQI 2GOMA 1HDDC 2DDAA 2K3FA 2JRTA 1ZLJA 4D7MA 3S3NA 2HXOA 2V9KA 4BQAA 1P6RA 1HA8A 4MQ9F 1BR4A 3FHZA 2GXGA 3MKLA 3CDHA 3MQ0A 2MH2A 1FJLA 2K86A 1IV8A 1IXRC 5DTDA 4AIKA 3MWMA 4NQWB 3FX3A 4KIGA 1ITYA 2R7XA 2MW8A 4LFUA 4J00A 1XX5A 1R5ID 1ZK8A 1GV5A 3K4LA 2XVCA 5EDNA 1YS7A 1FYLA 1G8XA 3C18A 4E7HA 4HPQA 3IHUA 3WGHA 3CCEI 5FJ8J 3IRQA 2Q1ZB 2XAGA 1W5SA 2L7ZA 3A0BC 3F22A 4ENKA 1JJ8C 4CA0A 3VB2A 3CCYA 3VYRB 3ZN1A 2YUSA 2HWVA 1O7FA 4Y17A 3JRCA 4IHYA 1DP3A 4BBSJ 3GF2A 1RETA 1UHMA 4BE2A 1G3TA 2E1MB 4XK4A 4A69C 3JAMK 2R5YA 1PP8F 1CQTA 2JQ7A 2IA2A 2UWMA 3OOUA 1IUYA 3KLOA 2CSOA 4OMZA 5TRDA 1OCOH 3V8LA 5LLQA 2HYJA 2XROA 3C2BA 4YFXF 1QVTA 2LR8A 2FRHA 2KPMA 2QZ8A 3G1MA 3UNGC 1RUOA 3V7SA 1A6IA 4HX8A 3J7AY 1YS6A 2KLOA 2EFQA 1WJ5A 2A6EF 1F9NA 1MJAA 4HV5A 3BROA 1BJZA 1BN5A 2ICWG 4ZC3A 3RZDJ 1EJ9A 1SMTA 2ZSIB 1MMGA 1U0JA 2HYGD 1T08B 3DBLB 3ERMA 2VIXA 4II3A 2LF8A 3HOZJ 3KYLA 2XGEA 2PMHA 4J19A 5J1UA 3RCOA 3D5RC 2R7SA 3I5UA 2FX0A 3DU6A 3IWFA 3ZCOA 2HVSA 3AFHA 4ETSA 4PGGA 2PI0A 3E6CC 3KP5A 1V3FA 2OF7A 5C44J 4A6DA 4I2OA 2QCOA 4HX7A 2IS4A 1MBHA 2F5FA 2RDPA 2OC6A 3RTRA 3QU3A 1G3YA 3JRDA 2F5EA 3LL7A 5KVRA 2E7WA 3HOXJ 4QPOA 2CU7A 2L2OA 3OYIA 2VPLA 1IDYA 2X48A 1H8AC 2OBPA 2OPTA 4PJMA 2E5ZA 3JRIA 3QPSA 4AVPA 3OOPA 2KJCA 4L9TA 4MFEA 2Z33A 1Z7UA 2LBFA 5LRRA 4XSZF 1WJDA 4IZZA 3ZGKA 2ZXWH 1UHWA 2CMPA 2OJED 4KT5C 2IEKA 1X3ZB 3BPXA 1B1BA 1HF0A 3IKVA 1FEXA 4I99C 1XCBA 1SC7A 4NUBA 3KE2A 2H94A 2CUFA 2FOKA 1B59A 4PJLA 1S72I 3FZVA 1MD0A 4YIRX 3U9GA 3CJNA 4ANJA 1OYIA 3HZJA 1HSTA 4MLOA 3S93A 1S3JA 2AXTC 1V5GA 2BW3B 4KN7X 2GWRA 4FETA 4RDUA 1RIOH 1VQ8I 2BXZA 4M3FA 2PJRB 2X6WA 2LY2A 3S3MA 4LG0A 4A0XA 4A3BJ 3SFIA 4IPAA 5AIPA 3HSRA 4UVBA 1D5YA 5ICEA 5KK1A 1VQLI 3LSPA 1YW7A 4OOIA 2X51A 3M8FA 2HGCA 2WAEA 2N8GA 2P5KA 3GFLA 4RLFA 5B5EC 2BOLA 2GA1A 3RDIA 1C0WA 3F3XA 3HGGA 2LK2A 4RAZA 3VDXA 1F36A 3R0AA 5M5XJ 2KIUA 2QQ8A 2UV1A 1IRGA 3HJEA 5ERIA 1IGNA 4A6EA 2VJ4A 5CKTA 2ZSHB 1FOKA 2VC1A 2M7AA 1P2FA 2CJJA 3BR6A 1BI3A 2QYOA 1IF1A 4OMYA 2WAFA 4WCGA 2HFHA 3I4NJ 3HC7A 1FBQA 1MDMA 4FISA 2ME6A 2CW8A 2ZFWA 3GTPJ 3S16J 2WY7Q 1ERDA 5E17F 5D6EA 1ETWA 1R5GA 5CLSA 2DN0A 2ISYA 1YOVB 4N9HA 4XM3A 2RNGA 1XCVA 1DPUA 1D8KA 2BYVE 2WB1N 1B8IB 2KFDA 4HEA2 1LE8A 5BOXA 2G0EA 2DQLA 1WJFA 2EH3A 3BTIA 4LB6B 4GRIA 3GTOJ 1BBYA 2D2WA 3CP8A 1MW7A 3DXJF 4AD9A 1BOAA 1VQKI 1WI9A 2OV7A 1IN7A 1Z77A 2LKSA 2VBWA 2KRHA 3BP8A 1AHDP 5J8FA 3GBGA 1WWXA 3S2WA 2O61A 1QNTA 1RR7A 2CW0F 2ZXHA 4EATA 3PUFA 2DPUA 4M9SA 2OQRA 2ZJQF 2OTJI 4XMYA 3HOSA 4CCOA 3H0GJ 1OR7C 4PJNA 2Z1DA 2HQAA 2R7DA 3FBIB 4FASD 2DT5A 4W1UA 3A2KA 1TLHB 3K7AJ 3FMQA 5J3LA 3B02A 2EIKH 4IKFA 3OIPA 5KHDA 5KCMA 4EGZA 1MKMA 3ZXSA 2HOEA 4BJTA 2IGNA 3PFIA 1I3QJ 1HSJA 3CP2A 1W4MA 3DTIA 4ZDPA 1MSEC 1RNLA 4MFDA 4RAGA 4GFBA 2E2IJ 5LGTA 5HNFA 3CUQC 3FMRA 2LF7A 4P9UA 2OD5A 3RSNA 3CCSI 4Z6YA 2F4OB 3OYAA 1TWHJ 1MH3A 2MC4A 3GW2A 1S29A 2WY8Q 3F8BA 3K2AA 3OSFA 4N4OB 4BBRJ 3IP4B 2JPBA 1JI8A 4N0BA 4LIVA 1KQ9A 4D7NA 1QHGA 4BEHB 3I64A 2NVQJ 3WTWC 1FYKA 1WKMA 4LJZF 2O6GE 2JA7J 1QZZA 2A5WA 3FM5A 3G4SI 5DM7F 3KIOA 4GCVA 2XKPA 1BR1A 3RYPA 1D1CA 2HOAA 5B66C 2K3PA 4M3DA 1VTNC 2KKOA 2EIMH 4UNOA 3DTKA 4LGWA 3ABUA 3FIWA 2FBIA 3QPTA 1ETXA 2O7OA 4C9YA 5J1YA 5K5QA 1FNNA 1UAAA 1ZREA 2FEZA 3LA3A 2XSDC 4L9NA 1D3YA 3S8PA 1QVUA 2G7HA 2DCEA 2ZC2A 2IW5A 2VBXA 4DYQA 3R4KA 3T8RA 2F4MB 1ACIA 2ZB9A 1IAWA 3LSJA 4RGSA 3SZPA 4IEJA 5CVVA 3JRGA 1TBXA 2CQKA 1N78A 5E20A 4ZJZA 2Y0MA 2NYXA 4Q47A 4XOPA 3VODA 3W6KB 3CC2I 1K6OA 1MBKA 1MIJA 2KZVA 2QGUA 3RQIA 5JFRA 3HEFA 2P7CB 1OYWA 2DOFA 4F92B 4YG2F 3P9IA 1DPRA 1I3AA 3P9KA 2LD5A 3PJRA 1E0EA 4CYCB 4XKCA 4HDUA 2XB0X 3HKZN 1E2XA 4GYIA 1GVJA 4HLXA 3OL4A 3QYBA 5E3OA 2QBYA 2CQ7A 4U87A 4AC0A 5IT9Z 2ZXIA 2X4HA 1BI2A 5GTIC 4V2FA 5AONA 4C2TA 1CGPA 1ZARA 4JYKA 1G3SA 3I56I 1KZHA 2K4BA 2GLOA 1USSA 3GX4X 2RVCA 3GEZA 5K5RA 1DUXC 3QOEA 3I59B 1MMSA 2F5VA 1X19A 2L4AA 2QQ9A 3DEUA 2MD5A 3ELKA 4AIHA 2LC2A 2CV1A 1ZR2A 1MBFA 2OQGA 5BQTA 3G2BA 5TISC 2P0WA 2E34A 3EUHA 3NEUA 5FKKA 3HDDA 3R60A 1T56A 1QHHD 1XB4A 3O8HA 3ABKH 4XSXF 2HKXA 2L9SA 4E7SA 5DCFA 2VXZA 3GFIA 2F6CA 3OYLA 1A5JA 2PLYA 3PL8A 2R5ZA 4ITVA 3RZOJ 1R00A 2VQGA 4A3GJ 1SAUA 3BJOA 3TO9A 2V6CA 1QGPA 4A3KJ 3OV8A 3ASOH 2JTVA 4MEYF 4XLNF 3AG1H 1HW2A 3PSFA 3TO7A 3HOYJ 3K1MA 4WWCA 3HRUA 2QQAA 3V8JA 3IAS2 1JHFA 2IS6A 2L3DA 3CMAI 2FUG2 2A69F 3IH3A 1TWAJ 2DK5A 3AG3H 1KA8A 3V4GA 4RMNA 1EH8A 1GUUA 2RNJA 4C2MJ 2JVGA 1T39A 4X0GA 3QYFA 3Q9SA 1Z7LA 5FGMA 1GDTA 4DNCA 4I02A 1RUNA 1R1TA 1ZTRA 4LLGF 1EA3A 2R93J 4L18B 1ZRCA 4J01A 4QIWN 2VE8A 3OS1A 3JTGA 3H0DA 3KP7A 2DDBA 1X4PA 4BQQA 1RPWA 5FFZA 1IRZA 2DK8A 3KP4A 1IXCA 3N4MA 2DA1A 4ENJA 4KJZA 2E36A 1XG1A 1HLVA 1HKTA 2DFIA 2COMA 2K85A 3RI4A 1XSDA 2K9LA 2HTJA 3AG4H 2EIJH 4E6KG 5A2QZ 3W2AA 2V4JC 1ZRFA 3ZMVA 2VT3A 3FK7A 2FSWA 1SD4A 3K1NA 2Y0SN 4KICA 1MMDA 3DF8A 4CDGA 2EJRA 1GT0C 5F27A 1X2NA 5HS7A 4AYBA 3KZIC 4IJAA 1MMAA 1F5TA 5IT9K 4BY1J 1R6RA 3ZOBA 2IPQX 5IOZA 3FBNB 5J40A 1VQ5I 2Q2EB 3VSLA 2K27A 2K9QA 4EEFG 1IDZA 1OPCA 3PO3J 2NVYJ 2VBYA 3Q3SA 1N75A 5C4XJ 3OWTA 4PZJA 2M7BA 3NRVA 4RGXA 4B43A 5JI6A 2B9SA 3MCZA 4IX7A 3KETA 1BI1A 3JW4A 4V19K 2K7LA 1JKRC 1UB9A 2KL4A 2ID3A 3DPUA 1ETQA 5BS6A 2EV5A 1P7JA 2X6OA 1QPMA 4BEHA 3OYMA 3E5QA 2DA7A 5EGOA 1ZGWA 1SFUA 5HLGA 3FHNA 1A35A 4P55A 1TWGJ 2BVLA 3WTXC 5IT3A 1XMKA 3GTKJ 3DU5A 2W84A 1DGRM 3L2UA 4JBAA 2YU3A
chains in the Genus database with same CATH topology
2BW3A 3LSMA 3BG6A 2IGKA 1X1AA 3TBIA 3VYRB 4CA0A 2VKHA 2PJRA 2AQEA 2XAUA 3NWSA 1Y6IA 2XDVA 3K70C 1DP3A 2Z2SB 4DBQA 1WJEA 4DGWB 4BE2A 1D1BA 2E1MB 4CCJA 2IS2A 1OLTA 1G59A 2UWMA 3RQ4A 3OOUA 4BXFA 3OYHA 3UNGC 2KPMA 4OWRB 3OR2C 2VLAA 2RREA 3J7AY 2MABA 4JQFA 2E5NA 2KLOA 4B47A 4U7BA 1WJ5A 4E7ZA 4B3XA 3CF2A 2HDWA 5FRMA 4ZC3A 3DPTA 3H9JA 3LSKA 2ZSIB 1MMGA 1U0JA 3H5NA 2E1MC 3C2HA 3OY9A 2WAQA 4BE0A 2VIXA 3OL3A 4II3A 3KEYA 4KITB 3KYLA 4XL9A 1P9QC 3RCOA 2R7VA 3D5RC 2R7SA 4BJ5C 3DU6A 3ZCOA 2HVSA 3AFHA 1V5FA 3DQVC 4XLFA 4XNFA 2LG4A 2IS4A 2A6TA 3L2WA 2IXSA 2OC6A 3RTRA 4XLCA 2CS3A 2LRDA 4CCNA 3LL7A 4E7LA 4QPOA 3HOTA 2L2OA 3OYIA 2VPLA 2WBMA 3M8JA 3TL4X 2VJ5A 4PJMA 4C30A 2E5ZA 1MNDA 3K4MA 4Y33A 4YELA 4LITA 2LBFA 3H35A 1V5EA 1WJDA 4IZZA 3ZGKA 5HVQC 4ZDOA 2ELJA 4ZTJA 2CMPA 2VJJA 3K70D 4BDYA 2X1CA 1D1AA 4P5OA 1Z3XA 2W82A 2JA2A 1Y56A 3DTEA 2QKMB 4NUBA 3EUAA 4G6TB 4PJLA 4II2A 3HUGB 4ANJA 3OYEA 3CJQB 4ZTFA 3OYKA 2KMUA 2LREA 4MLOA 3S93A 2BW3B 2VXDA 1V5GA 4E4HA 2R4GA 4FETA 4XKVA 3TMOA 1WFXA 4BL0B 2PJRB 2X6WA 3V42A 1PJRA 3HPHA 2LY2A 3S3MA 3DWLE 3UR3C 4BQOA 3K6GA 2VQHA 3EPZA 4Y4RA 3SEZA 3K4KA 2PMZA 4HG2A 1YX5A 2X51A 4AU7A 3DKXA 1LVKA 1J09A 4B48A 3OYNA 2WAEA 3U21A 4RLFA 1W36C 2BOLA 2WB1A 1LDKB 3VDXA 2JVHA 3OR1C 3PFYA 3SZGA 4AVZA 2W00A 4RM3A 3C2GA 2UV1A 4XONA 5JHFA 2VJ4A 1KONA 4OAZA 4D9JA 5CKTA 2ZSHB 2DJIA 2ZFUA 4NNJA 4BDZA 1BOBA 3HG9A 2M7AA 1MNEA 3LSHA 5HNHA 2CV2A 2CV0A 3H9QA 2KHMA 3BG7A 3VWBA 2X6YA 2WAFA 3EUHC 3HC7A 3VYUB 2CW8A 2WY7Q 1ERDA 4F93B 3L2VA 2V26A 2HPIA 4XN3A 3OIQA 1X1DA 2R7QA 4KT6A 2IS1A 2RNGA 1Z3YA 4JOMA 3CESA 5CPRB 4HEA2 3CJRB 1VZ0A 3IAM2 1WJFA 2R7TA 2W1OA 3HPGA 4GRIA 3SYTA 3W3CA 3M1CA 1MW7A 3CP8A 1ZELA 2OV7A 1X4OA 2LBFB 1WJBA 2E60A 2KRHA 3MKYB 3GBGA 4CCLA 2ZXHA 3LFUA 2K5CA 4EATA 3VSKA 4PK4A 3BCAA 2V1NA 4XMYA 2XF6A 4PJJA 3HOSA 4CCOA 4PJNA 1OR7C 4CH7A 2Z1DA 4HRIA 2HQAA 3IUOA 4XN0A 2L5QA 4BU2A 3FBIB 2X6XA 3DPLC 1WJCA 4FASD 1W36D 3A2KA 2LYCA 3OYFA 4PFPA 2IGOA 2X1DA 2CUJA 4IKFA 2VQLA 3OIPA 5KHDA 5KCMA 1TZLA 1FMVA 3ZXSA 4BJTA 2IGNA 3MMYB 2CFOA 3CP2A 3DTIA 4ZDPA 3AL0B 4N4NB 2HNHA 1T95A 2KP6A 4CUGA 5HNFA 2HVRA 4XKBA 4F52A 3EUKL 2HZDA 3RSNA 2Y0SA 2CW7A 3OYAA 2M4KA 3H5AA 2MC4A 2WY8Q 4N4OB 4HSRA 3IP4B 5TGTA 2W4SA 1JI8A 4LIVA 2KQRA 4OAYA 4ZDLA 3SEQA 1QHGA 4BEHB 1IRXA 2I8DA 4E7KA 4DOZA 3VYSB 3DKYA 2QKLB 2A5WA 3OYJA 3W2VA 3DLAA 3D5SC 4XORA 1BR1A 3CMMA 1D1CA 2HPMA 3AL0C 2K3PA 4PSXA 2RQQA 3DTKA 3OS2A 4DBRA 2NOJB 1NG6A 4C9YA 3HKZA 1UAAA 4QPQA 3DEEA 4XR6A 1N77A 3A4CA 3S8PA 1LKXA 4RM2A 1X1BA 4BUPA 2DCEA 2MFZA 1D0YA 3OYCA 1K6YA 4BGDA 3HL2A 3H5RA 1N78A 4XLEA 2DXIA 5FRNA 4ZJZA 3K4BA 4XOPA 4H4KC 2KZVA 3ZR8X 1PYVA 1X1CA 3SDBA 2K9MA 1BR2A 3NWTA 3OS0A 3BCBA 3OMYA 3H9GA 2LH9A 4F92B 3AKZA 4C2UA 3K4NA 1DQUA 1SFKA 3PJRA 4CZCA 1E0EA 2VASA 4IQ4A 1Z21A 4XKCA 5HOOA 2AQFA 4LIUA 2R7WA 4RLQA 3PNTA 3OL4A 3QYBA 4R79A 2MD0A 3N05A 1TT0A 4U87A 3I3LA 1QU3A 2W7NA 4HNUA 1AA7A 2ZXIA 4P1WA 2XSJC 4PFOA 5CQEA 3L2RA 3S3OA 2L9NA 4C2TA 2BVMA 3L2QA 3PNYA 3FDYA 5KNLA 3VYTB 1UELB 2JUGA 4F55A 4CCMA 1D0ZA 2WA0A 3QOEA 2F5VA 1X19A 4XKWA 2CV1A 2LC2A 2LOOA 2XF7A 2V6EA 3G2BA 1S9HA 2P0WA 2CUZA 4XQFA 4KISA 1QHHD 4PUSA 3PUBA 3BC8A 2L9SA 3LMMA 4E7SA 2VXZA 3QODA 3OYBA 3A1YA 2F6CA 3OYLA 4NC7A 3PL8A 4BJ6C 2M3AA 4XLAA 1NG7A 2DT6A 4ITVA 1T0FC 3HXLA 2VQGA 2HU9A 2VKDA 1SAUA 4ZYAA 3S32A 4D1QA 3W2WA 4YEJA 4CCKA 2X85A 3PSFA 2M0MA 3E1SA 2XF5A 3IAS2 3D5LA 2IS6A 2L7KA 2FUG2 3ZRGA 4XOTA 4F91B 4RMNA 5LD2C 2Z16A 2JVGA 1FMWA 4X0GA 3QYFA 1Z7LA 1WJAA 3RPUD 4HSTA 2KDOA 2WADA 2V7FA 3ZQQA 4BQNA 1EA3A 2MYSA 3OYDA 4E7JA 4J01A 3OS1A 4LG3A 2JSPA 3H0DA 1DGWY 5FROA 3PSIA 1UG0A 1X4PA 4BQQA 4E7IA 4XLHA 3K4JA 2VJIA 4BACA 4KJZA 4F3QA 1LFPA 2VQCA 1YE9A 3MKZA 2R7RA 2CH0A 2K9LA 3K4CA 4E6KG 3W2AA 2R7UA 2M4GA 4BS9A 2V4JC 1GLNA 2HVQA 3MD2A 3PNVA 1MMDA 3MKWB 4PSWA 4DIQA 2KRCA 2IGMA 2F4IA 3LSIA 4CSWA 2LY1A 3ONQA 3CZ6A 4AYBA 2R7OA 2O5RA 1MMAA 2X1EA 2GOMA 4IQJA 1R6RA 5LFAA 2VB6A 3E0JB 3FBNB 3KX2A 2Q2EB 3VSLA 2GOXB 3S3NA 4NC8A 2V9KA 4YRVA 5HLTA 1HA8A 1BR4A 3K10A 3FKJA 1N75A 2OUMA 3OWTA 2M7BA 4B43A 4IX7A 5CQGA 4NQWB 2XC7A 2KL4A 1MMNA 3DPUA 3OYGA 2R7XA 3F9KA 4J00A 3QYEA 3I9V2 4B44A 4BEHA 1YX3A 3K4LA 3BLYA 3OYMA 3LSGA 2VL8A 1G8XA 2DOAA 4HNTA 4E7HA 3FHNA 4HPQA 1D0XA 2BVLA 2UUZA 4BE1A 3DU5A 4DJAA 2Q1ZB 1DGRM 4Y3OA 3L2UA 4XM3A 2DT7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2B A; 
#chains in the Genus database with same CATH topology
 3LSM A;  3V7R A;  1UST A;  3CCL I;  1R7J A;  2AQE A;  2XAU A;  2Y69 H;  1H88 C;  1PUF A;  2Z2S B;  3GZ6 A;  2DMQ A;  4Y52 J;  1XTA A;  3VPR A;  3DFG A;  3MFK A;  4Q48 A;  2L0K A;  5K7Z A;  4WX9 A;  1VQ4 I;  4LLN A;  3P7N A;  5IYD J;  3K69 A;  1GXP A;  4BXF A;  1IG7 A;  3OYH A;  1ODD A;  2XIG A;  1K4S A;  4OWR B;  3OR2 C;  3LAJ A;  1WVR A;  2KRF A;  2RRE A;  3E6D A;  3B6A A;  1BL0 A;  4ZYE A;  3F6O A;  3MN2 A;  2QVO A;  4QLC U;  4U7B A;  5K7F A;  2OZ6 A;  3CDL A;  1OCC H;  3TW6 A;  3GTJ J;  3CF2 A;  1BA5 A;  1KQ8 A;  4HYE A;  1R1V A;  4QTR A;  3E6B A;  2IA1 A;  2EB7 A;  1XGO A;  3S1R J;  2E1M C;  3C2H A;  2WAQ A;  1TQI A;  5ILU A;  1W5T A;  3ZN0 A;  2UXN A;  4XL9 A;  1P9Q C;  5A2Q K;  2R7V A;  3JAM Z;  3WTU C;  3DCF A;  2R7Z J;  3LAP A;  3JSP A;  3ECO A;  1D8J A;  1XPX A;  1V5F A;  2DA5 A;  2DI3 A;  2DYS H;  5DDG A;  2XPW A;  2NNY A;  3LWF A;  1B9N A;  2A05 A;  3BZC A;  5HOD A;  4Q4Z F;  1YQA A;  2WV1 A;  2IXS A;  1OR7 A;  4XLC A;  2HI3 A;  2LRD A;  3GFJ A;  4E7L A;  5L3D A;  1U8R A;  3HOT A;  4ZZL A;  4HLY A;  4G8X A;  3A01 B;  1T0F A;  4I76 A;  1I39 A;  2VJ5 A;  1HW1 A;  4CO8 A;  2K02 A;  1P4X A;  1MND A;  2ACJ A;  3WTS C;  5ICG A;  3E5X A;  1V5E A;  4C3I J;  3BG3 A;  2ELJ A;  3G1L A;  3GO5 A;  3DV8 A;  3CUQ A;  1D1A A;  3FM3 A;  1RKT A;  3E5U A;  1TC3 C;  4AM3 A;  2JA2 A;  2DOD A;  2QKM B;  1WPK A;  2ZBK A;  3EUA A;  2OCC H;  2BV6 A;  3BR5 A;  3IL2 A;  1S8N A;  3HUG B;  1QO0 D;  4M3E A;  3OYE A;  4Z2Y A;  4ZTF A;  1ZRD A;  1BW5 A;  2HS5 A;  2KMU A;  5FKM A;  4E4H A;  2VXD A;  1IW7 F;  1YYV A;  1Z91 A;  5IP9 J;  4BL0 B;  5F0C A;  3V42 A;  5EG0 A;  1PJR A;  3A03 A;  3J80 Z;  1H0M A;  3E6M A;  2Y75 A;  3DWL E;  4BQO A;  2MSY A;  2PG4 A;  3O3K A;  3CCJ I;  2UXX A;  4BXU A;  4GGG A;  5LEJ A;  4FQG A;  2BZT A;  2IP2 A;  5DUK A;  4AU7 A;  1LVK A;  4B48 A;  1QZY A;  2CQX A;  3U21 A;  4ASN A;  1LDK B;  2DFH A;  3EYY A;  4A5M A;  3HM5 A;  2J5O A;  2L4M A;  3SZG A;  1ONV A;  4G6D A;  4CXF A;  4JX6 A;  5EEG A;  5JHF A;  1KON A;  2XV4 S;  3E97 A;  4OAZ A;  4D5F A;  2K4J A;  2G9W A;  2DJI A;  2ESN A;  4NBQ A;  2ZFU A;  4U0V A;  3HG9 A;  4JK1 X;  4PDK A;  1MNE A;  3TOB A;  1QA6 A;  5HNH A;  2P4W A;  2B63 J;  3KYD B;  3H9Q A;  1J9I A;  3W6V A;  3BG7 A;  3EUH C;  2MBF A;  4HV6 A;  2XAQ A;  4B09 A;  3ABL H;  2DMT A;  1FOX A;  1J75 A;  2YPR A;  4XN3 A;  4LMY A;  3CLQ A;  2VOD A;  3UKG A;  1JKQ C;  1KYZ A;  3GUD A;  2CQQ A;  2R7Q A;  3PQK A;  4KT6 A;  3BDD A;  1YI2 I;  4IHV A;  1I5Z A;  1A04 A;  2QEN A;  4IF4 A;  2CO5 A;  2HQR A;  3OSG A;  2W85 A;  4L5E A;  3HPG A;  1Y1W J;  1AKH A;  1ZGA A;  3SYT A;  4U0W A;  4HQM A;  3W3C A;  5KAI C;  3BTC A;  1L0O C;  5D5U B;  5EZG A;  1X4O A;  4EJO A;  1WJB A;  2E60 A;  3HGY A;  4PCQ A;  1FTT A;  3MKY B;  1VQP I;  4CCL A;  3U2R A;  2JPC A;  4B1R A;  4DW6 A;  3BCA A;  4M3G A;  1CF7 B;  1BW6 A;  2JJ7 A;  3BR2 A;  3WGI A;  4HZF A;  4UY8 I;  1K79 A;  4MNU A;  2QA4 I;  1XMA A;  2HDC A;  4HRI A;  4XN0 A;  3DPL C;  2EZK A;  2EIL H;  5H2F C;  1B72 A;  5EYR A;  4PFP A;  5CVJ A;  3M4O J;  2STT A;  1R9T J;  3VFZ A;  4EJW A;  1JHH A;  1I50 J;  3EET A;  2VBZ A;  3R6S A;  3MMY B;  4KMF A;  1HXD A;  2CYY A;  3S17 J;  1QZE A;  2QUF A;  4L5J A;  2YSR A;  4RAY A;  3RIR A;  2HNH A;  2KP6 A;  4HF1 A;  3J80 K;  1J0R A;  5CVR A;  2IT0 A;  2Y0S A;  3JRA A;  4K2E A;  3Q9V A;  3W6J B;  4A3I J;  1O3Q A;  3KEQ A;  4IRI A;  1EH6 A;  5CJ9 A;  4HSR A;  1F43 A;  4ZDL A;  2DYR H;  3QPL A;  2EQR A;  2I8D A;  5J47 A;  3DKY A;  4M74 A;  2QKL B;  5DCM B;  3W2V A;  3HTS B;  2ZCW A;  3D5S C;  3F23 A;  3CMM A;  3KEO A;  3FMS A;  2HPM A;  1J7K A;  2D5V A;  3CTA A;  4PSX A;  3MAJ A;  2KT0 A;  2A68 F;  1AU7 A;  1Y8Q B;  3M7G A;  2NOJ B;  2P6T A;  3H3Z A;  1NG6 A;  5TJJ A;  3BR0 A;  2ID6 A;  1YLF A;  4CIC A;  3QP5 A;  4QPQ A;  1R22 A;  1R1U A;  1N77 A;  1OCP A;  1LKX A;  1STZ A;  4RM2 A;  1X1B A;  2FBH A;  3TW7 A;  5IY5 H;  2MFZ A;  3BG9 A;  1D0Y A;  4A3D J;  2TCT A;  4E70 A;  3KZY A;  1P4W A;  3K9T A;  4L9J A;  3HL2 A;  1G4D A;  1UJ8 A;  2IJL A;  2DO7 A;  3J7A O;  3ABM H;  4WF2 A;  3T5X A;  1TWC J;  3IKT A;  1W7P B;  1ZN2 A;  2HKO A;  4H4K C;  1TL8 A;  1W0T A;  2HR3 A;  2RV8 A;  1OIS A;  5L3F A;  1K78 B;  3QPH A;  3ZMZ A;  1Q1V A;  2M45 A;  3RPQ A;  3SDB A;  4MO7 A;  1BR2 A;  3NWT A;  1F1Z A;  3TP0 A;  3CCM I;  2FNA A;  2LH9 A;  5ILV A;  1SFK A;  5HOO A;  2AQF A;  3GZ5 A;  3HRT A;  4LIU A;  2R7W A;  5LGU A;  1XDU A;  2EZH A;  2KIM A;  4RLQ A;  3PNT A;  4FHT A;  4P9F A;  3N05 A;  1TT0 A;  5F08 A;  4LK1 F;  1GXQ A;  4BY7 J;  3MZH A;  3SZT A;  2W7N A;  4HNU A;  3BJA A;  1U2W A;  1FYM A;  4LB5 A;  5CQE A;  3S3O A;  5JLX A;  2LP0 A;  1YG2 A;  3L2Q A;  3QU6 A;  3FDY A;  2XAH A;  3C1D A;  3VYT B;  2JUG A;  4S04 A;  1GV2 A;  5E3L A;  1ULY A;  4EVI A;  2XGD A;  5CVU A;  2NXN B;  1E3P A;  1LB2 A;  2OU2 A;  5EEA A;  2LOO A;  4NDL A;  2V6E A;  1S9H A;  1U8B A;  1B4A A;  5D5V B;  1PP7 U;  4NQW A;  2XHK A;  4XQF A;  3QQA A;  4BXX J;  3L00 A;  4NB5 A;  2V9P A;  3ML6 A;  5JHU A;  1WH7 A;  2H8W A;  2FXA A;  3BC8 A;  4UUS B;  3LMM A;  2QF7 A;  1WGX A;  1GHC A;  1OQY A;  2JN6 A;  3A1Y A;  3G3Z A;  1RC9 A;  2ME0 A;  4NC7 A;  2M3A A;  1NG7 A;  3TDU C;  2JA6 J;  5ICF A;  1T0F C;  2PQ8 A;  2BY2 A;  2HU9 A;  2VKD A;  5D6F A;  5LRS A;  4AIJ A;  4ZYA A;  2XPU A;  1FY7 A;  1KU9 A;  2HOT A;  1YW9 A;  2LMD A;  3GWZ A;  1VQ6 I;  1S7A A;  2J5P A;  3MZY A;  4I0B A;  4YEJ A;  4CCK A;  1EV7 A;  1YJW I;  1LDJ A;  2M0M A;  1BIB A;  4V2G A;  4RB3 C;  4Y13 A;  2L7K A;  3ERE D;  3KP6 A;  3ZP5 A;  2NOG A;  5D8L B;  1FWZ A;  2RQP A;  4F91 B;  1LFU P;  1Y8R B;  5EEH A;  5LD2 C;  1FPQ A;  2JSC A;  4IHT A;  3I58 A;  3RPU D;  5HDN A;  2KDO A;  2WAD A;  4C3H J;  1YRN B;  3BT9 A;  2MYS A;  3OYD A;  1R71 A;  5E8I A;  1Z6R A;  3FXU A;  2I10 A;  5FO5 A;  2O3F A;  3L9F A;  3K4J A;  4A3L J;  2HZT A;  1VQM I;  3LNQ A;  2K9N A;  5E18 F;  5JLW A;  2VQC A;  1ZG3 A;  2DMP A;  4A12 A;  3K0L A;  5AIQ A;  3JRH A;  3FXR A;  4DZP A;  1DU6 A;  3K4C A;  4UB8 C;  2R7U A;  3LA2 A;  3GTQ J;  3MEX A;  2HVQ A;  3LFK A;  3MKW B;  4PSW A;  4DIQ A;  5IOY A;  3ZMD A;  2IGM A;  3FXO A;  1B6A A;  3LSI A;  4CSW A;  4MIM A;  2BGC A;  2QM3 A;  3I54 A;  4BAY A;  4IHW A;  4Q5S F;  4AUX A;  1Z9C A;  2O5R A;  2QSF X;  5H6Q A;  2E1C A;  4HBL A;  4BKX A;  2NVT J;  3WTZ A;  4NHJ A;  1TWF J;  3QWL A;  2B7E A;  3BJ6 A;  3NAR A;  3SHF A;  3HOU J;  3HSE A;  1U6G A;  2NS7 A;  1Z6T A;  5M3M J;  4WXD A;  2H8R A;  5B1B H;  1KQ0 A;  2KZG A;  5BMZ A;  3DBH B;  2D45 A;  4DQ2 A;  2A3S A;  3IH2 A;  3GZN B;  2DLL A;  4XRF A;  1MMN A;  2X0L A;  4XRS A;  2QEX I;  2FF4 A;  2L7M P;  2BBY A;  1YX3 A;  2EIN H;  3BLY A;  3M8E A;  6PAX A;  2OCE A;  4B3A A;  2DOA A;  4HNT A;  4CHU A;  1WH5 A;  3AG2 H;  1I6X A;  2Y48 A;  2XB5 A;  4BE1 A;  4CGZ A;  2UUZ A;  1P4A A;  5FB2 A;  4DJA A;  2VKV A;  3LOC A;  2DT7 B;  2M30 A;  2BW3 A;  2L9V A;  3TBI A;  2UZK A;  3ESW B;  1LEB A;  5B3S H;  2ZKZ A;  2VKH A;  1YHQ I;  2PJR A;  1JJ6 C;  3FXJ A;  4KN4 X;  1Y6I A;  2XAJ A;  4XLP F;  1MJB A;  1YO5 C;  2JUC A;  2ADU A;  3CDI A;  4KUM A;  1HKS A;  3Q0W A;  5ICC A;  1D1B A;  4HW0 A;  2HEO A;  1G59 A;  4M73 A;  2DFF A;  4N9I A;  5D4S A;  1MBE A;  2PMU A;  3MVP A;  2RN7 A;  1FZP B;  2NS0 A;  1REP C;  2MAB A;  1U5T B;  4JQF A;  3IV5 A;  2K9S A;  4HAM A;  1U3E M;  1JE8 A;  2E7X A;  2Z5U A;  4L5I A;  5FRM A;  3L7W A;  3DPT A;  1QQI A;  3H9J A;  1JKP C;  2ELH A;  1JT0 A;  1IUF A;  3I53 A;  2F48 A;  1NK3 P;  4IRH A;  3H5N A;  5J4V A;  4OU0 A;  2GQQ A;  2P5L C;  1J2X A;  1PDN C;  4YFK F;  3VEP A;  3CCR I;  2JMW A;  3OL3 A;  2BHZ A;  1TW3 A;  4KIT B;  1FC3 A;  3SXY A;  2A61 A;  2MH9 A;  3DEW A;  1TP4 A;  3DLL F;  4I7H A;  4XLF A;  2JA5 J;  2LG4 A;  2LDU A;  2WC2 A;  1E3O C;  4LK0 F;  2A6T A;  4ESF A;  4A3E J;  2H1L A;  2EFW A;  3N97 A;  2FOW A;  1XSX A;  5JVT A;  3WG9 A;  1B8I A;  4M3B A;  3GLX A;  1FP1 D;  3TL4 X;  4QWQ A;  4DZJ A;  3NQO A;  1SD7 A;  2V1U A;  3O6B B;  4H0E A;  2AXL A;  3K4M A;  1IXS B;  5JR3 A;  5EF6 A;  1RRJ A;  3L09 A;  4HX4 A;  4IVN A;  2RKH A;  4UUV A;  4YFN F;  1JTX A;  3H35 A;  1UG2 A;  2GIZ A;  1FIP A;  1ZYR F;  4ZTJ A;  2P8T A;  3FXL A;  2C6Y A;  2EK5 A;  3WE3 A;  1O3S A;  4P5O A;  2VT2 A;  3KPH A;  3L1P A;  2W82 A;  2VN2 A;  1Y56 A;  1ON1 A;  1QBJ A;  3DTE A;  3KP3 A;  5M3F J;  4KA4 A;  2ZJ2 A;  4G6T B;  4II2 A;  2QSH X;  1VQ9 I;  2ZXJ A;  2DAO A;  1FIA A;  3CJQ B;  5IYC J;  2M8E A;  2LRE A;  2ZME B;  4XKV A;  3TMO A;  5DM6 F;  4S05 A;  4S0H B;  4BNC A;  1U9O A;  2DA2 A;  4OIP F;  3K6G A;  2GIV A;  1YIT I;  4HDV A;  1MH4 A;  1RR8 C;  3WU2 C;  2ZO4 A;  4A5N A;  2R5Y B;  3F8N A;  2CQN A;  1G3W A;  4M71 A;  1YX5 A;  2KIF A;  1IJW C;  1YRN A;  3CC4 I;  1W36 C;  2WB1 A;  3BTL A;  2JVH A;  1JT6 A;  3F21 A;  5E8G A;  3BQY A;  5F0F A;  3JR9 A;  4UXN A;  4XON A;  5C4J J;  2YX4 A;  4G7O F;  3TED A;  1Y0N A;  2F2E A;  4JX5 A;  3LSR A;  2GA2 A;  2CV2 A;  5K1Y A;  3G73 A;  4FX4 A;  2CV0 A;  1LNW A;  2DBB A;  4A3F J;  3VWB A;  4OIO F;  2X6Y A;  3IRR A;  2QSG X;  3TOA A;  3VYU B;  1JGG A;  1TNT A;  4F93 B;  3L2V A;  1YTY A;  2HPI A;  3OIQ A;  3FXM A;  1DU0 A;  4P96 A;  3GME A;  2JRM A;  2NVU B;  3CCV I;  3RPU A;  3V8K A;  2IS1 A;  1O57 A;  1Z3Y A;  3OIO A;  4JOM A;  4I0A A;  3RKX A;  3KZZ A;  2P81 A;  2WV0 A;  3FK6 A;  1KU3 A;  2FMY A;  3CJR B;  1VFC A;  1FP2 A;  2R7T A;  3WHC A;  2W1O A;  2BY1 A;  1ETV A;  2E1N A;  2XKO A;  2DTZ A;  2M34 A;  2XUB A;  4RBO A;  4MEX F;  3M1C A;  3RKQ A;  1UZC A;  3BQZ A;  2LBF B;  3ROU A;  4XID A;  1XS9 A;  4XRS G;  4CYC A;  5LGN A;  4M6Y A;  3LFU A;  4ZYH A;  2ECB A;  4A0Y A;  3VSK A;  4EM2 A;  4PK4 A;  2PJP A;  2V1N A;  1S7O A;  4HOB A;  1O3R A;  1W0U A;  4PJJ A;  1Y1V J;  3K1P A;  3H1C A;  1Z05 A;  4FT8 A;  4AWX B;  1E17 A;  1VQO I;  4BU2 A;  5FLM J;  3CQZ J;  2X6X A;  3GTG J;  1WJC A;  1W36 D;  5HS9 A;  2LYC A;  3OYF A;  2IVM A;  2IGO A;  2BEO A;  2X1D A;  2CUJ A;  3I71 A;  2DTR A;  4MHG A;  5L3E A;  1IN5 A;  2MLG A;  1TZL A;  1FMV A;  1K7A A;  4ENM A;  1IRF A;  1SD5 A;  4ON0 A;  3AL0 B;  5E3N A;  4WK8 F;  4N4N B;  4LG0 B;  3BZ6 A;  1T95 A;  4CUG A;  3I59 A;  3TDZ C;  4F52 A;  5GAE J;  5BPI A;  4JX4 A;  4IO9 F;  5LHI A;  1XD7 A;  2M4K A;  1Q1H A;  5L3B A;  3TQN A;  4KMU X;  1TQP A;  5DV5 A;  2PN6 A;  5DYM A;  4L0Z B;  3A0H C;  3PM1 A;  4G9Y A;  5FFX A;  2KQR A;  4LLL A;  4BYY A;  4RGU A;  5DD8 A;  1LUJ B;  3BR1 A;  3BY6 A;  3GVA A;  3HBL A;  5E1X A;  4DOZ A;  3HOV J;  2OTL I;  1Z67 A;  1X58 A;  3OYJ A;  4XOR A;  2EV6 A;  5GTH C;  4QSH A;  2RQQ A;  4BHB A;  1NHA A;  4EGY A;  2LLK A;  3Q0U A;  1QRY A;  2EFO A;  2GXA A;  3U1K A;  1HDP A;  2LTP A;  5GPA A;  4M9X A;  3HKZ A;  3TKY A;  3H36 A;  4IHS A;  3DEE A;  1T33 A;  4B4C A;  1MDM B;  1JUM A;  2JZY A;  2DQR A;  1APL C;  3GLL A;  3CO6 C;  2LKX A;  1N25 A;  1K6Y A;  4BGD A;  3S2H J;  3H5R A;  5GPC A;  5J4Y A;  1XDS A;  4XLE A;  2DXI A;  5FRN A;  2QQB A;  1LE8 B;  3K4B A;  3T1B A;  2VC0 A;  2FNP A;  1YFH A;  3WHB A;  5F64 A;  3C3W A;  4X1E A;  1FSH A;  3ZR8 X;  1PYV A;  1MZB A;  4HA8 A;  1X1C A;  1KYW A;  2K9M A;  1T98 A;  2P7V B;  2XRN A;  4GO1 A;  3OS0 A;  3BCB A;  3GFM A;  5LBQ A;  3G71 I;  1XMX A;  3AKZ A;  1LDD A;  4WXH A;  5D8K B;  4CZC A;  3CMY A;  1Z21 A;  3ZQC A;  1T2K A;  2M87 A;  4L9V A;  1FOW A;  4I6Z A;  4HF0 A;  3U1D A;  2M1B A;  1RKW A;  1ZH5 A;  4GYG A;  4RS8 A;  1YIO A;  1JUS A;  2PMZ N;  1ORK A;  2DJN A;  2VI6 A;  2O03 A;  4P1W A;  4PFO A;  3L2R A;  3Q5F A;  4RAF A;  2OZU A;  2L9N A;  1OJL A;  2BVM A;  4U0Y A;  2ZME A;  1NH3 A;  3M1E A;  2Q2E A;  5KNL A;  2H1K A;  1FX7 A;  4CCM A;  1P7I A;  1RI7 A;  1XGN A;  2FE3 A;  1D0Z A;  2WA0 A;  1H9T A;  3ULQ B;  1SFE A;  4XKW A;  3L2C A;  3FXK A;  3IH4 A;  1UFM A;  2DA3 A;  1ZKG A;  2ESH A;  4PGH A;  5ED4 A;  3V7C A;  2KDZ A;  4PUS A;  1UHS A;  2DMN A;  1OMI A;  3PUB A;  3ZMS A;  3D0S A;  1BIA A;  2FML A;  2M8G X;  1HC8 A;  3VOE A;  3OYB A;  2Y2Z A;  1I1S A;  4BJ6 C;  4UB6 C;  2H09 A;  4XLA A;  1DDN A;  3HXL A;  2O0Y A;  5M5Y J;  4BHP A;  2YX7 A;  4RB2 C;  5D4R A;  4D1Q A;  2CWE A;  3CD6 I;  3R61 A;  3S2D J;  2DU9 A;  3M3Y J;  2BE5 F;  3PIP F;  2R7F A;  1T8I A;  2FJ1 A;  3BG5 A;  2DOE A;  1L3L A;  2MC3 A;  3E1S A;  2XF5 A;  3D5L A;  2I5U A;  4CYD A;  3HTU A;  1O4X A;  2ZJP F;  1SVO A;  4IXA A;  2V9V A;  2Z16 A;  1UMQ A;  3PQJ A;  2XPV A;  1ZG1 A;  4A93 J;  2V7F A;  4BQN A;  1OCZ H;  1W7P D;  2GZW A;  2JSP A;  2HOS A;  2HQN A;  1DGW Y;  5FRO A;  3PSI A;  1UG0 A;  2KJB A;  5DD4 A;  5GAD J;  1K61 A;  2O8X A;  4E7I A;  2VJI A;  3JCU C;  3H3V K;  1HCR A;  4BAC A;  4CZZ A;  3P9C A;  1YE9 A;  3EYI A;  3MKZ A;  4G7Z F;  3WTT C;  4MTE A;  2W48 A;  3LQR A;  2BY3 A;  2COB A;  1D5V A;  2PX9 A;  1WZ2 A;  1LPQ A;  2ZNY A;  1TW2 A;  2IA0 A;  2Y9Y A;  1BC7 C;  1DP7 P;  1T38 A;  3F72 A;  2V1D A;  2QBY B;  1X3U A;  2F4I A;  2EZI A;  4MQV A;  1WRJ A;  2EV0 A;  2R7O A;  3M9A A;  1QPI A;  1WI3 A;  2X1E A;  4EV0 A;  4IQJ A;  5FLX Z;  5LFA A;  2VB6 A;  4G7H F;  3E0J B;  3KX2 A;  2NAZ A;  2P6S A;  2GOX B;  1GVD A;  2M2E A;  1IV6 A;  4NC8 A;  4YRV A;  3A01 A;  5HLT A;  1IN6 A;  3JRF A;  2YU9 J;  2QLZ A;  1I27 A;  3K10 A;  3SQN A;  5IP6 A;  3FIS A;  3FKJ A;  2A6H F;  2OUM A;  3WU0 A;  4Y7N J;  3WOD F;  5J6X A;  1R36 A;  1PUE E;  4O3M A;  1WSU A;  5CQG A;  3ISP A;  5EZH A;  1Z0X A;  1VI0 A;  2XC7 A;  4LOC A;  1V55 H;  3OYG A;  4EQQ A;  3F9K A;  4EMS A;  3QYE A;  3I9V 2;  4B44 A;  2R3S A;  1MNM C;  1W1W E;  3LSG A;  1VQ7 I;  2HYF A;  2VL8 A;  5D5W B;  1JGS A;  1R4N B;  4FE7 A;  2BY0 A;  5GAG J;  2GXB A;  2L01 A;  9ANT A;  2R5Z B;  1D0X A;  4AYB N;  3B6C A;  1NTC A;  3HUG A;  1G2H A;  1HKQ A;  4Y3O A;  1SFO J;  1YJN I;  3BG6 A;  2STW A;  2IGK A;  1X1A A;  3I4P A;  1IN8 A;  1ZGJ A;  4A0Z A;  1ZHF A;  2H6C A;  3NWS A;  1RZ4 A;  1FTZ A;  2YS9 A;  2XDV A;  4ZYG A;  3KCC A;  3K70 C;  4DBQ A;  1WJE A;  1OCR H;  4GXO A;  4DGW B;  4CCJ A;  2IS2 A;  1OLT A;  2EA2 A;  1SD6 A;  3RQ4 A;  4M6V A;  3ZMT A;  1H9G A;  4GDF A;  3S1Q J;  1SVM A;  1SAX A;  4UUT A;  4IHX A;  2VLA A;  2E5N A;  3RKY A;  3LST A;  4B47 A;  5E1W A;  1LJ9 A;  4E7Z A;  1YJ9 I;  4RB1 A;  5FKL A;  1JUP A;  1G6N A;  2F5D A;  4OIN F;  3ASN H;  4B3X A;  2HDW A;  3BPV A;  4OIR F;  3LSK A;  5DUI A;  2NS8 A;  2EWN A;  1Y39 A;  2JA8 J;  3I0T A;  3OY9 A;  3ZQF A;  5KAF C;  1P92 A;  1SMY F;  4BE0 A;  3KEY A;  1ETY A;  2E2H J;  5CYV A;  1VF9 A;  2K40 A;  1A6Q A;  4BJ5 C;  1TQM A;  2F5C A;  3ECH A;  4Y15 A;  2HXI A;  3DBR B;  3DQV C;  1ETO A;  3CC7 I;  2OAZ A;  4D5C A;  3A02 A;  4RGR A;  4G12 A;  4XNF A;  1U5T C;  3WU1 B;  1EF4 A;  4IOC F;  2Y30 A;  2AHQ A;  3G1O A;  3L2W A;  3WGG A;  5F6F A;  2CS3 A;  1SAN A;  4CCN A;  2E19 A;  3RKW A;  2M5W A;  1OYY A;  2WBM A;  5FLX K;  2G7U A;  3M8J A;  4UV9 A;  2D1H A;  3C7J A;  4C30 A;  3HHH A;  2Q0O A;  4NC6 A;  4FX0 A;  4ABZ A;  3H3U A;  3T0Y A;  3SFZ A;  2EZL A;  4LD5 A;  3HHG A;  1XN7 A;  3FXQ A;  4Y33 A;  4YEL A;  4I09 A;  4XBF A;  4LIT A;  4M6X A;  2H27 A;  2NVX J;  4DYC A;  5HVQ C;  3JTH A;  3ZPL A;  4ZDO A;  2VJJ A;  3K70 D;  2WAQ N;  1ON2 A;  1KU7 A;  5BNG A;  4BDY A;  1X2M A;  2X1C A;  4IRG A;  3S1N J;  1CF7 A;  1HQC A;  3KYC B;  1Z3X A;  2EBI A;  1BM9 A;  2ECC A;  2MA3 A;  1H89 C;  2MGQ A;  2Y31 A;  5F1J A;  5JVG F;  1IZ1 A;  3O2P E;  5EGO B;  5BPD A;  2CG4 A;  1RES A;  1O3T A;  1OCT C;  3DP7 A;  3QP6 A;  4M9Z A;  2HDD A;  3IC7 A;  5K7H A;  3F0C A;  5J1R A;  2CGP A;  3CCU I;  2ZNZ A;  2PEX A;  1TT5 B;  3OYK A;  1LFB A;  5FLV A;  4HQE A;  2R4G A;  3K2Z A;  2E2J J;  1XGM A;  1WFX A;  1M1E B;  1JTY A;  2DA4 A;  3D1N I;  4G94 A;  3HPH A;  5F04 A;  1PUF B;  3CF5 F;  1NK2 P;  3UR3 C;  1LVA A;  3HYI A;  2VQH A;  5L3C A;  3EPZ A;  2P5V A;  4Y4R A;  3SEZ A;  1HW5 A;  5M5W J;  5B1A H;  3K4K A;  2FU4 A;  3S1M J;  1O7L A;  2IAI A;  2PMZ A;  1IO2 A;  4HG2 A;  2A07 F;  2W24 A;  3DKX A;  1MGT A;  5DEQ A;  1J09 A;  3HRM A;  3OYN A;  4KFC A;  2E35 A;  1KGS A;  1BJA A;  3OR1 C;  2LFB A;  3PFY A;  4W97 A;  4AVZ A;  2W00 A;  4RM3 A;  2ZME C;  3C2G A;  5DCM A;  3M07 A;  3TP3 A;  3ZQ7 A;  2L02 A;  4D9J A;  3FKI J;  1AWC A;  4NNJ A;  4BDZ A;  1BOB A;  2TDX A;  3F8M A;  3LSH A;  2FA5 A;  2FD5 A;  2KHM A;  5E79 C;  2MLK A;  5IP7 J;  4FCY A;  3KP2 A;  4UVA A;  1T6S A;  2EFN A;  1XSV A;  1ZLK A;  3HSF A;  2V26 A;  4FTH A;  2Z99 A;  2Q8K A;  1X1D A;  1ZR4 A;  4R1H A;  2HTS A;  1JXS A;  4EJV A;  2WTE A;  4ESJ A;  5GP9 A;  3CES A;  3E7L A;  4AID A;  1OKR A;  5CPR B;  1W7P A;  2RC4 A;  3E3V A;  1OFC X;  3MZ8 A;  5LHG A;  1Z1D A;  1VZ0 A;  3IAM 2;  4I01 A;  4UHT A;  3ZQL A;  1XGS A;  2L54 A;  1K78 A;  2DFE A;  4PJ0 C;  2GAU A;  3S14 J;  1FBU A;  3RYR A;  3WG7 H;  1ZEL A;  3CO7 C;  3BR3 A;  2OA4 A;  1MJ9 A;  2NNN A;  5K5O A;  1POG A;  2TRT A;  1I1G A;  3GTM J;  3F6V A;  4RA2 A;  2K5C A;  3CUQ B;  3SJM A;  3EQL F;  4KIB A;  2RGV A;  3WE2 A;  3FF5 A;  1FT9 A;  3Q0V A;  4EM0 B;  2FQ3 A;  2JK3 A;  1TTY A;  2XF6 A;  4YII A;  4D0P A;  2ISZ A;  1R49 A;  4CH7 A;  4A3C J;  3IUO A;  2L5Q A;  1VND A;  4KDP A;  2LSO A;  2LKP A;  2M9H A;  3COA C;  2VQL A;  3GYH X;  2FBK A;  3TO6 A;  4IOA F;  2VUM J;  3REO A;  3R0J A;  5EG0 B;  2CFO A;  3AAF A;  3KFW X;  2HVR A;  4XKB A;  3EUK L;  2KIQ A;  2HZD A;  1YIJ I;  5FD6 A;  1X3W B;  4A3J J;  2CW7 A;  2DPD A;  2LY9 A;  1S5L C;  3H5A A;  4UVC A;  5FD5 A;  3GCM A;  4IL6 C;  5TGT A;  2W4S A;  5H20 A;  5HLI A;  2XGC A;  1S7E A;  2RAE A;  2XRL A;  2V1X A;  1YW8 A;  3CJT B;  1WQ2 A;  4OAY A;  3SEQ A;  4C3J J;  4UUS A;  1IRX A;  4E7K A;  4XIC A;  2R92 J;  2HQ5 A;  3VYS B;  2GM4 A;  1IN4 A;  4EJU A;  2XAF A;  4HNV A;  1JKO C;  2PFB A;  3DLA A;  1WHU A;  5HS8 A;  3QOP A;  2DMU A;  3AL0 C;  4KYW A;  4O6J A;  2M0C A;  4KIF A;  3BOQ A;  4R8H A;  4DBR A;  2PBI A;  3OS2 A;  2X9D A;  4ESB A;  5E3M A;  2MG4 A;  3J81 Z;  4XR6 A;  4ENN A;  2GBY A;  3DKW A;  5GAH J;  3A4C A;  3O8G A;  4A3M J;  2NRA C;  4BUP A;  1W5C C;  3WTV C;  3IWZ A;  4EJT A;  3OYC A;  5EJC A;  4OIQ F;  3JRB A;  1J5Y A;  2LVS A;  4I98 B;  4JP0 A;  3I4M J;  1X1P A;  4ZYD A;  3JSO A;  5L3G A;  2O8K A;  5IYB J;  3I55 I;  4O5V A;  3ZQI A;  1K83 J;  3HIF A;  2AS5 F;  3B73 A;  1I6H J;  5LHH A;  1AKH B;  2EFP A;  4F7Z A;  3OMY A;  5HLH A;  3H9G A;  4C2U A;  3K4N A;  1DQU A;  1ENH A;  4U88 A;  2VAS A;  3QAH A;  4IQ4 A;  4YIF A;  1A31 A;  3NAU A;  1SVL A;  2QWW A;  2VON A;  3CME I;  3CLO A;  2B0L A;  2BXY A;  4MGR A;  4FE4 A;  4R79 A;  2Z9O A;  5C3E J;  4X6A J;  2MD0 A;  1ZQ3 P;  4DYR A;  3I3L A;  1QU3 A;  3ZMU A;  4TV7 A;  1B72 B;  1V54 H;  1AA7 A;  1HOM A;  2JWT A;  2XSJ C;  3ZQH A;  4HF2 A;  3PO2 J;  1SEU A;  2ZJR F;  4RB0 A;  4EM1 A;  1J59 A;  2IBD A;  3HOW J;  1AOY A;  3PNY A;  2CRG A;  5CVI A;  3SDG A;  1UEL B;  2VKE A;  2E1O A;  4F55 A;  3H92 A;  3WTY C;  2DA6 A;  2E71 A;  5DS9 A;  5F0H A;  2L9R A;  3RJP A;  3GXO A;  3CUO A;  2W25 A;  3J7Z I;  2XF7 A;  1FLI A;  1R4M B;  1MSF C;  3TGN A;  3LA7 A;  2O9L A;  2CUZ A;  2EA4 A;  5FKN A;  4BHC A;  1A36 A;  1E3H A;  1KU2 A;  4BH9 A;  4KIS A;  1ETK A;  2FQ4 A;  2XAS A;  1PVE A;  1ZAO A;  5D5X B;  5E1Z B;  3BZK A;  3QOD A;  1HBX G;  2VE9 A;  4XRM A;  2V79 A;  2CUE A;  1WCM J;  3HB9 A;  3QRF F;  3S15 J;  2DT6 A;  2DW4 A;  1MBG A;  1R5H A;  1FBS A;  1VQN I;  1U78 A;  1LQ1 A;  3X2Q H;  3EDP A;  2A5Y B;  3LQQ A;  3S32 A;  4G6Q A;  5F1R A;  3FWE A;  2KIS A;  4MTD A;  3W2W A;  2R0Q C;  2X85 A;  1UCR A;  3ZQG A;  3JRE A;  2CFX A;  4M72 A;  2ELK A;  1LEA A;  3PIO F;  1R23 A;  4A2U A;  3ZRG A;  3J81 K;  4XOT A;  3BTJ A;  3KLN A;  4B8X A;  2VOP A;  3G6E I;  2ETH A;  5IPA A;  2Z3Y A;  5HDG A;  1FMW A;  2L7F P;  1K4T A;  1BI0 A;  1WJA A;  4HST A;  5H6R A;  3ZQQ A;  4UV8 A;  4ZZD A;  4E7J A;  1R58 A;  2XGX A;  2D1V A;  1B9M A;  2VPR A;  2AO9 A;  1EKE A;  4LG3 A;  4ZH4 F;  1U5T A;  3GTL J;  2WWY A;  3HRS A;  1SFX A;  3ABT A;  4XLH A;  3J7Y J;  2Y9Z A;  1TNS A;  5HDK A;  4L0Y B;  3F8F A;  1S6L A;  1MBJ A;  4F3Q A;  5LEK A;  1LFP A;  1F4K A;  1BC8 C;  1V4R A;  3BWG A;  1U9N A;  1XC5 A;  2R7R A;  2CH0 A;  5ILS A;  1ZG5 A;  2BHY A;  1IC8 A;  2M4G A;  4BS9 A;  2EPF A;  1GLN A;  2YR2 A;  4U7D A;  5FKO A;  3MD2 A;  2H6B A;  1Y0U A;  1EH7 A;  1FOY A;  1FSE A;  2JT1 A;  2KRC A;  3PNV A;  2W57 A;  2LY1 A;  3T8T A;  3F8C A;  2VOO A;  2LNB A;  3ONQ A;  3P5J A;  3CZ6 A;  2IRF G;  4KNY A;  4WXC A;  5J8C A;  3CCQ I;  2GOM A;  1HDD C;  2DDA A;  2K3F A;  2JRT A;  1ZLJ A;  4D7M A;  3S3N A;  2HXO A;  2V9K A;  4BQA A;  1P6R A;  1HA8 A;  4MQ9 F;  1BR4 A;  3FHZ A;  2GXG A;  3MKL A;  3CDH A;  3MQ0 A;  2MH2 A;  1FJL A;  2K86 A;  1IV8 A;  1IXR C;  5DTD A;  4AIK A;  3MWM A;  4NQW B;  3FX3 A;  4KIG A;  1ITY A;  2R7X A;  2MW8 A;  4LFU A;  4J00 A;  1XX5 A;  1R5I D;  1ZK8 A;  1GV5 A;  3K4L A;  2XVC A;  5EDN A;  1YS7 A;  1FYL A;  1G8X A;  3C18 A;  4E7H A;  4HPQ A;  3IHU A;  3WGH A;  3CCE I;  5FJ8 J;  3IRQ A;  2Q1Z B;  2XAG A;  1W5S A;  2L7Z A;  3A0B C;  3F22 A;  4ENK A;  1JJ8 C;  4CA0 A;  3VB2 A;  3CCY A;  3VYR B;  3ZN1 A;  2YUS A;  2HWV A;  1O7F A;  4Y17 A;  3JRC A;  4IHY A;  1DP3 A;  4BBS J;  3GF2 A;  1RET A;  1UHM A;  4BE2 A;  1G3T A;  2E1M B;  4XK4 A;  4A69 C;  3JAM K;  2R5Y A;  1PP8 F;  1CQT A;  2JQ7 A;  2IA2 A;  2UWM A;  3OOU A;  1IUY A;  3KLO A;  2CSO A;  4OMZ A;  5TRD A;  1OCO H;  3V8L A;  5LLQ A;  2HYJ A;  2XRO A;  3C2B A;  4YFX F;  1QVT A;  2LR8 A;  2FRH A;  2KPM A;  2QZ8 A;  3G1M A;  3UNG C;  1RUO A;  3V7S A;  1A6I A;  4HX8 A;  3J7A Y;  1YS6 A;  2KLO A;  2EFQ A;  1WJ5 A;  2A6E F;  1F9N A;  1MJA A;  4HV5 A;  3BRO A;  1BJZ A;  1BN5 A;  2ICW G;  4ZC3 A;  3RZD J;  1EJ9 A;  1SMT A;  2ZSI B;  1MMG A;  1U0J A;  2HYG D;  1T08 B;  3DBL B;  3ERM A;  2VIX A;  4II3 A;  2LF8 A;  3HOZ J;  3KYL A;  2XGE A;  2PMH A;  4J19 A;  5J1U A;  3RCO A;  3D5R C;  2R7S A;  3I5U A;  2FX0 A;  3DU6 A;  3IWF A;  3ZCO A;  2HVS A;  3AFH A;  4ETS A;  4PGG A;  2PI0 A;  3E6C C;  3KP5 A;  1V3F A;  2OF7 A;  5C44 J;  4A6D A;  4I2O A;  2QCO A;  4HX7 A;  2IS4 A;  1MBH A;  2F5F A;  2RDP A;  2OC6 A;  3RTR A;  3QU3 A;  1G3Y A;  3JRD A;  2F5E A;  3LL7 A;  5KVR A;  2E7W A;  3HOX J;  4QPO A;  2CU7 A;  2L2O A;  3OYI A;  2VPL A;  1IDY A;  2X48 A;  1H8A C;  2OBP A;  2OPT A;  4PJM A;  2E5Z A;  3JRI A;  3QPS A;  4AVP A;  3OOP A;  2KJC A;  4L9T A;  4MFE A;  2Z33 A;  1Z7U A;  2LBF A;  5LRR A;  4XSZ F;  1WJD A;  4IZZ A;  3ZGK A;  2ZXW H;  1UHW A;  2CMP A;  2OJE D;  4KT5 C;  2IEK A;  1X3Z B;  3BPX A;  1B1B A;  1HF0 A;  3IKV A;  1FEX A;  4I99 C;  1XCB A;  1SC7 A;  4NUB A;  3KE2 A;  2H94 A;  2CUF A;  2FOK A;  1B59 A;  4PJL A;  1S72 I;  3FZV A;  1MD0 A;  4YIR X;  3U9G A;  3CJN A;  4ANJ A;  1OYI A;  3HZJ A;  1HST A;  4MLO A;  3S93 A;  1S3J A;  2AXT C;  1V5G A;  2BW3 B;  4KN7 X;  2GWR A;  4FET A;  4RDU A;  1RIO H;  1VQ8 I;  2BXZ A;  4M3F A;  2PJR B;  2X6W A;  2LY2 A;  3S3M A;  4LG0 A;  4A0X A;  4A3B J;  3SFI A;  4IPA A;  5AIP A;  3HSR A;  4UVB A;  1D5Y A;  5ICE A;  5KK1 A;  1VQL I;  3LSP A;  1YW7 A;  4OOI A;  2X51 A;  3M8F A;  2HGC A;  2WAE A;  2N8G A;  2P5K A;  3GFL A;  4RLF A;  5B5E C;  2BOL A;  2GA1 A;  3RDI A;  1C0W A;  3F3X A;  3HGG A;  2LK2 A;  4RAZ A;  3VDX A;  1F36 A;  3R0A A;  5M5X J;  2KIU A;  2QQ8 A;  2UV1 A;  1IRG A;  3HJE A;  5ERI A;  1IGN A;  4A6E A;  2VJ4 A;  5CKT A;  2ZSH B;  1FOK A;  2VC1 A;  2M7A A;  1P2F A;  2CJJ A;  3BR6 A;  1BI3 A;  2QYO A;  1IF1 A;  4OMY A;  2WAF A;  4WCG A;  2HFH A;  3I4N J;  3HC7 A;  1FBQ A;  1MDM A;  4FIS A;  2ME6 A;  2CW8 A;  2ZFW A;  3GTP J;  3S16 J;  2WY7 Q;  1ERD A;  5E17 F;  5D6E A;  1ETW A;  1R5G A;  5CLS A;  2DN0 A;  2ISY A;  1YOV B;  4N9H A;  4XM3 A;  2RNG A;  1XCV A;  1DPU A;  1D8K A;  2BYV E;  2WB1 N;  1B8I B;  2KFD A;  4HEA 2;  1LE8 A;  5BOX A;  2G0E A;  2DQL A;  1WJF A;  2EH3 A;  3BTI A;  4LB6 B;  4GRI A;  3GTO J;  1BBY A;  2D2W A;  3CP8 A;  1MW7 A;  3DXJ F;  4AD9 A;  1BOA A;  1VQK I;  1WI9 A;  2OV7 A;  1IN7 A;  1Z77 A;  2LKS A;  2VBW A;  2KRH A;  3BP8 A;  1AHD P;  5J8F A;  3GBG A;  1WWX A;  3S2W A;  2O61 A;  1QNT A;  1RR7 A;  2CW0 F;  2ZXH A;  4EAT A;  3PUF A;  2DPU A;  4M9S A;  2OQR A;  2ZJQ F;  2OTJ I;  4XMY A;  3HOS A;  4CCO A;  3H0G J;  1OR7 C;  4PJN A;  2Z1D A;  2HQA A;  2R7D A;  3FBI B;  4FAS D;  2DT5 A;  4W1U A;  3A2K A;  1TLH B;  3K7A J;  3FMQ A;  5J3L A;  3B02 A;  2EIK H;  4IKF A;  3OIP A;  5KHD A;  5KCM A;  4EGZ A;  1MKM A;  3ZXS A;  2HOE A;  4BJT A;  2IGN A;  3PFI A;  1I3Q J;  1HSJ A;  3CP2 A;  1W4M A;  3DTI A;  4ZDP A;  1MSE C;  1RNL A;  4MFD A;  4RAG A;  4GFB A;  2E2I J;  5LGT A;  5HNF A;  3CUQ C;  3FMR A;  2LF7 A;  4P9U A;  2OD5 A;  3RSN A;  3CCS I;  4Z6Y A;  2F4O B;  3OYA A;  1TWH J;  1MH3 A;  2MC4 A;  3GW2 A;  1S29 A;  2WY8 Q;  3F8B A;  3K2A A;  3OSF A;  4N4O B;  4BBR J;  3IP4 B;  2JPB A;  1JI8 A;  4N0B A;  4LIV A;  1KQ9 A;  4D7N A;  1QHG A;  4BEH B;  3I64 A;  2NVQ J;  3WTW C;  1FYK A;  1WKM A;  4LJZ F;  2O6G E;  2JA7 J;  1QZZ A;  2A5W A;  3FM5 A;  3G4S I;  5DM7 F;  3KIO A;  4GCV A;  2XKP A;  1BR1 A;  3RYP A;  1D1C A;  2HOA A;  5B66 C;  2K3P A;  4M3D A;  1VTN C;  2KKO A;  2EIM H;  4UNO A;  3DTK A;  4LGW A;  3ABU A;  3FIW A;  2FBI A;  3QPT A;  1ETX A;  2O7O A;  4C9Y A;  5J1Y A;  5K5Q A;  1FNN A;  1UAA A;  1ZRE A;  2FEZ A;  3LA3 A;  2XSD C;  4L9N A;  1D3Y A;  3S8P A;  1QVU A;  2G7H A;  2DCE A;  2ZC2 A;  2IW5 A;  2VBX A;  4DYQ A;  3R4K A;  3T8R A;  2F4M B;  1ACI A;  2ZB9 A;  1IAW A;  3LSJ A;  4RGS A;  3SZP A;  4IEJ A;  5CVV A;  3JRG A;  1TBX A;  2CQK A;  1N78 A;  5E20 A;  4ZJZ A;  2Y0M A;  2NYX A;  4Q47 A;  4XOP A;  3VOD A;  3W6K B;  3CC2 I;  1K6O A;  1MBK A;  1MIJ A;  2KZV A;  2QGU A;  3RQI A;  5JFR A;  3HEF A;  2P7C B;  1OYW A;  2DOF A;  4F92 B;  4YG2 F;  3P9I A;  1DPR A;  1I3A A;  3P9K A;  2LD5 A;  3PJR A;  1E0E A;  4CYC B;  4XKC A;  4HDU A;  2XB0 X;  3HKZ N;  1E2X A;  4GYI A;  1GVJ A;  4HLX A;  3OL4 A;  3QYB A;  5E3O A;  2QBY A;  2CQ7 A;  4U87 A;  4AC0 A;  5IT9 Z;  2ZXI A;  2X4H A;  1BI2 A;  5GTI C;  4V2F A;  5AON A;  4C2T A;  1CGP A;  1ZAR A;  4JYK A;  1G3S A;  3I56 I;  1KZH A;  2K4B A;  2GLO A;  1USS A;  3GX4 X;  2RVC A;  3GEZ A;  5K5R A;  1DUX C;  3QOE A;  3I59 B;  1MMS A;  2F5V A;  1X19 A;  2L4A A;  2QQ9 A;  3DEU A;  2MD5 A;  3ELK A;  4AIH A;  2LC2 A;  2CV1 A;  1ZR2 A;  1MBF A;  2OQG A;  5BQT A;  3G2B A;  5TIS C;  2P0W A;  2E34 A;  3EUH A;  3NEU A;  5FKK A;  3HDD A;  3R60 A;  1T56 A;  1QHH D;  1XB4 A;  3O8H A;  3ABK H;  4XSX F;  2HKX A;  2L9S A;  4E7S A;  5DCF A;  2VXZ A;  3GFI A;  2F6C A;  3OYL A;  1A5J A;  2PLY A;  3PL8 A;  2R5Z A;  4ITV A;  3RZO J;  1R00 A;  2VQG A;  4A3G J;  1SAU A;  3BJO A;  3TO9 A;  2V6C A;  1QGP A;  4A3K J;  3OV8 A;  3ASO H;  2JTV A;  4MEY F;  4XLN F;  3AG1 H;  1HW2 A;  3PSF A;  3TO7 A;  3HOY J;  3K1M A;  4WWC A;  3HRU A;  2QQA A;  3V8J A;  3IAS 2;  1JHF A;  2IS6 A;  2L3D A;  3CMA I;  2FUG 2;  2A69 F;  3IH3 A;  1TWA J;  2DK5 A;  3AG3 H;  1KA8 A;  3V4G A;  4RMN A;  1EH8 A;  1GUU A;  2RNJ A;  4C2M J;  2JVG A;  1T39 A;  4X0G A;  3QYF A;  3Q9S A;  1Z7L A;  5FGM A;  1GDT A;  4DNC A;  4I02 A;  1RUN A;  1R1T A;  1ZTR A;  4LLG F;  1EA3 A;  2R93 J;  4L18 B;  1ZRC A;  4J01 A;  4QIW N;  2VE8 A;  3OS1 A;  3JTG A;  3H0D A;  3KP7 A;  2DDB A;  1X4P A;  4BQQ A;  1RPW A;  5FFZ A;  1IRZ A;  2DK8 A;  3KP4 A;  1IXC A;  3N4M A;  2DA1 A;  4ENJ A;  4KJZ A;  2E36 A;  1XG1 A;  1HLV A;  1HKT A;  2DFI A;  2COM A;  2K85 A;  3RI4 A;  1XSD A;  2K9L A;  2HTJ A;  3AG4 H;  2EIJ H;  4E6K G;  5A2Q Z;  3W2A A;  2V4J C;  1ZRF A;  3ZMV A;  2VT3 A;  3FK7 A;  2FSW A;  1SD4 A;  3K1N A;  2Y0S N;  4KIC A;  1MMD A;  3DF8 A;  4CDG A;  2EJR A;  1GT0 C;  5F27 A;  1X2N A;  5HS7 A;  4AYB A;  3KZI C;  4IJA A;  1MMA A;  1F5T A;  5IT9 K;  4BY1 J;  1R6R A;  3ZOB A;  2IPQ X;  5IOZ A;  3FBN B;  5J40 A;  1VQ5 I;  2Q2E B;  3VSL A;  2K27 A;  2K9Q A;  4EEF G;  1IDZ A;  1OPC A;  3PO3 J;  2NVY J;  2VBY A;  3Q3S A;  1N75 A;  5C4X J;  3OWT A;  4PZJ A;  2M7B A;  3NRV A;  4RGX A;  4B43 A;  5JI6 A;  2B9S A;  3MCZ A;  4IX7 A;  3KET A;  1BI1 A;  3JW4 A;  4V19 K;  2K7L A;  1JKR C;  1UB9 A;  2KL4 A;  2ID3 A;  3DPU A;  1ETQ A;  5BS6 A;  2EV5 A;  1P7J A;  2X6O A;  1QPM A;  4BEH A;  3OYM A;  3E5Q A;  2DA7 A;  5EGO A;  1ZGW A;  1SFU A;  5HLG A;  3FHN A;  1A35 A;  4P55 A;  1TWG J;  2BVL A;  3WTX C;  5IT3 A;  1XMK A;  3GTK J;  3DU5 A;  2W84 A;  1DGR M;  3L2U A;  4JBA A;  2YU3 A; 
#chains in the Genus database with same CATH homology
 2BW3 A;  3LSM A;  3BG6 A;  2IGK A;  1X1A A;  3TBI A;  3VYR B;  4CA0 A;  2VKH A;  2PJR A;  2AQE A;  2XAU A;  3NWS A;  1Y6I A;  2XDV A;  3K70 C;  1DP3 A;  2Z2S B;  4DBQ A;  1WJE A;  4DGW B;  4BE2 A;  1D1B A;  2E1M B;  4CCJ A;  2IS2 A;  1OLT A;  1G59 A;  2UWM A;  3RQ4 A;  3OOU A;  4BXF A;  3OYH A;  3UNG C;  2KPM A;  4OWR B;  3OR2 C;  2VLA A;  2RRE A;  3J7A Y;  2MAB A;  4JQF A;  2E5N A;  2KLO A;  4B47 A;  4U7B A;  1WJ5 A;  4E7Z A;  4B3X A;  3CF2 A;  2HDW A;  5FRM A;  4ZC3 A;  3DPT A;  3H9J A;  3LSK A;  2ZSI B;  1MMG A;  1U0J A;  3H5N A;  2E1M C;  3C2H A;  3OY9 A;  2WAQ A;  4BE0 A;  2VIX A;  3OL3 A;  4II3 A;  3KEY A;  4KIT B;  3KYL A;  4XL9 A;  1P9Q C;  3RCO A;  2R7V A;  3D5R C;  2R7S A;  4BJ5 C;  3DU6 A;  3ZCO A;  2HVS A;  3AFH A;  1V5F A;  3DQV C;  4XLF A;  4XNF A;  2LG4 A;  2IS4 A;  2A6T A;  3L2W A;  2IXS A;  2OC6 A;  3RTR A;  4XLC A;  2CS3 A;  2LRD A;  4CCN A;  3LL7 A;  4E7L A;  4QPO A;  3HOT A;  2L2O A;  3OYI A;  2VPL A;  2WBM A;  3M8J A;  3TL4 X;  2VJ5 A;  4PJM A;  4C30 A;  2E5Z A;  1MND A;  3K4M A;  4Y33 A;  4YEL A;  4LIT A;  2LBF A;  3H35 A;  1V5E A;  1WJD A;  4IZZ A;  3ZGK A;  5HVQ C;  4ZDO A;  2ELJ A;  4ZTJ A;  2CMP A;  2VJJ A;  3K70 D;  4BDY A;  2X1C A;  1D1A A;  4P5O A;  1Z3X A;  2W82 A;  2JA2 A;  1Y56 A;  3DTE A;  2QKM B;  4NUB A;  3EUA A;  4G6T B;  4PJL A;  4II2 A;  3HUG B;  4ANJ A;  3OYE A;  3CJQ B;  4ZTF A;  3OYK A;  2KMU A;  2LRE A;  4MLO A;  3S93 A;  2BW3 B;  2VXD A;  1V5G A;  4E4H A;  2R4G A;  4FET A;  4XKV A;  3TMO A;  1WFX A;  4BL0 B;  2PJR B;  2X6W A;  3V42 A;  1PJR A;  3HPH A;  2LY2 A;  3S3M A;  3DWL E;  3UR3 C;  4BQO A;  3K6G A;  2VQH A;  3EPZ A;  4Y4R A;  3SEZ A;  3K4K A;  2PMZ A;  4HG2 A;  1YX5 A;  2X51 A;  4AU7 A;  3DKX A;  1LVK A;  1J09 A;  4B48 A;  3OYN A;  2WAE A;  3U21 A;  4RLF A;  1W36 C;  2BOL A;  2WB1 A;  1LDK B;  3VDX A;  2JVH A;  3OR1 C;  3PFY A;  3SZG A;  4AVZ A;  2W00 A;  4RM3 A;  3C2G A;  2UV1 A;  4XON A;  5JHF A;  2VJ4 A;  1KON A;  4OAZ A;  4D9J A;  5CKT A;  2ZSH B;  2DJI A;  2ZFU A;  4NNJ A;  4BDZ A;  1BOB A;  3HG9 A;  2M7A A;  1MNE A;  3LSH A;  5HNH A;  2CV2 A;  2CV0 A;  3H9Q A;  2KHM A;  3BG7 A;  3VWB A;  2X6Y A;  2WAF A;  3EUH C;  3HC7 A;  3VYU B;  2CW8 A;  2WY7 Q;  1ERD A;  4F93 B;  3L2V A;  2V26 A;  2HPI A;  4XN3 A;  3OIQ A;  1X1D A;  2R7Q A;  4KT6 A;  2IS1 A;  2RNG A;  1Z3Y A;  4JOM A;  3CES A;  5CPR B;  4HEA 2;  3CJR B;  1VZ0 A;  3IAM 2;  1WJF A;  2R7T A;  2W1O A;  3HPG A;  4GRI A;  3SYT A;  3W3C A;  3M1C A;  1MW7 A;  3CP8 A;  1ZEL A;  2OV7 A;  1X4O A;  2LBF B;  1WJB A;  2E60 A;  2KRH A;  3MKY B;  3GBG A;  4CCL A;  2ZXH A;  3LFU A;  2K5C A;  4EAT A;  3VSK A;  4PK4 A;  3BCA A;  2V1N A;  4XMY A;  2XF6 A;  4PJJ A;  3HOS A;  4CCO A;  4PJN A;  1OR7 C;  4CH7 A;  2Z1D A;  4HRI A;  2HQA A;  3IUO A;  4XN0 A;  2L5Q A;  4BU2 A;  3FBI B;  2X6X A;  3DPL C;  1WJC A;  4FAS D;  1W36 D;  3A2K A;  2LYC A;  3OYF A;  4PFP A;  2IGO A;  2X1D A;  2CUJ A;  4IKF A;  2VQL A;  3OIP A;  5KHD A;  5KCM A;  1TZL A;  1FMV A;  3ZXS A;  4BJT A;  2IGN A;  3MMY B;  2CFO A;  3CP2 A;  3DTI A;  4ZDP A;  3AL0 B;  4N4N B;  2HNH A;  1T95 A;  2KP6 A;  4CUG A;  5HNF A;  2HVR A;  4XKB A;  4F52 A;  3EUK L;  2HZD A;  3RSN A;  2Y0S A;  2CW7 A;  3OYA A;  2M4K A;  3H5A A;  2MC4 A;  2WY8 Q;  4N4O B;  4HSR A;  3IP4 B;  5TGT A;  2W4S A;  1JI8 A;  4LIV A;  2KQR A;  4OAY A;  4ZDL A;  3SEQ A;  1QHG A;  4BEH B;  1IRX A;  2I8D A;  4E7K A;  4DOZ A;  3VYS B;  3DKY A;  2QKL B;  2A5W A;  3OYJ A;  3W2V A;  3DLA A;  3D5S C;  4XOR A;  1BR1 A;  3CMM A;  1D1C A;  2HPM A;  3AL0 C;  2K3P A;  4PSX A;  2RQQ A;  3DTK A;  3OS2 A;  4DBR A;  2NOJ B;  1NG6 A;  4C9Y A;  3HKZ A;  1UAA A;  4QPQ A;  3DEE A;  4XR6 A;  1N77 A;  3A4C A;  3S8P A;  1LKX A;  4RM2 A;  1X1B A;  4BUP A;  2DCE A;  2MFZ A;  1D0Y A;  3OYC A;  1K6Y A;  4BGD A;  3HL2 A;  3H5R A;  1N78 A;  4XLE A;  2DXI A;  5FRN A;  4ZJZ A;  3K4B A;  4XOP A;  4H4K C;  2KZV A;  3ZR8 X;  1PYV A;  1X1C A;  3SDB A;  2K9M A;  1BR2 A;  3NWT A;  3OS0 A;  3BCB A;  3OMY A;  3H9G A;  2LH9 A;  4F92 B;  3AKZ A;  4C2U A;  3K4N A;  1DQU A;  1SFK A;  3PJR A;  4CZC A;  1E0E A;  2VAS A;  4IQ4 A;  1Z21 A;  4XKC A;  5HOO A;  2AQF A;  4LIU A;  2R7W A;  4RLQ A;  3PNT A;  3OL4 A;  3QYB A;  4R79 A;  2MD0 A;  3N05 A;  1TT0 A;  4U87 A;  3I3L A;  1QU3 A;  2W7N A;  4HNU A;  1AA7 A;  2ZXI A;  4P1W A;  2XSJ C;  4PFO A;  5CQE A;  3L2R A;  3S3O A;  2L9N A;  4C2T A;  2BVM A;  3L2Q A;  3PNY A;  3FDY A;  5KNL A;  3VYT B;  1UEL B;  2JUG A;  4F55 A;  4CCM A;  1D0Z A;  2WA0 A;  3QOE A;  2F5V A;  1X19 A;  4XKW A;  2CV1 A;  2LC2 A;  2LOO A;  2XF7 A;  2V6E A;  3G2B A;  1S9H A;  2P0W A;  2CUZ A;  4XQF A;  4KIS A;  1QHH D;  4PUS A;  3PUB A;  3BC8 A;  2L9S A;  3LMM A;  4E7S A;  2VXZ A;  3QOD A;  3OYB A;  3A1Y A;  2F6C A;  3OYL A;  4NC7 A;  3PL8 A;  4BJ6 C;  2M3A A;  4XLA A;  1NG7 A;  2DT6 A;  4ITV A;  1T0F C;  3HXL A;  2VQG A;  2HU9 A;  2VKD A;  1SAU A;  4ZYA A;  3S32 A;  4D1Q A;  3W2W A;  4YEJ A;  4CCK A;  2X85 A;  3PSF A;  2M0M A;  3E1S A;  2XF5 A;  3IAS 2;  3D5L A;  2IS6 A;  2L7K A;  2FUG 2;  3ZRG A;  4XOT A;  4F91 B;  4RMN A;  5LD2 C;  2Z16 A;  2JVG A;  1FMW A;  4X0G A;  3QYF A;  1Z7L A;  1WJA A;  3RPU D;  4HST A;  2KDO A;  2WAD A;  2V7F A;  3ZQQ A;  4BQN A;  1EA3 A;  2MYS A;  3OYD A;  4E7J A;  4J01 A;  3OS1 A;  4LG3 A;  2JSP A;  3H0D A;  1DGW Y;  5FRO A;  3PSI A;  1UG0 A;  1X4P A;  4BQQ A;  4E7I A;  4XLH A;  3K4J A;  2VJI A;  4BAC A;  4KJZ A;  4F3Q A;  1LFP A;  2VQC A;  1YE9 A;  3MKZ A;  2R7R A;  2CH0 A;  2K9L A;  3K4C A;  4E6K G;  3W2A A;  2R7U A;  2M4G A;  4BS9 A;  2V4J C;  1GLN A;  2HVQ A;  3MD2 A;  3PNV A;  1MMD A;  3MKW B;  4PSW A;  4DIQ A;  2KRC A;  2IGM A;  2F4I A;  3LSI A;  4CSW A;  2LY1 A;  3ONQ A;  3CZ6 A;  4AYB A;  2R7O A;  2O5R A;  1MMA A;  2X1E A;  2GOM A;  4IQJ A;  1R6R A;  5LFA A;  2VB6 A;  3E0J B;  3FBN B;  3KX2 A;  2Q2E B;  3VSL A;  2GOX B;  3S3N A;  4NC8 A;  2V9K A;  4YRV A;  5HLT A;  1HA8 A;  1BR4 A;  3K10 A;  3FKJ A;  1N75 A;  2OUM A;  3OWT A;  2M7B A;  4B43 A;  4IX7 A;  5CQG A;  4NQW B;  2XC7 A;  2KL4 A;  1MMN A;  3DPU A;  3OYG A;  2R7X A;  3F9K A;  4J00 A;  3QYE A;  3I9V 2;  4B44 A;  4BEH A;  1YX3 A;  3K4L A;  3BLY A;  3OYM A;  3LSG A;  2VL8 A;  1G8X A;  2DOA A;  4HNT A;  4E7H A;  3FHN A;  4HPQ A;  1D0X A;  2BVL A;  2UUZ A;  4BE1 A;  3DU5 A;  4DJA A;  2Q1Z B;  1DGR M;  4Y3O A;  3L2U A;  4XM3 A;  2DT7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...