The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
70
|
sequence length |
267
|
structure length |
244
|
Chain Sequence |
GPVRTPHADVLLASVGERGVLCDFYDEGADGTSEAREFATRTVSGPVLELAAGMGRLTFPFLDLGWEVTALELSTSVLAAFRKRLAEAPADVRDRCTLVQGDMSAFALDKRFGTVVISSGSINELDEADRRGLYASVREHLEPGGKFLLSLAMSEAAESEPLERKQVLHVRHLPAEEIQEITIHPADETTDPFVVCTHRRRLLAPDQVVRELVRSGFDVIAQTPFASGGAGRKDMVLVEAVMPG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics.
pubmed doi rcsb |
| molecule keywords |
PCZA361.24
|
| molecule tags |
Transferase
|
| source organism |
Amycolatopsis orientalis
|
| total genus |
70
|
| structure length |
244
|
| sequence length |
267
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2009-01-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF13649 | Methyltransf_25 | Methyltransferase domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Carboxypeptidase Inhibitor; Chain A | Carboxypeptidase Inhibitor; Chain A | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Vaccinia Virus protein VP39 |
