3G2OA

Crystal structure of the glycopeptide n-methyltransferase mtfa complexed with (s)-adenosyl-l-methionine (sam)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
267
structure length
244
Chain Sequence
GPVRTPHADVLLASVGERGVLCDFYDEGADGTSEAREFATRTVSGPVLELAAGMGRLTFPFLDLGWEVTALELSTSVLAAFRKRLAEAPADVRDRCTLVQGDMSAFALDKRFGTVVISSGSINELDEADRRGLYASVREHLEPGGKFLLSLAMSEAAESEPLERKQVLHVRHLPAEEIQEITIHPADETTDPFVVCTHRRRLLAPDQVVRELVRSGFDVIAQTPFASGGAGRKDMVLVEAVMPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PCZA361.24
publication title Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Transferase
total genus 70
structure length 244
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1040.60 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3g2oA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3g2oA02
3NMUF 2AOUB 5GM2A 4YUVA 4FZVA 3CJQA 4GOND 3TM5A 3D2LA 1FJXA 4QPNA 1JSZA 1ZGJA 2YR0A 3B3GA 3TKYA 3DOUA 4B17A 1NW3A 3PFHA 5C9ZA 5E1MA 1O54A 2ZIEA 3P2EA 5DM2A 1FPQA 2FHPA 1NT2A 1I9GA 1VBFA 3TMAA 4YUXA 2YTZA 3BGDA 4PGHA 5HIKA 4BP3A 2P1DA 5GIPE 1KPGA 2HNKA 5CUQA 5EOVA 5P8WA 4DKJA 3BKXA 4OBXA 4RTJA 1YZHA 4PCAA 3KQSA 5CVDA 1FBNA 5E9QA 5FQOA 2ZSUA 3KKZA 2YVLA 5K0EA 2E5WA 3SX0A 1XDUA 1VQ1A 4DF3A 3BZBA 5CIYA 4PYQA 3KQQA 3TQSA 1AV6A 3FUTA 2PT9A 2PX4A 3KQTA 4OX9Y 3ELWA 7MHTA 3O7WA 3RW9A 2ADMA 3FRIA 2FPOA 4PONA 3TOSA 4E2ZA 3G5LA 3IEIA 2ZWVA 2AOWA 3A27A 4AZWA 4KW7A 2OKCA 2P3OA 3EVAA 1JR4A 1R74A 3KR1A 4DCGA 1WXWA 5DX8A 5MHTA 4CTJA 1TW3A 3EMDA 1YF3A 1JSXA 2Z6QA 2ZIGA 5BP7A 4MIKA 5EEHA 2Y1XA 3KHKA 2EFJA 3PX3A 3OZSA 2AOXA 1R8YA 4AUKA 1EQAA 3HVKA 3SVZA 2YXDA 5DM1A 2GH1A 1ORIA 4QVGA 5EVJA 4O29A 1KPIA 3PVCA 3SR4A 2IDKA 3LL7A 5GWXA 2G70A 3REOA 2CWWA 4R8RA 3IHTA 3KQMA 2O0LA 1SUSA 3HP7A 4RVGA 3NW9A 2I9KA 4RTQA 1ZGAA 2ZZNA 4RSRA 5FWAA 4RTLA 3FPEA 1L9KA 2G1PA 3FUUA 1XVAA 4C05A 3HCDA 3BGIA 3QOXA 2BR4A 3QV2A 4EVIA 2PWYA 2P3QA 3EMBA 3BXOA 5K8VA 2H1RA 5JR3A 1X19A 2G71A 3DMGA 5F2OA 5E9JA 5EEGA 1HNNA 2ZTHA 5H02A 2ERCA 1X1BA 1P39A 3GIWA 3OU6A 1VE3A 2BH2A 3Q87B 3FYCA 3EPPA 1XCJA 2EG5A 1NKVA 3EVZA 5FWDA 5EHGA 4HH4A 9MHTA 5EGSA 3SSMA 2QRVB 5T64A 1INLA 2YX1A 3NWEA 1KYZA 5ICGA 4K6MA 2FRXA 3GCZA 1NW6A 4FS8A 3KR0A 5EG5A 5K0GA 3DTNA 2AVNA 4JXJA 3LBFA 1EAMA 4POOA 3UA4A 3KPUA 2C7OA 3I58A 1IY9A 5GOZA 2YXEA 2ZBQA 3FUXA 4C06A 2P40A 3M70A 4Y30A 5EIWA 3UJ8A 3M6VA 4GEKA 2JHCA 4PGGA 2WA2A 4RVHA 5DX0A 5LQUA 2H11A 5K0CA 2I6GA 5ICCA 4HTFB 3CVOA 4NECA 1Q0SA 2PBFA 5BXYA 4HRAA 2NXJA 1UFKA 3P97A 1UIRA 1XCLA 1VPTA 4Y2HA 3KQPA 4CKCA 2UYCA 3IV6A 2AN3A 2DULA 5E9WA 1FP1D 4X1OA 1Z3CA 5LR6A 3FPJA 1ZQ9A 3I9FA 2I62A 3B3JA 5ICEA 2ZWAA 5DT2A 3FTEA 2O07A 1SG9A 2XYQA 3M4XA 2GAFA 2OB2A 4QTTB 2VDUE 1T43A 2PXAA 2UYOA 3C3PA 4OA5A 4RTPA 1SKMA 1SVUA 3I53A 4KIFA 3HCCA 3ELYA 1YFJA 4CKEA 1QZZA 2GA9A 4X41A 5HOQA 1JQEA 3R0QA 3PTAA 4BP1A 2AVDA 3BWYA 5CVJA 4G56A 3OFJA 1JG1A 4PINA 4ER5A 3DXZA 5IKMA 2QM3A 3FPGA 3NWBA 4V0RA 4E32A 3UWPA 1VP9A 5HIJA 1KP9A 5D1NA 3CKKA 4YV1A 1RI5A 3P2IA 2B25A 1DCTA 3C3YA 2UZ4A 4RWZA 1XDZA 1HMYA 2PV0A 3HEMA 3M6WA 1R18A 3O4FA 5HEKA 1EIZA 3SMQA 2AOUA 4IWNA 3KQYA 5FQNA 3FUWA 1AQIA 1JG2A 1V39A 2DPMA 3JWHA 4AZVA 5LQJA 10MHA 1SUIA 3GNLA 5HFJA 4LWPA 2GLUA 3UZUA 1B42A 4YUYA 2HTEA 5BW4A 2K4MA 3P71T 3ME5A 1SQGA 1P1CA 3HCEA 4FT4A 4C04A 4E30A 5U4XA 1JG4A 1YB2A 1JTEA 2C7PA 1ZG3A 1DUSA 2B2CA 1RI3A 4FP9A 5CD1A 3A26A 3R6TA 3ELUA 5DRTA 3LCUA 5CCXA 3BWCA 3BGVA 3LDGA 2ONYA 3NDIA 3DMHA 3LCVB 4GC9A 2AN4A 4M38A 3GO4A 3HVJA 2AOTB 3G8BA 4X61A 3QOWA 3B89A 3G2MA 3G7UA 1JTFA 3TRKA 5DX1A 1KPHA 3C0KA 2JJQA 2VZ9A 1R8XA 3SSOA 1YZ3A 2O06A 3CJTA 4QQKA 4PNEA 4YUZA 2AS0A 5KVAA 2R6ZA 1G38A 4LG1A 1QAQA 4HGZA 2XYVA 4M7RA 2CKDA 2GS9A 3ANXA 2VS1A 1BC5A 2YUIA 2FYTA 1D2CA 3CC8A 4XUEA 5B1SA 4E33A 3DXXA 3GJYA 3EEOA 5EMJA 1VP3A 3MGGA 4Z2YA 4EQZA 1G6Q1 2HV9A 5FA5A 5DLYA 1RI2A 2KW5A 4DCMA 4EKGA 2XYRA 3OU2A 4GQBA 4PYOA 2YQZA 2B78A 4BY9E 2OO3A 3ELDA 3KQVA 5GM1A 2P7HA 3LDUA 3LECA 3HA3A 1L3CA 2NP7A 4E70A 1N7IA 1QYRA 3EGVA 4FT2A 5G02A 5EMLA 3B3FA 5FA8A 4P7GA 1P91A 2QY6A 3O31A 2BZGA 5EKUA 4X63A 1WZNA 3PLAE 4YMHA 4HC4A 3BWBA 4IV8A 2BR5A 5K0LA 1G8AA 5KYGA 2ZBRA 3FPFA 5HIIA 2O05A 5DPMA 4PYJA 1MJFA 3T7SA 1P1BA 3EVBA 1X1CA 3LKDA 2OBFA 3G2QA 1QAOA 4GOMD 3DH0A 2OY0A 3FUVA 3JWIA 4QTUB 4C4AA 2JG3A 2HMYB 4FGZA 4PYIA 5C0OE 3MQ2A 4E31A 2ZCJA 2NNWB 3F4KA 4M37A 2PT6A 3E05A 1NW5A 2ONZA 2PWPA 1Y8CA 5FCDA 3P2KA 5FHRA 3B5IA 3KPJA 3U81A 1NW8A 3V97A 4DMGA 3B7PA 4PWYA 4C03A 4RTRA 2Z6UA 1VIDA 2NP6A 3TM4A 5M5BA 1M0EA 3EEYA 1EJ6A 3H2BA 4C08A 2B9EA 3GRUA 3JWGA 3UFBA 1JQ3A 3ER8A 2BM9A 4KRGA 1PRYA 4P7FA 1R00A 3IYLW 4U7TB 5GIOE 4KIGA 1JQDA 4KWCA 5E2BA 2HWKA 3SM3A 3TPZA 3EVCA 3OZTA 3FRHA 5K0NA 1NV8A 3HVHA 3S68A 5EZSA 2PX5A 4RV9A 2AR0A 4FSXA 4CKBA 1G8SA 3OZRA 3X0DA 5T67A 2C7RA 3UJ6A 4XUDA 1F3LA 4R6WA 2PJDA 4OA8A 3GRYA 4HSGA 4M36A 1XXLA 5FULA 2IPXA 5HZMA 1NW7A 3OE4A 5LSAA 3THRA 1I1NA 3DUWA 3VYWA 3UBTA 3UJ9A 2Z6AA 2JH8A 4KVZA 4LWOA 3R24A 3UJ7A 4EK9A 2JH9A 5E1DA 8MHTA 3PX2A 3P9KA 3P9CA 5EPEA 3T7RA 3C6MA 2Q41A 4BLUA 4PIPA 3SXJA 3C6KA 1WG8A 3AWIA 3CBGA 5DM4A 3EVGA 2WA1A 4EKIA 3OU7A 1VL5A 5GP1A 4WXHA 2V74B 2IH5A 1O9GA 3I5UA 3ID6C 3G89A 3PFGA 5C1IA 5EC8A 4HGYA 3CCFA 3GGDA 2OXTA 2PLWA 1D2HA 1KHHA 2AOVA 4X60A 3FZGA 3LCCA 2EJTA 3LDFA 5DTQA 4RTOA 1F38A 4PCLA 2C7QA 3VC1A 4DM3A 2GPYA 3HCBA 4C07A 3T7TA 2HR1A 2IH4A 2ZBPA 4HG2A 2ZW9A 4E2YA 3A7EA 3DMFA 3GWZA 1YUBA 2ZZKA 4H0NA 5E8JA 1R6AA 1BOOA 3HCFA 4QQNA 4CWAA 1G60A 5CVUA 3BT7A 3LBYA 4QVKA 1XDSA 4MHTA 1L3IA 5EIFA 2PSSA 3MAGA 4PYKA 3KR9A 1YFLA 2A14A 4ISCA 2OZVA 3VC2A 3DR5A 5LQNA 2R3SA 3MHTA 3G2OA 4R8SA 3TLJA 2IP2A 3HNRA 3E23A 4FSDA 4ER7A 4GF5A 2O57A 3GDHA 2P41A 3KU1A 5K01A 2XBMA 2IFTA 3LPMA 2ZLBA 5EMMA 2CL5A 3AJDA 3MTEA 4WVLA 3WSTA 1ZHFA 3P9IA 2PX8A 2JHAA 5DXJA 2AOTA 3EGEA 5DM0A 1H1DA 3HA5A 2G8NA 4OQDA 2BR3A 3NTVA 4YUWA 3BWMA 5BW5A 3M6UA 3PS9A 1EG2A 4AZTA 2NXNA 3A25A 3FYDA 5E2AA 4BLWA 3A7DA 2ESRA 5CVEA 5LQRA 4R6XA 2NXEA 3EGIA 3DLIA 4RX1A 3TR6A 1MHTA 3LHDA 4RVDA 4RTNA 4RVFA 1TPYA 2FCAA 1QANA 3EVEA 2VP3A 5DWQA 3P9NA 4E2XA 2NXCA 4ATNA 5DSXA 3AY0A 3GXOA 4F86A 3CJRA 2OB1A 3OE5A 4GUAA 2QYOA 5K0FA 1ORHA 3M6XA 4KDCA 4AZSA 1X1DA 3BKWA 2UYQA 2IDJA 3TFWA 4IV0A 3AXTA 4L7VA 3SGLA 5K09A 3E8SA 3PB3A 5F2NA 5LQKA 3NDJA 4OBWA 4EMSA 3DULA 3E7PA 3NVMB 5LQAA 5DTRA 1N7JA 4YV2A 3UJDA 3MERA 4RYLA 2Y1WA 2EX4A 5KQSA 1NV9A 3FTDA 5HILA 5FTWA 3LX6A 2ZVJA 3JWJA 3DLCA 1RJDA 1M6YA 3LSTA 5CVVA 1AQJA 5E1BA 2WK1A 3FTCA 3HM2A 3LGAA 3M33A 3OFKA 4GOOD 3HTXA 4GOLD 4ER6A 3I64A 1KIAA 4PYMA 4XUCA 3MB5A 4DZRA 1D2GA 2YXLA 1I4WA 4A6EA 2AZTA 3Q7EA 2QE6A 2V7EA 3A4TA 5HIMA 3HVIA 1Q0TA 4PYLA 4F85A 2ZZMA 1RJEA 2OPBA 3NVKI 1L1EA 2VDWA 4V0QA 5DXAA 3K0BA 5EKXA 4ZTBA 3T0IA 5JUWA 3KQWA 2XVMA 5F2KA 5EMKA 4FR0A 1BHJA 5IH3A 5DSTA 1FP2A 2QRVA 3DXYA 1U2ZA 3KR2A 5DTMA 4YV0A 3GRVA 2FK7A 2IGTA 3UJAA 3G5TA 3UJCA 1SQFA 3LKZA 3L8DA 4XCXA 1WY7A 2P3LA 3HCAA 1G55A 3MCZA 3ER9A 1RJFA 1NE2A 1NBIA 5T6BA 3G2PA 5K05A 3TKAA 1RI1A 3OPNA 5E1OA 3THSA 2PGXA 2UYHA 1ZKDA 3GRZA 2IBTA 3FTFA 2IIPA 1OR8A 2JHPA 5D1HA 2NYUA 2PKWA 5FHQA 4DA4A 2CMGA 4P7JA 2P7IA 5EQJB 2EJUA 4HTFA 3MTIA 3HA7A 2G72A 4OQEA 5CM2Z 5K0JA 2PX2A 4QDJA 2P8JA 2ZFUA 1KR5A 3CGGA 3EVDA 4PIMA 3RODA 4MTLA 1QAMA 5EHIA 4E2WA 3K6RA 4MWZA 1L3BA 2PXCA 3RIEA 2N47A 1IM8A 2VDVE 2F8LA 4GBED 1IXKA 4P7KA 2BM8A 2P35A 4BLVA 3ORHA 1X1AA 4MQ4A 4ER3A 3FPHA 4PYNA 2LD4A 2PY6A 1BKYA 3GU3A 2AN5A 4UOEA 5KQRA 2IH2A 3ERCA 5CCBA 3R9XB 3KPWA 1WXXA 1EJ0A 3DP7A 2CMHA 1RJGA 2XVAA 5ERGB 5EZQA 3R3HA 3P8ZA 5FUBA 3UJBA 2B3TA 1VLMA 2I7CA 1PJZA 2ZIFA 5E8RA 4AX8A 4QDKA 5FADA 3V8VA 4A6DA 4YMGA 4P58A 4CXMA 4IKPA 1NBHA 3BUSA 4LECA 3KQOA 1O9HA 4GC5A 4QPPA 1JG3A 3EVFA 3MCTA 4DQ0A 2GB4A 5LQCA 4U7PB 2H00A 1N2XA 1XTPA 2ZULA 5K0BA 3UA3A 3PT9A 1UWVA 1WS6A 2PVCA 5ICFA 3KPVA 3KPYA 5DRYA 3NJRA 1AF7A 1KXZA 1XJ5A 5GINE 3OCJA 1TW2A 1KYWA 3AXSA 3SSNA 3G88A 4R05A 4RTMA 4F84A 4KDRA 2OYRA 1RI4A 4RTSA 3GRRA 3VSEA 4RTKA 4ER0A 5K03A 1DL5A 1M6EX 2ORED 2PXXA 3G8AA 2IBSA 5KS2A 4CTKA 2FK8A
chains in the Genus database with same CATH superfamily
2QX4A 1F8YA 1MXFA 3DQZA 4UUPA 1NFQA 3FOCA 3D2LA 3PFKA 1EBBA 4ADSG 3EHEA 4FYXA 4C6TB 3EG5A 3IVGA 4NONA 4DIKA 3ORFA 2OLKA 1PG5A 3E03A 4HB0A 3QBJA 2F8TA 1T5DX 4W5NA 1J1IA 3PHGA 4QQRA 1VDZA 1PCXA 1LSJA 1U8YA 2X9LA 2XRFA 4ML3A 4B4DA 4D44A 5JYCA 1NM5C 2XADA 4IXNA 1GM5A 4FFLA 2LDBA 4Y1EA 4U6QA 5EIBD 2QY9A 3BORA 3IEKA 3QXHA 3KKZA 1VLZA 1Z07A 2YVLA 2ZAIA 1T2DA 4L3OA 4TM8A 2YMPA 1DSSG 2VRNA 4OXQA 4ZOBA 5ALXA 2WY2D 4A5OA 1TJNA 4HH0A 1OWNA 1RWQA 3FUTA 4HXYA 4RHUA 5A4DA 4DCTA 2R6GA 2B9VA 3RIHA 1NVWQ 1RTKA 1S8FA 1UPXA 2P9TA 1E58A 3MEQA 4G4JA 1G19A 1AKYA 3RW9A 1CY7A 4BZWA 2EX0A 2HH9A 3EMKA 5F21A 4QDOA 3ZCPA 4DNXA 2WJPA 3D5TA 4MLZA 3V3TA 2WPDD 3EZ2A 3VPFA 4UDXX 4DCGA 4OGFA 1O9BA 3WICA 4EDFA 4JI4B 1E69A 2A1UA 3OMLA 1K5PA 2ZSKA 3B8HA 3PLNA 4JSYA 1U2SA 1UBRS 1K8RA 4MIKA 4A0GA 3RS2A 1W9MA 4FHZA 4AP5A 3C48A 3CR7A 1JQKA 2R87A 3DM9B 3O4HA 1ML4A 3MBKA 3DEJA 3D43A 4J16C 4F71A 2IY9A 3QE9Y 1EFVA 3OD5A 1ZMTA 1KFKB 2I7XA 1LSSA 1RQ2A 3N5CA 1BU5A 3NT5A 3WO0A 3AFOA 1E9CA 4RTLA 3U44B 1L9KA 3HR7A 1I2DA 2BR4A 2SHKA 3K09C 5SYNA 4U6NA 2FUG1 4WDQA 5JBNA 2VUIB 3BXOA 3EF1A 1J8FA 1N32B 3H2KA 3TW6A 2BBTA 1UFOA 3D7MA 2Y67A 3AIIA 1CUVA 2IHZA 4GMHA 4TV8A 2DUMA 3L0OA 2Q2VA 4IJQA 2ICAA 4V03A 3P7MA 4F1JA 4QTZA 2GN6A 3PRKE 1ND6A 1JPUA 4QSMA 4QARA 5CHEA 2VDRB 2BF4A 1CG6A 3QVGA 4WN9A 5JT1A 6YASA 4H7FA 1IN7A 1R0BA 3K0SA 3NLLA 1DTVA 3RU7A 3NC4A 2HHLA 4H3HB 4JLSA 1R6DA 1NW6A 1U8AA 1GZ4A 1JJBA 4GMKA 1RXYA 2GAIA 3DXFA 2JAXA 3DTNA 1CD5A 3GPCA 3K72B 4CM3A 3A9SA 1C3JA 3RO7A 2X3UA 3HGTA 1WU8A 3P1JA 3H0CA 4MPDA 4EJMA 4J0KA 4Y30A 2GPBA 3UYLA 2VQSA 2ACWA 2GZRA 3ASVA 3T1TA 1CZHA 4Y2JA 4D80A 3OOEA 4NZOA 2I1QA 2FSVC 4ALNA 4B3FX 3PFWO 5LQUA 3O3OB 1Z75A 3CVOA 2C99A 4CV3A 1E9EA 5DHPA 4I5EA 3U6BA 2XMBA 4OB6A 1VI5A 5HTOA 1JHDA 4TSFA 1MF7A 1DQPA 4FKMA 4CQLB 4NPCA 2W83A 2BHNA 2I6TA 2IK8A 1BS9A 1ZRMA 4MIYA 3QE3A 3R7WA 3ZBQA 3I9FA 3OZCA 4NY1A 3ZD7A 3V4FA 4DWOA 3FCYA 3CNBA 1NY5A 4ZTUB 1C7QA 3JVIA 2IXBA 3OC6A 3CEAA 3OJWA 4Y6PA 5ALGA 1SKMA 4ZO7A 4CLRA 2G04A 1P2UA 3Q8KA 1POWA 1YE3A 1JVBA 1YRBA 3E2MA 1P2FA 3KELA 2J31A 3WOVA 5CR9A 1JHVA 3KXKA 1JFVA 4ZCSA 1ND5A 4EMBA 4NATA 3EA4A 1XKQA 3GT4A 4MUGA 1Y80A 1A2QA 2JPDA 4UCWA 3D0OA 3KL4A 1KDTA 4MS1A 4DC1A 2WR8A 4HDQB 5HEKA 2W6MA 3A6HA 4Q34A 3KQYA 3IMKA 4XEHA 1RLTA 1F6WA 3L04A 3F3KA 4KPUA 2BEWB 3ZVKA 1JG2A 1U04A 1VE9A 4MWBA 5CYPA 3PWZA 3ZZNA 4CFSA 2AFHE 4J16A 1ZBQA 3PWKA 4IFEA 4RW0A 4B46A 2K4MA 1E5DA 1K6XA 1XZGA 2CGEA 3J7AC 1Y7IA 2PVSA 3LX8A 1LV8A 3EPJA 3OTIA 5KU7A 3RAPR 1BE1A 1X7HA 2J3HA 2HUPA 2XR1A 3CW8X 4J49A 1ZK2A 4QU0A 5A4KA 5IANA 5FWYA 3LDGA 2HF2A 3GJ8A 3HUUA 2FUNB 3K09A 3IUQA 4KO1S 3ZWMA 4BVAA 3SFZA 2IUEA 1IY0A 1GQYA 1RYNA 5CTJA 3LI2A 3KEGA 3GJ3A 3MCUA 2J6CA 1YZNA 4QQKA 4UVDA 4GNKA 1GLGA 1FMCA 4BLSA 5B57C 2VH1A 4JYZA 3D3QA 3EC2A 4R71A 1KO5A 4QJ4A 4ID3A 1G8MA 1ODTC 4EGAA 4A0FA 1VB3A 3BM5A 5CB6A 1UKCA 2YICA 3D4LA 3DXXA 2EARA 3H9JA 1G291 4PWZA 2Z1DA 2CJYA 3UVEA 2UXBB 2HV9A 2HU5A 4EKGA 3NAMA 4IH1A 4RIFA 4X7PA 4A16A 4YRZA 3U19A 1CF2O 3RVMA 4D79A 4XRGA 3GLGB 4E5DA 1VTKA 1ACMA 1J25A 2QJRA 3HN7A 4NBWA 4KK4A 1KORA 4IJ5A 3VOBA 1FDTA 1YZTA 1ZK3A 421PA 2WQZA 3O1LA 3WJ2A 4LJLA 3BMCB 4WY8A 1MG5A 4R3WA 2FSVA 4OM7A 1TKCA 3ITKA 3TK1A 4EI2A 1PNRA 3AW8A 5AJXA 5H83A 4PLGA 3G7SA 4WD3A 5DPMA 5FI0B 3RFXA 5LIRA 3EA0A 4ZOEA 4P81A 1JQBA 2Q46A 1IHOA 4N0DA 4M1ZA 5T4BA 3RIYA 2BCGY 2IIQA 4C4AA 4ERNA 1GSOA 2A1UB 4UPEA 4X6YA 5PGMA 2BAGA 4H0FA 3V55A 3AJRA 4C4SA 5AIAA 4CI0B 1U0NA 4JLMA 1CQIB 3TG2A 4IXTA 4KQ1A 1EM6A 1GL7A 3L93A 4ZCTA 3EW7A 1AMOA 2ATEA 1W2HA 2I4MA 4C08A 5ENVA 1ZW1A 5AQEA 4EY7A 1OA1A 2Q2OA 4O4IB 3FF4A 2PPVA 4P7FA 3TS1A 3I83A 4F4HA 1VBNA 1RXVA 4E09A 3KSBC 2F55A 4YAWA 1D5CA 3Q3EA 1N2CA 2JIQA 4Z8XA 1KFBB 3AINA 3BJZA 4NMXB 1WTCA 1DC4A 3N53A 3F3SA 2ZBGA 3H2HA 5JSZA 5CJ2A 2FUKA 2JBAA 3PQ8A 2CVZA 3BD9A 2EHDA 1F3LA 1WE2A 4YLYA 1W0JD 1Z4IA 2OFOA 2QTMA 1A7AA 1WKCA 1FQKA 2FVYA 2O4UX 3H2ZA 3THRA 1TB4A 3SF0A 5IJ0B 2LV8A 3NVDA 4MA5A 3GGJA 3CLTD 1ZN9A 2BJHA 2JRLA 1GPAA 2ZRCA 3KX2A 3VOAA 1LLFA 5FV7A 3LLSA 1JP7A 4XE5A 4BIIA 4QULA 2ZJZA 1PDOA 3AV3A 3HWX1 4MP3A 4BLUA 3QBEA 5EIXA 2I3ZA 2VOEA 1YTUA 4OLFA 5IVKA 5AVQA 3IKLA 2QM7A 4LNHA 3Q1LA 1FUKA 4Q4LA 3AUXA 3BSSA 4RVCA 2WVAA 1C0LA 2IZ5A 2OXTA 2YS6A 5A0FA 1BWQA 5BPFA 3TNDA 4LPSA 3FZGA 5KTPA 1FRNA 4OXKA 5GVRA 3L41A 4O2AB 2C7QA 3FR7A 4QAJA 3BDVA 1RWOA 1U0EA 1VCIA 2Z43A 4DCNA 6CHYA 4ZJUA 3L84A 5HYVA 5FYQA 4JLAA 2B21A 3PC3A 3HYTA 1KSGA 3G59A 3GRFA 1R6AA 4RKWA 1JW9B 4C5CA 4YFYA 4K9KA 5C5EA 3DE1X 3A3YA 3L1KA 3LL4A 5J4LA 4LF4B 1SXPA 1ODSA 3ISTA 2D5IA 4LYEA 3OY7A 1GGMA 1WHSA 2YWDA 3UXHA 4MGIR 1XKLA 4JEHA 3DR5A 5REQA 1X80A 2HF7A 4LOJA 1YRYE 1P74A 1DEHA 1SHUX 2IP2A 2FCRA 2PSEA 4RADA 4WCFC 3KXPA 2E4UA 2J09A 4D6XA 4HEHA 3GRPA 4P0TA 4N3NA 4I6GA 1Y6RA 2VUSA 2ZPTX 2ZRNA 1YZKA 3SYKA 2AUMA 1JHMA 1WZUA 1X7ZA 1H1DA 5BMOA 2WI8A 2VXBA 1AS3A 3CTPA 2DKOA 1YV9A 2IPNA 4L0MA 5E6UA 5FOUA 4WKBA 4YUWA 1ZL0A 3NKLA 1Z4NA 4YI3A 3TYXA 3RDPA 2JLAA 1LLQA 1UKYA 4BCDA 5AUNB 2PIDA 2NO0A 3H2SA 3DLIA 3NIFB 3TR6A 3ZD6A 2OWEA 2R7LA 4DUZB 4RVDA 1VBKA 3MTQA 3EIHA 4RTNA 1JH9A 1RWNA 5H16A 1TTPB 4ZJZA 1N2CE 5BMVA 4PXAA 2PFSA 1Q7CA 3CJRA 3PYMA 1YOVB 2BI4A 3GDGA 3M6XA 1QIHA 4N0QA 1R8QA 3K70D 2BKLA 2G5PA 4L7VA 3K5WA 2P9BA 1VE7A 1QGOA 3D3WB 2FSGA 3TGPA 3JQ8B 3NDJA 4L5YA 1OX4B 4GX5A 1A9SA 3FPLA 2L17A 3UWSA 2IYVA 1LA2A 2BEVA 3FNHA 3MERA 3TJMA 5ADWA 1R0YA 1ZNQO 3Q3HA 3R7BA 1H2HA 3I62A 2HXGA 5ALQA 3FF1A 1V2HE 4CKWA 3UBMA 2LUOA 1DC7A 2V7WA 3ABOB 2WW8A 3W3AH 4Z4CA 1I33A 1XPJA 2IYLD 2VBIA 4HI0E 1L6IA 3H8VA 2FX5A 3OFVA 1XVIA 1Z15A 1SR8A 4G0YA 3UY4A 1T0PA 3EIFA 3O8CA 2WC1A 3KB6A 4X1IA 2I1VB 1Q20A 1P9LA 2ZTVA 4BWFB 2YWXA 4PYLA 2C2OA 2OCLA 2ZQZA 3L4BC 3I9JA 1ZSVA 4JJEA 5CHYA 1S2OA 2YC4C 3KYDB 1RM0A 4I2VA 1CR1A 2FZ5A 1XLWA 5GONA 5LBUA 3EPHA 3OCZA 4EHHA 3DONA 2JDIA 4BTLA 4IGFA 3G1TA 4RK7A 3IP7A 1M74A 4JYAB 2ZSIA 5BN4A 5IYZF 4EPVA 5AM2A 3L8DA 3ROTA 5TVKA 4AMYA 4MYTA 5BSHA 3BTVA 5I9SA 2MYNA 4DEXA 3FMGA 1HQYE 3O92A 5D3KA 4N47A 3PI6A 3G2PA 3ABZA 4PO3X 4BMZA 1US8B 3AU8A 3SU8A 4GWKA 3W0LB 4Q6BA 4DQLA 4E94A 5D1HA 4YDSA 1R27A 1E2QA 4OP2A 4BQIA 2PR2A 5LMUB 1BRMA 3F9CA 3T5CA 3VDQA 3PPXA 1EFUA 2R6FA 1A96A 3CBQA 2FY8A 1O5OA 2W58A 1LWNA 4HZGA 4Q5IA 3WYAA 4D4GA 2ZFUA 2B98A 1L4KA 4UBOA 1L8AA 3OJEA 4WCFA 4Q4JB 1E6KA 1KC1A 4IIJA 3UWMA 3T3IA 2ZJ7A 2QTCA 2W42A 2FH5B 2H7CA 3D0QA 1UXGA 2Q8QA 1NJGA 4BE7B 1IM8A 1K98A 2R8YA 2VP2A 1IBCA 2QG9A 3ORHA 4Q12A 1WSBA 1X1AA 2GPTA 3O38A 2GF0A 3KOWA 4B82A 2AJTA 1T8TA 3AUJB 1LSUA 1AN0A 1FYXA 3RSCA 1HBJA 2OM2A 4UOEA 3LHSA 3C85A 1NZFA 5AM0A 1IZZA 1K1EA 1KEVA 3HNOA 3JZFA 5SZHB 3ZDQA 3MWYW 2HADA 4E46A 5IAOA 1HDCA 1ELOA 1O2DA 2VDMB 3RU2A 4F60A 2ZB2A 2E3JA 2IXEA 5K1ZA 4M0DA 2WSMA 2X1LA 3LT5A 5A4IS 1NOIA 3DQQA 1IZ9A 2MSKA 1E9AA 1MB0A 3GJ4A 3U3RA 3THXB 2Q0QA 3BS4A 4YMGA 5A4JA 4P4TA 1HG0A 1KO7A 3HYNA 3ZUPA 4FI3C 1F9AA 4P9NA 3U3OA 2AG6A 5TF0A 1JH8A 4B73A 1G4HA 2QUKA 5ADVA 2DXIA 1KEEB 2EU8A 3W1VA 2D5AA 2EJBA 1KGSA 3ZU4A 2YHAA 1FB5A 3IB6A 3MZ0A 4UHHA 3FA2A 4U7JA 4Z86A 3AXSA 4GOXA 3I5AA 2P2LA 3A28A 1KJYA 4ZAFA 3RRBA 5AJWA 4ARAA 4BZQA 4Z3KA 4W5TA 5H4HA 3OURA 2LPMA 3VR4A 4PSCA 5JNUA 4JUFA 4X71A 1GLNA 2E4VA 3SHTA 2FK8A 1BGXT 4MW1A 3THWB 3IV7A 4F6LA 4JGBA 1YR2A 1M72A 5HDQA 5B1HA 3L4BA 3N7UA 1TQ8A 1G3QA 1WHSB 1CUAA 1ZAYA 1NF9A 5REQB 1X80B 4YR7A 1JEAA 1NR1A 2VSQA 3Q9UA 3JRXA 3ZHXA 4DG9A 5JJ5A 4DJFC 1NT2A 2O48X 3JYQA 1I9GA 1OXXK 4FGWA 4M55A 4PC1A 4DSOA 5LQMA 3AVVA 4FMBB 1TM1E 1OY1A 4D96A 1WV0A 1BIFA 2HRZA 3UUWA 5ALFA 4DKJA 1ODLA 3ZZ0A 2CUNA 1Z4MA 3OOJA 1X7ZB 3TTXA 3K0CC 2ZSEA 5TQ2A 5FTJA 4XPIA 1DQRA 3QFFA 3ROGA 3PNOA 2D0PB 3GRAA 5BV1A 1RAGA 3AUKA 5ULLA 4C30A 5H59A 4ZCLA 3ACBA 1Y3FE 4X62B 3WZLA 2PX4A 5I4KA 3O7WA 4GOJA 3WI7A 4F91B 3VKGA 1IOZA 1YMVA 3TR0A 3A4VA 2WAXA 3A27A 3PV0A 4UULA 2P3OA 1VGVA 1XUOA 3MPOA 1K92A 1U90A 2FWRA 4H15A 3UW1A 3WDLA 2YHBA 2JLVA 4KMRA 2RK3A 2C5GA 5AVTA 1W0KA 4FYIA 4U9HS 5DHTA 4FR2A 9ATCA 4GOKA 3W1EA 5CB4F 5HQ3A 2BW0A 2Y1XA 1SUAA 5LA6F 3G1UA 3U7QB 1TA4A 1LQ2A 1MB4A 2PVPA 1ORIA 4RJJA 5AKHA 3TLEA 5L3QA 2FEOA 1SC3A 2AMVA 4YONB 4QOHA 2G76A 1JDJA 1NJ8A 1XA3A 2HQOA 2GM9A 3DC7A 3VSAA 3ZN2A 3W5DA 4CGZA 5FPHA 4NFYA 1ORWA 3URMA 2R7AA 1TADA 3I23A 2FJUA 2L0XA 1Z0JA 2HREA 5EN4A 4CDMA 2Z2KA 4ZYYA 3TZHA 2OHJA 5DNCA 4EUFA 2RHWA 2ZTHA 3FWPA 4QREA 5ILQA 4Z1MA 3SEZA 3U0VA 4RPJA 2XXAB 4I1RA 5JAQA 3ZIDA 1V4BA 1CV2A 2V5VA 3M6MD 3W05A 3ADDA 3BH0A 2XKAA 3FYCA 5JH7A 3EPPA 2XNDA 1XCJA 2J6BA 2OORC 1T34A 3CZPA 3EVZA 4IX9A 4PICA 4A3SA 1HYBA 2D00A 4N5MA 3UKJA 4QOGA 4K81B 1H8HA 5FOSA 1MVOA 2HIAA 3JQAD 4FBGA 5T64A 4EHKA 1XNJA 2FRXA 3DNPA 4C6RA 3DAFA 1D2EA 2NPIA 3H86A 2YBEA 3FIJA 2ZIVB 2Z04A 3WIVA 4XGQA 2G8LA 2B5OA 4HXEB 1RLMA 1CTQA 3WWZA 2VNAA 2C42A 2AW3A 4TPKA 3VJRA 1O8BA 1HEYA 4EYEA 3ZLUA 1PJLA 2QTWB 1OREA 4MDFA 2I29A 1Y37A 3O82A 4WLFA 4L72A 4YA6A 4ZOCA 5HG0A 1AK1A 4P93A 4V0LA 1Q0SA 1Y6QA 2PBFA 4IEFB 4UU8A 3P97A 2QI9C 2Q5EA 1YDFA 2VHWA 4Y2HA 4Y6RA 1LD3A 3CEJA 3CQ9A 5JNLA 1RZRA 2JFNA 2WYIA 3QEKA 3N1UA 1Y4ZA 3G2JA 2H57A 1QF6A 1O8CA 2IZ7A 1VHTA 3EWIA 4NU8X 1CDZA 4UDYX 3K2QA 4HNAB 1KO4A 3KM0A 4LHZA 3MWEA 4TS3A 3HSSA 1SG9A 1XQVA 2PUFA 2QGFA 4QUIA 1L1RA 3K0CA 3LUAA 1PLLA 1V8BA 4EJFA 1DQZA 1ZCAA 3IDSA 4YRCA 3TQIA 1NVXQ 1OJLA 1SVUA 2AYXA 3G02A 1A2KC 1RKBA 2AQ8A 4B75A 5B5SA 1YFJA 4OQZA 1UZMA 2HHAA 3MMPA 2D2VA 5HOQA 1AT1A 4Q00A 3PTAA 1DNPA 1NI5A 4KLCA 5BQFA 3K30A 1X9IA 3DXZA 1RZ3A 4DCCA 4EHJA 2P9QA 3M4YA 1EA5A 2B5WA 1RM5A 4BGDA 2J4CA 3F0TA 3LX5A 3OKFA 1DZIA 5I9LA 5JI2E 2BTEA 2CHFA 3LTNC 3HEMA 2H3EA 2VWGA 3W9UA 5CK5A 3GOQA 3FCCA 3H4TA 1R4NB 1V39A 1WUKS 4MO9A 5BXQC 3PUXA 4RVUA 5LQJA 3DDZX 2J32A 4G67A 3O90A 3WGIA 3NHSA 2WTBA 3QKRA 3OEWA 5AKEA 1U98A 5U4XA 4DC9A 3PSHA 2I54A 5C8YF 4GXNA 2LXNA 2R79A 1JYSA 5CD1A 1EK2A 1EVIA 3A26A 3ELUA 4G0XA 4JLJA 3REFA 2QNRA 3BWCA 2QV7A 3HFSA 3OTQA 1T2NA 4FC6A 3BZUA 4PAQA 4C0SA 1H94A 3PHHA 2JK0A 3IAM6 4MULA 4AXXA 3ORQA 4Q7JB 2FQWA 4MROA 5EESA 1Y34E 1LK7A 1AS2A 4LY3A 2HMWA 5AVSA 2GN1A 2O06A 2XDQA 4PNEA 3K6SA 2R2GA 2ZAOA 3GFRA 1GLVA 1ZITA 3C1AA 2O23A 2Y1KA 2HQ1A 4LCEA 4GR9A 3L6RA 4LV6A 1E2DA 2EW8A 2QV0A 2OORA 1ZIDA 1XEFA 4I50F 4PR0A 5IW8A 5K4AA 3STVA 1E2FA 3CPSA 4JK3A 4PNHA 5IBRA 1G6Q1 3ZWWA 1BCSB 4BBZA 4CMBA 5DLYA 3GLHE 2KW5A 1LWOA 2BFAA 1HSOA 2ONCA 3KSMA 4EYQA 2ZYTX 5IDVA 5CLJA 4RA9A 4ZEXA 3AQ4A 4P32A 3DGFC 3L0CA 1Y4SA 3D8HA 3GMSA 4BVFA 5JEEA 16PKA 1NPTO 4TQUS 3ZI4A 2OOSA 1D9ZA 1JWAB 1ACJA 1JEDA 4XPIB 2RAPA 1QR6A 3O31A 2AG5A 2N46A 1NQ5A 2HX1A 2O2EA 3FDZB 1TD1A 1Y82A 4TWBA 1WMAA 2HU8A 1RZVA 2O2DA 5J2TA 1DBRA 1VSQA 3BTUA 2O05A 1DT3A 5DBOA 3CTMA 5TPZD 4F96A 2NPFA 3FHCB 1YL7A 4Z3DA 2AHRA 3JPWA 4HB4A 1SFRA 2VBCA 4M8LA 1RJ9B 2P4QA 3E7WA 3IDZA 2WJWA 2FSFA 3QQPA 2ZPAA 3L6UA 6ADHA 2PT6A 2NMVA 1KJIA 2ONZA 3AI1A 1N1DA 3AY6A 3RJZA 4E3WA 5IM4F 1HZZC 5SY9A 1U3FA 4YRIA 2P30A 3M5CA 4BMPB 3GN1A 4MW6A 2QD2A 3A3OA 1SIWA 2AG1A 2Q5JA 1DU4A 1CS0B 1QC5A 1H1TA 2J7PD 1QFSA 4Y6GB 5EXDA 4ENVA 1WUTA 5FI5A 5L3QB 5IS2A 2QWXA 3JWGA 4D45A 3UFBA 1P5FA 3HHEA 1JXMA 4ZVPA 2EKBA 4KIGA 4M1YA 5D5QA 5JE8A 1BMFD 1FRZA 3NHMA 4H9GA 3QBTA 4HXGA 4MR9B 2PSFA 5AI8A 1CZUA 2V6BA 4FEAA 1XD8A 2WUEA 5K3AA 4A9AA 2RHCA 3EEIA 4OHVA 2QP9X 3OAAD 1RQGA 3FROA 3K31A 1RKQA 1S3SA 4NJOA 4MV6A 3TBHA 2D5LA 2ZJ8A 5CDFE 2Q3DA 5DYGA 1WBBA 5EJ5A 2I2XB 2BBSA 2JEOA 4M1WA 4AP6A 5A03A 3C24A 4LWOA 5DLPA 5JISA 3UT6A 1V45E 1ZGHA 2ZITA 5DMXA 4X8MA 1N5OX 1M6VA 1MNAA 2AJCA 3T9FA 1FUEA 1X86B 2ZJ3A 2CKMA 2Q41A 2O3TA 3SXJA 1MO3A 3C6KA 1F2TA 2WA1A 1NVAA 3JALB 2B99A 3RTEA 4WLOA 2W0MA 1GXSB 1GL3A 3I5UA 4LZJA 1KE2A 2GK7A 3C3XA 3TEMA 3PFGA 1BX0A 4TX1A 1QZUA 2QGZA 3EXFA 4RS3A 2CXUA 1KQGA 3IEPA 2DHCA 2ZJAA 3F97A 4E51A 2ZYIA 3H2GA 1F38A 1GRRA 2HCTA 1C41A 3L8MA 2GPWA 4OAQA 1I6WA 5DGDA 1T9DA 2XV1A 5DK4A 2W2PA 2FTKE 2PZGA 1VMDA 3P19A 4DA6A 1SKUA 4XGRA 1S9HA 3B6IA 4JEIA 3EIWA 4MQEB 1S8AA 4LBWA 3H16A 1G60A 1OH5A 2XRMA 1KDRA 3ZX5A 1NJFA 3G17A 3F90A 4J4BA 1GCOA 4YROA 5DU2A 5IT4A 1GYRA 4NENA 2R5NA 2F1OA 4OJYA 1N34B 4DR4B 4F4IA 2WVGA 3Q0EA 5ITSA 1YCHA 4IJ6A 1E2IA 3ZHBA 2M1XA 1RM3A 4NLLA 1K8YB 4E88A 2XB9A 3AX6A 1PI3A 2R3SA 1JQJC 3KD2A 4EHNA 4EFMA 1ZU5A 3I2YX 4O4HA 5IUJC 2G17A 2JIDA 4RLQA 1SKYE 1KRWA 3EPLA 2JHAA 5DXJA 4F97A 3PWTA 4N3AA 1GSHA 2R4TA 5CX1A 1VPWA 4AJ2A 3GFTA 2BPOA 2D4HA 3MVEA 3EAQA 1HZZA 3CN9A 5KCZA 1RHJA 1M2VA 3HKEB 4GLFA 4L51A 5KSWB 5TSDA 5AFSA 4S2UA 1T0BA 5KOYA 2PS0A 2NU8B 5EP4A 3AEUB 1GQFA 4J75A 2EOAA 1YAHA 2R6HA 2RGDA 1C0EA 5LYJF 1KOGA 2VTKA 2X9VA 2GGSA 4RE5A 4U1RA 2Z56A 2ZWOA 3QX7A 3QVJA 2BEUA 4QG7A 4DPKA 1B2RA 5DTJA 3T1OA 1XZBA 3OE5A 4KGVA 1OAAA 4N9WA 3VVBA 4Z1OA 3RTAA 5TMBA 4MQLA 3M4NA 4PLYA 1GZ7A 1R4AA 1UBMS 2XLBA 1PYDA 3OFNA 4L3WA 3ZW8A 1OFUA 2CXOA 4OYYA 4Y9RA 3W6UA 4AKTA 4F8YA 4MVJM 4UAUA 5DV9A 4RANA 1EJBA 2FVXA 4NE2A 1N92A 4OBWA 2AYZA 1UKZA 1VECA 2GF9A 3I6YA 2IV2X 1ZK1A 5EKDA 4ALJA 1RP7A 3CH5A 2EX4A 4A1FA 5KQSA 2VUTA 3LX6A 4UHFA 4KE7A 5A2QA 2WF6A 2DTDA 3F78A 1OYOA 9GPBA 5AVXA 2EX1A 2WAOA 2XUFA 3LGAA 5KBYA 1DJMA 4NFLA 1GPJA 1ECBA 3X1DA 4N3GA 2QPOA 4N12A 2HLHA 4ENRA 1U0JA 2OHXA 4OP1A 3KT0A 2CYBA 1DAOA 2D2EA 4PHCA 5L3RA 1UQUA 5TT0A 1UH5A 4EF5A 4QM7A 4Z9FA 4F85A 2VWPA 1OZHA 1WZEA 3HCOA 2PUWA 3PDHA 3JW8A 1YR8A 4WA8A 4YMSA 2SKEA 4Z7OB 4JXXA 1AO3A 1WB5A 4FGJA 2HWWA 4UE3S 3BJMA 5I7EA 2XDYA 2O52A 3WXMA 4CU5A 3KR2A 4ZI3A 3KUXA 4ZVVA 4YV0A 1H9CA 3RC1A 3IHLA 2PM8A 3TLZA 4BYGA 4B1FA 4J2OA 1SIOA 2PTGA 3ZJVA 3VTZA 3UN1A 3NNNA 1RU3A 3SJ7A 4G2TA 5K3FA 4TMZA 2FN7A 3KWJA 5KOHB 2YY6A 3PR3A 1LSOA 2QLTA 4PPYA 5E1OA 3IUMA 2YMLA 3T7AA 4LZNA 3R9KA 3UAZA 2UYHA 3K1TA 2OD9A 4MUNA 2NYUA 4XW2A 3HI6A 4BLPA 2FEXA 4MQFB 2E4ZA 1T13A 2QN2A 5EQJB 1HURA 1ISJA 1Q1GA 2HLNA 2W6NA 3LUHA 2G72A 4UEWA 5CM2Z 2ZKIA 5AJYA 3L05A 3DPUA 4N54A 2EAUA 2DSTA 2R44A 3N2GA 1A97A 1TQ6A 2N1BA 3WVNA 1AZTA 3LC2O 2KQUA 1OB2A 3JQ7A 2GERA 2BWJA 3RTCA 4LXXA 2JGAA 4EG5A 2ZT7A 4UXIA 1U2EA 5BR7A 2BGUA 1PZHA 2DHQA 4N6OA 3C7KA 4DDWA 2KPOA 4CEHB 1H4VB 2YYZA 1YZUA 4FDTA 4KXXA 2Y1CA 4REQB 1C9KA 2PX3A 3K5PA 3GROA 2ALJA 3WBFA 5CDHA 4JNCA 2D4AA 4MPJA 4EW2A 2XMZA 4W9MC 3HN2A 5DIZA 2X0JA 3C3JA 2COEA 3VR3A 2ZE7A 3DFZA 3PJGA 4QA9A 5EXPA 3S3TA 4BNWA 1EXVA 5LN1A 2EZ8A 1GZ3A 2DR0A 5BQ5A 1NE7A 1KS9A 2H52A 4CKCB 3TVTA 3EULA 4F5YA 3GELA 4X92A 1CQXA 1H2RS 4MPTA 5HCNA 1F2TB 1P2DA 4GS5A 2I6XA 2XZDA 4QPPA 4EYGA 3FVRA 1IHDA 3L07A 3ZE0B 1KF0A 2B1RA 1XBTA 4L1KA 5AOAA 5EIOA 4G1UC 1IWOA 5LLTA 1PV4A 3COJA 1QU3A 3EXFB 4IDOA 2V5AA 1PVVA 2VAWA 1GN8A 3PT9A 4IIGA 3GA0A 5L3SA 4LXGA 1QGDA 1WS6A 1EE2A 2PXHA 3R3VA 1PQYA 2TYSB 3KPYA 3Q0IA 4FHGA 2OV4A 1REQB 1N6NA 1YDWA 3MGKA 3VMMA 1KYWA 2Z8YM 2HSDA 5IDWA 1RLOA 2VG8A 2JZNA 3AF5A 4H18A 3LVBA 3ZE9A 3P20A 4AN1A 4EA8A 4ETIA 4ZZ1A 1L7RA 5M04A 5E95A 4QKQA 4RTSA 2E9SA 4I9FA 2ZE6A 1JSCA 1N1GA 4EMTA 3G8AA 1U9JA 4OKNA 1B4DA 5HKOA 2AOUB 4QQ8A 2LIPA 2R6JA 4YUVA 1JTVA 1KH1A 5JJLA 3KOYA 2IYZA 4G5FA 4B17A 4ZEMA 1HYGA 1P3DA 1UR5A 2BC9A 3T4EA 5J59A 3T3OA 5DM2A 1RFGE 4XVCA 1UZUA 2BGKA 4KB5A 2YBDA 5P21A 1QHSA 3LY7A 4JA2A 3CVYA 3JYHA 3T1QA 4O3MA 1YD7A 3MIZA 3QUAA 1GGJA 2ZQYA 5EIEA 2PH1A 2WG0A 4P54A 5LL6P 4F1KA 4QHTA 3GFBA 1TYBE 3QEOA 4RTJA 4RHEA 3DFMA 3TJRA 1KDVA 4G5QA 4C3VA 2FZGA 4BLOA 4C29A 1Q84A 4L4RA 2JJ1A 4CMHA 1M2VB 2GZ1A 3KS9A 5CIYA 2WOJA 3DE5X 5LD2C 1QGYA 3RVNA 2HHHB 2E18A 5DYYA 4P7BA 3T9EA 2O3UA 2Q6VA 5BVHB 4PONA 1NYTA 4PRZA 3RUIA 2BFEA 5KNDH 4DYDA 2VHTA 3KLOA 3VTAA 4AJHA 2G4CA 4B79A 4MRMB 4CE6A 5KVVA 3WGTA 3RUPA 1QPZA 4X7BA 2I87A 1JR4A 1UBKS 2EBHX 5F4BA 5DX8A 2BP7A 1NJ1A 4YMIA 1CERA 3EBPA 2R7NA 3A1TA 3WQRA 2RHHA 4U9UA 3RS5A 2B7LA 5KVQA 3KHKA 1FDSA 2EFJA 3ADCA 4PSVA 3IQGX 3S40A 3CUTA 1D9XA 2Y71A 3KCNA 1WCYA 3N2KA 1T5LA 3WL3A 3U13A 2AIRA 3LL7A 2VP0A 3CLSC 3UK2A 1X42A 2I5PO 3B78A 4M22A 4PQYA 1Z12A 4CQMB 1SO8A 4L07A 5BR8B 3KB2A 4NZMA 1JXAA 4NMMA 4TWIA 1PWXA 1TIKA 3IAM1 1EUCA 4ZZ2A 5KI6A 2JIPA 4B8YA 5BRJA 5HUJA 5HZKA 2J67A 4PLHA 3OQNA 4FOPA 2CHEA 5IMBA 1RQLA 3SHOA 3FUUA 3HE3A 1QHGA 2MSDB 2YOHA 1MQSA 3NR2A 3ZV6A 2H2DA 5CCEA 4TGLA 1RYMA 2H1RA 4ARUA 1O7JA 2A3RA 4CCSA 1KDPA 4E1AA 1HNNA 5ALDA 1PK8A 3GNTA 3I9OA 4RQTA 3ZY4A 1G9SA 3KWMA 3GEBA 1QHFA 2Y0BA 3ND8A 4RLSA 5CIWA 4BBJA 4MHOA 1V6SA 2R68A 3IMGA 2O20A 1TI7A 3I05A 4MXDA 4B34A 1IONA 3KJNA 2DHDA 4FBLA 8GPBA 4HH4A 5A5DA 3SSMA 1ZI8A 4E1VA 3ZH2A 3GNSA 4PX5A 3IKVA 5EG5A 1YS1X 3VDNB 1RWKA 4P4SA 3IAS6 4JENA 4ZQCB 5F2EA 3VI3B 4WK4B 3JYLA 1MVLA 2PA0A 3KRTA 3WJ7A 4MJ7A 2MDTA 2VYND 1RC0A 4AJNA 5K3FB 3ZXSA 4Q7KA 3ZJ4A 4DJTA 3TQFA 2UYGA 5JC8A 2F1KA 3ZCRA 4ZVRA 4DMUB 3W1WA 1NDHA 1Z5VA 3K94A 4AUNA 5KX5F 2D62A 1FQOA 1MX1A 2CZGA 2NSDA 3N2EA 2Q9CA 3A1DA 3N0RA 3RI3A 5GTDA 3PHBE 4BFTA 3S2ZA 3NBMA 1DIHA 1ZGZA 2IOFA 3DZ8A 4AJ9A 3JQ7B 3PNKA 1VM6A 3KQPA 1YA6A 5EXEA 4ZIRA 4F11A 4BE9A 2VRCA 5E9WA 1L5OA 4FFOA 1C3OA 1GSAA 3LOUA 1MU0A 1NLYA 4CU2A 1ZQ9A 3L49A 1PSDA 2HLDA 4RJTA 3B3JA 1WEHA 3LBIA 1NVTA 3BD7A 3OE7A 3QKSA 4F12A 3FTEA 1L7MA 1Z22A 4G0OA 5SYAA 5ES3A 3PR1A 4G1FA 3EA5A 3VR0A 3X1XA 5DHAA 2J3QA 3A9TA 1FXWA 3STYA 3TQTA 3OMXA 1KMHB 1Z7YA 2O8NA 1UMKA 3O8BA 3B9RA 4QLAA 5LYYA 4DXDA 1Q83A 2CV0A 3EEOA 4XASA 3K1AA 4EPRA 4FYYA 3A6JA 4J1QA 4M99A 4CKYA 1ZVMA 4ZAZA 5KSOA 3Q3JB 1BN6A 1VPDA 4HK4A 3O0DA 1H65A 2NYAA 4DWWA 1TLLA 4KX3A 2BKEA 2Q5OA 4U5XA 3HR8A 1OKKA 1VXOA 3D8BA 3FN4A 3L7DA 4MP6A 4S1NA 3RC7A 1GKIA 5JDCC 3OQPA 2D74A 3F1KA 3O4FA 3KYCA 4LBYA 1Q0HA 4RD2A 4DG8A 5EJ7A 2Z2JA 4G9GA 3TG8A 3TOXA 4ZYVA 4P5PA 3CLVA 4I3HA 1QHEA 3QU2A 2ACKA 4LWPA 4CDRA 1W87A 5L3SB 4BTEA 3GLFA 3MSCA 2JIZD 4US0R 4JT8A 1OLXA 2DE0X 4KZKA 2PS3A 1UADA 1LPMA 1F8UA 3A31A 3EZ9A 3B1YA 4O4JA 2AQHA 3N5KA 1P2BA 4HQOA 2IA5A 3COZA 1N5KA 3G9ZA 4UEJA 1WB9A 1AMUA 2LIVA 1MHPA 2IYUA 5EJ4A 2AOTB 3BL8A 5EMHA 3S99A 5F5NA 3OJXA 1V9LA 3H6KA 3SX4A 1K89A 4PO8A 4ASUA 4F5WA 3BMNB 7ADHA 1Y8RB 4BPBA 3ANNA 1EX9A 4HJXA 2A0KA 2FSUA 2W0SA 4XUEA 1Z47A 3V4LA 1MRNA 3MGGA 1M1YB 3HU2A 3T7IA 1OVMA 5IJAA 3U40A 2EZUA 1PGJA 1SURA 1CUBA 3DD1A 3EASA 3CCCA 4LSMA 4RPHA 1W75A 2Z5LA 4JNKA 1TU3A 2B78A 2PTHA 4ZVUA 3BD8A 3DZGA 4G3XA 5DI3A 1TO6A 4UBLA 2O7RA 3CZQA 2IU4A 1J0AA 1EDZA 2ZXEA 2WHYA 4R0VA 4NC9A 5AKLA 3T7DA 2PWZA 1URPA 2LBPA 2PNJA 3RROA 5I45A 3AZPA 4IJMA 3QLJA 1FX0B 1VCHA 1XTQA 2VPYA 4FINA 4MOWA 1FIUA 5KEIA 4WXPA 3L9XA 2C4VA 3A2MA 1JSLA 2BFEB 4IDFA 1VRVA 4NHOA 2OCDA 1AZLA 1CKEA 1KYTA 2Q6TA 3HLTA 3P26A 4M9UA 4QGAA 5F1KA 4C89A 1YL6A 2FSSA 1ULBA 5F5XA 1M76A 2HMYB 3F4BA 4PYIA 4AO6A 1Q14A 4MV8A 3F4KA 4M1SA 1LFAA 4ZZ0A 1HQCA 5FFNA 3UB2A 1Y8CA 3P2KA 2JI8A 4HDKA 3VV3A 1RBZA 2RC6A 2P4EA 1K0UA 3SBEA 2FOLA 2GMWA 5FBWB 1UJMA 3LT2A 1MORA 2W4MA 3AIMA 3QWBA 4GLOA 1Z56C 4RMGA 5C5IA 4V1CB 2PRZA 5KTSA 3GVCA 4WEOA 3H05A 3UUEA 1W7AA 1AHIA 1TUIA 2ATVA 3LIIA 3ONDA 1YQQA 4F4JA 2BM9A 3HZRA 5A5VA 3ER8A 3NBZC 1W76A 4OI1A 3DOIA 4X7MA 3SM3A 3HXMA 1E63A 4QBFA 1T0HB 4PCVA 3RVOA 3JASA 5GV7A 1NV8A 2WRZA 3RYFB 4DV1B 1DUVG 4ZT3A 3OBBA 2X0EA 5JDCA 2QZZA 3ZWQA 4EJSB 3ZJUA 3R0IA 4ESOA 4NS4A 2WZBA 3GRYA 4PBSA 5G1OA 5KNBD 4IDBA 4KAXA 2I7TA 1JFLA 1SVNA 2HBRA 3JZAA 2XQVA 3PICA 2QAGC 1Z16A 3CKYA 2YIJA 3S70A 4CLDA 3U4QB 1DC3A 2CBZA 2GETA 2IYQA 3DCYA 5FB3A 5CURA 1JPNA 1XLUA 2W4IA 4ME6A 5FNVA 1SD5A 3F2VA 3KKQA 5BV0A 4P4SB 5C46F 1X1QA 1D04A 5CPBA 1IPHA 1P8JA 1EE1A 1BE0A 3X2EA 3KO8A 1IPFA 3QNUA 1IXSB 2ARKA 5JNVA 2ZE5A 4C1NA 3H6GA 4XOUA 4YWJA 4G01B 1B0UA 4KNVA 1YR9A 4MUBA 3T1VA 3WNQA 1UEJA 3L0YA 4TLEA 5AI0A 4HR7A 2Q2WA 5JALA 2FEMA 4PRYA 4R51A 3VC1A 4YO8A 4H7KA 3NRJA 4IL5A 1Z18A 4WK2B 2Y0CA 3D64A 3NWOA 2XAAA 3G0CA 4PU0A 2WTAA 4H16A 2VBFA 1T91A 1AQNA 3BT7A 3HA2A 4PZDA 2QZ9A 4QQNA 1L5FA 4KIWA 1U7PA 2QUHA 3LBYA 4QVKA 1DTDB 4BTVA 1ENPA 4DW8A 3LVQE 9LDTA 4E5VA 2PSSA 5E3IA 3WLLA 2ORIA 4XVUA 3MAGA 2GZ2A 5FPQA 3KUDA 1ZOLA 1NPYA 4KV9A 4E22A 2ZRBA 4F9GA 5G1PA 3GVIA 4J9VA 5DHQA 2I4LA 5CLGA 2YVAA 3OA2A 3FG9A 2FPLA 2GSDA 4QBIA 2Z08A 1G1MA 3HNRA 4IW3B 3SQXA 4R3UC 3K1AB 3ESCA 1S3IA 5EP1A 1UBOS 1PJQA 4QTXA 2JFQA 1L5SA 2G82A 4TL9A 2F43A 3U17A 5BVGB 1V0JA 1NUQA 2OXEA 4R1SA 2H9IA 3MTEA 3VRHA 1ZLYA 3CVUA 2R751 2IE8A 2DY1A 2H9YA 2DQZA 1M1NB 3B6EA 3P9IA 4KXNA 2G25A 1MMFB 4DCSA 2FDCA 3M81A 4F4DA 4PZZA 1JXQA 4ROTA 4II2A 1U3CA 3P5SA 3T1HB 2ZRJA 2C9CA 2REBA 3W8FA 1P33A 3PGMA 4TYPA 5LQRA 1JYFA 3T0GA 1H2XA 3AI3A 4GW3A 2NXEA 2HV8A 3GLFB 1NRXA 1SBQA 2ZJ1A 3PNSA 4ZVOA 4BS9A 4JL8A 3RSFA 3C7AA 1HFEL 4TXLA 4Z4FA 3WZMA 1FDVA 4WKPA 1DBVO 2H63A 1B43A 4GUAA 5K0FA 3KKPA 1LEHA 1ETUA 2JD1A 3OLWA 5FJIA 4OEHA 1ORHA 2J8ZA 1N8NA 1V8OA 4XYGA 4YFVA 2EDAA 4V3CA 2GAOA 2WWWA 2RGCA 1QH8B 2WKQA 3AXTA 2OBMA 4KGZA 1W5FA 1O0BA 4BLRA 1HDIA 1PNOA 2PRKA 1V7QA 2BN4A 1EFCA 2XQGA 3OPXA 2KI5A 2Y9MB 4G0MA 5FL3A 2QAGA 2VH2A 3VHXB 2AMJA 2C5HA 1N8KA 5LQAA 3K9FC 3L4KA 4W9NC 3U3ZA 4KITB 1U7OA 1IB0A 3WFZA 5D2CA 3QXSA 3V3KA 3QFSA 4CM8A 4UU0A 3R8CA 1UOEA 1U1GA 2AFRA 4JC4A 1BSVA 1WXHA 4BVHA 4YT4A 3BXPA 3UG7A 3CVWA 3QELB 4KR6A 2X0RA 3CX6A 1Q7BA 1UBFA 3LTEA 4PGFA 3DE3X 3KYBA 4OQPA 4MGZR 2O2IA 2W2LA 3DHNA 2GCEA 1OYYA 3ZS8A 1X7WA 4QRHA 2W43A 2ZTLA 1NQTA 2HIGA 4H1HA 4Z9AA 3E3MA 1A5ZA 1PF7E 2O1SA 1OC4A 3PZRA 2JHGA 1YVRA 2JI4A 4NQRA 2EKQA 2J0UA 2CXXA 1RZUA 1U6JA 3ADKA 3S1AA 2WAAA 1UFQA 2WTNA 4XWKA 3VU0A 2PGIA 1JWBB 4UDOA 1DFGA 2OD7A 1IWPB 1JSRA 1I1HA 2ZVPX 4QXRA 4WQMA 3ZH9B 1GD1O 4JJAA 3W6PA 3X1JA 5C8DA 1IXYA 2J9FA 1QWSA 2CNWA 2VSNA 1DX6A 3O8DA 3OEED 1QH1B 4TTAA 5TPWA 4HB3A 2PBLA 4JFAA 6GPBA 1O97C 4FXOA 1RVV1 3O94A 1V8PA 2I2WA 1FY2A 1UBNA 4HDKB 5JOQA 2XT6A 5J4VA 4DLVA 2PUTA 5LUBA 3FLAA 1I24A 2ZRDA 5BN1A 3MWFA 6AT1A 3OECA 1UM9A 2UXDB 2OBLA 3R3ZA 4JX9A 5HF6A 4C5AA 3VHRA 3RREA 2W8ZA 3LWBA 1WETA 3AVXA 1VL0A 2XTZA 2YH2A 2CXRA 3CX3A 1TK9A 5AJTA 1W6RA 2CHVA 1IXKA 3WL7A 5JAPA 3ITEA 4YP6A 3IF8B 3NHLA 3MQ4A 2QP4A 4AY5A 1UJ5A 1SCAA 2B4TO 1EG7A 4L8LA 4M46A 3AM3A 3TX6A 2WB4A 3CSDA 3F4LA 4NYMR 3IA2A 2HO5A 3TSYA 2WIKA 3RIXA 4NULA 1KYYA 1HLPA 1D1TA 1TA0A 2FR0A 1A7KA 4L6AA 4UHCA 2ZAGA 5ERGB 3RUHA 4FGSA 2G77B 2XOKA 5LM3A 4EGJA 1EUDB 1E9BA 2CSUA 4HSEA 2AI3A 2FMXA 3OG9A 2I7CA 4Y2SA 1JS1X 1UXKA 3RHFA 3WWOA 4CF6A 4E3ZA 1UDCA 1A8QA 1VKNA 2B4QA 2O8BB 1FP6A 2QM0A 3KJFA 1DRJA 2UDPA 4LECA 5SY4A 1IJFA 4MQUA 4GC5A 3QUQA 3MCTA 1G5IA 3BULA 4JA0A 4U7FA 5E7QA 1G6OA 3MT9A 3BWVA 1SRQA 4R8MA 1OUMA 2O7QA 1QQBA 2SCUA 1G21A 2IOFK 1P4AA 1I9CA 2I4TA 4L8GA 4URFA 3IAS1 5GZ6A 4W9NA 5B58T 1AF7A 1JHRA 4G4SP 3VH1A 3ZEIA 1EI9A 1YGYA 3OCJA 5T8KC 2XA9A 4MQ5A 4HDNA 3GLTA 1K7FB 1TO2E 1L6RA 2IXAA 4ID9A 4S24A 2XUJA 1PT9A 1LZLA 4ND2A 4XVHA 4ZYWA 4RGVA 1RI4A 2C31A 2K87A 4FFMA 2C9ZA 2Q4RA 2B34A 3CPHA 3WGMA 1MFZA 1LC3A 3GUVA 1M6EX 5K03A 4IHJB 1ESZA 1YK1A 4HDCA 3PXBA 2O3RA 3I0ZA 1ZUHA 3D0RA 3RSGA 3CSSA 2XXAA 1LBTA 1XX6A 4J07A 1CUZA 1L9XA 3D54D 3HCRA 3U1BA 1LBSA 4LZOA 3ECAA 1IZYA 1KSJA 3ETHA 1UDAA 3IPAA 1BX1A 3O5AA 3ZUGA 2NU7A 1O5IA 4RPCA 3WKCA 1CUUA 3GJ0A 1JIKA 4W5WA 4FZ3A 1FXSA 2F43B 1J5XA 2PGDA 3CSUA 3FNFA 3PXUA 4TLDA 1Z6YA 2DPYA 4IYRA 1J5EB 1J8DA 1QPBA 1FSPA 3KVOA 2PKRA 5TGDA 1N77A 3ZDDA 1XXHB 3CIOA 5EZYB 4HQ0A 2WJ3A 5E9QA 5C5DA 1O0SA 4BNHA 2OVFA 1UMDB 3P9RA 3IKJA 1OWOA 4Q05A 1GZUA 4PYQA 4LHWA 3WWEA 2EWMA 4QJ3A 2XMDA 1V3QE 2NQ8A 3ZXXA 2BGNA 1GTJ1 1W49A 1XJ0A 3GN2A 3KQTA 1SOVA 3MAAC 4ONEA 5IDQA 4KQIA 3U4DA 5KTTA 1THZA 1C7ZA 4I81A 3PC4A 2DHEA 2CNNA 3ZK7A 4OKSA 5FPKA 5JSUA 5K7SA 1QGUA 3PC7A 3RSZA 3IQWA 5AJVB 2WFLA 3E3LA 1O95D 2GJSA 4O2LA 4OQFA 1HT2E 5CLLA 2FE1A 2MSEB 3BWXA 4OIMA 5IJXA 4D4IA 3IBGA 3ZGOA 5M29A 2CFRA 2XE6A 2QQ5A 5DN6D 3VU9B 2Q4OA 1PR3A 2GZHA 4J1TC 1DEOA 2YXDA 2ZJOA 3HK2A 2FLVA 2GDZA 1OQAA 5J2UB 3IA7A 4QPDA 1WUYA 3DB2A 4RVGA 2TMKA 4OHBA 1YACA 5J3JA 4EA6A 2P5UA 1XYYA 4CM8B 2OOKA 3Q2KA 5CXQA 1XD2A 5EY5B 2A0FA 2W8BB 4NNJA 5EWMA 1W19A 3GUYA 4XEUA 2Q6IA 1XVAA 2V0NA 4JASB 4TKVA 4DKXA 1VIAA 3I01A 1C29B 1JJVA 5MN4A 1P6QA 4ALMA 1S2GA 2G71A 2Y1GA 4CMJA 1UMCA 1UPTA 4HATA 3GQBA 4CM4A 2I66A 2OGZA 1P39A 3A6EA 4EUKA 1J1ZA 3H1FA 4X0EA 1CUWA 4JJ7A 1PLJA 2PA3A 1N2BA 4H1TA 4IGEA 2EG5A 1DO0A 3ZC3A 2K2WA 3FGNA 1RMQA 3KHUA 1U5BB 3RBZA 3SQWA 9MHTA 2C1EA 5T8KA 4EF6A 1PJRA 1LK0A 4MR7B 3B52X 1THMA 2NGRA 1ZMXA 3NWEA 2XVZA 5ICGA 4WJZA 1Z36A 4FS8A 3VR5A 5C80A 4S3MA 2PH3A 3UA4A 4G1EB 1KZGB 1PZMA 1IJKA 1G66A 1HF3A 2I55A 2P40A 2E89A 3M70A 3AGPA 4MYRA 3KP1A 3IURA 4EDHA 1ISFA 4X90A 3UJ8A 4NV0A 1CEEA 3B2NA 1YUNA 2O0MA 1FDRA 4B3CA 4CL8A 4TV9A 2WYUA 4N0PA 1F51E 1T36A 4UTVA 2C7VA 3VKHA 1YZGA 1TF7A 2BI8A 1U94A 4HRAA 4HWKA 3T5BA 1ECCA 4WK0B 4CG1A 1VPTA 1IHYA 9LDBA 3KE9A 2WU8A 1UAYA 4DT1B 1FP1D 3E81A 4X1OA 5EWLA 4B5KA 1B6SA 2VJAA 1XZ8A 3DTVD 4Y67A 2X15A 1GTRA 1RYFA 4Q18A 1UEIA 4HCJA 4C88A 4G0WA 1A5TA 1PV2A 1MDFA 3X0DA 4EKNB 3C3PA 3V1NA 4CLEA 4DQUA 2NU6A 4D4LA 4W1PA 5H70A 4XGKA 4YJ3A 3C8HA 4CKEA 4JYMA 3GXBA 3C5VA 2R11A 3R0QA 1HETA 4RZXA 1EWQA 1X15A 1PUXA 2N0SA 2BTOA 4GSLA 3OZVA 3OFJA 4D26A 2XB2A 4OHZA 3NHPA 2BHRA 2D1YA 3VR2D 2ZRPA 3KQLA 3VYTB 2BRUA 2PUGA 3C8MA 1T10A 2GHIA 3MJSA 2I6FA 4RKEA 4N82A 5EQFA 1XA4A 4HNGA 5TS3A 1Y5LA 2P5TB 4LDQA 4KHZA 3VM6A 1H3EA 5C4MA 3ZOKA 1YMUA 1XNRB 4O25A 1MG0A 1PO7A 2O7VA 4PFQA 4KSYA 3V4OA 2XMQA 2I76A 4XGIA 3RFCA 4J1TA 3WGHA 2JLWA 3WRYC 1Z2AA 4QX6A 2VP4A 5BUZA 3L82B 1KSFX 3V4VB 1PGNA 3Q5GA 3UMVA 1AU9A 2W2QA 1J56A 2WSLA 2X1HA 5J2UA 3ZDAA 1WQ1R 3MC1A 4TYYA 2NTNA 4TTIA 1R5OA 1PG0A 1KQNA 2WP8J 3NQ41 3Q2OA 4MV4A 4G6ZA 3VDMA 3ZWKA 3NX4A 3P2MA 4KIJA 1AXRA 1ZN8A 1BRTA 1UPFA 2QHXA 3OM0A 4XM0A 1W2WB 5HX7A 1RI3A 1V4NA 2YVQA 1QF9A 4XDZA 3KQNA 2AN4A 1KI6A 1UC4B 3GAMA 1W6UA 1TQDA 1UP7A 2QRKA 3TRKA 4FJ1A 2WSSD 3CJTA 5KVAA 4QOJA 3A4MA 4UZFA 1QAQA 2PKCA 3HBMA 4PQFA 3LA6A 4O1IA 1LNQA 1X7XB 3IDQA 3G2IA 1SOWA 2H3HA 3C70A 1O94D 1G3MA 2NO5A 1C8VB 1CUEA 1SPBS 5AO9A 4AIIA 3IFSA 4JC8A 1EBFA 1N5RA 1T9ZA 2AXQA 4UNSA 2OESA 1CF4A 4LJKA 3JSAA 1JBKA 2I4RA 2J9XB 3ASZA 3MJCA 3OF3A 4WW0A 5GM1A 3GAAA 3WB2A 3ET4A 3O8RA 5CA0F 1WVMA 2A30A 2PZLA 1XWIA 3LYUA 3L6DA 1GVNB 3I1FA 2ON6A 5LZ9A 3GP8A 4MEAA 3CZAA 5AD1A 4MK4A 2QY6A 1ZJZA 2Z2XA 1T9GR 3TPCA 2ACEA 3F74A 2NQ2C 1N6RA 5FWXB 4H7PA 2RE8A 2EGGA 5K0LA 5CEFA 4CR8A 2A0YA 1NVMB 4K9LA 2UVQA 2IYYA 1X6VA 3WRVA 1R0KA 2C3MA 1P1BA 4QHYA 3EVBA 3LO8A 4YDHB 1ONPA 4KXVA 4A5SA 1Z68A 5HKKA 1X7GA 1JV2B 1E7WA 1QGUB 3GMIA 2ZJYA 4KYIB 1MR3F 2E5FA 4ALLA 3MQ2A 2G1JA 2NNWB 4MQBA 1Y1KE 4N6NA 4JCOA 4DPMA 4KYUA 2BKAA 4NP6A 1BEEA 3QYAA 1P6UA 1XV5A 3N87A 4YRPA 3EC7A 4OHFA 2NP6A 1X7YB 2XSZD 2WT4A 2F3UA 1IRIA 5CDTA 1CQWA 4NAHA 2PRSA 1KYIA 3OLCX 1N2ZA 1IVYA 3FY4A 5EA2A 1DDGA 5C31A 3TDNA 2UU9B 1Y6FA 4E15A 2XA2A 1CFJA 1PRYA 1R00A 2HY7A 4LY0A 1DV1A 3A6KA 3IE2A 3DT8A 3OLVA 2GEUA 1OHHD 5DCWA 1KMCA 1JB9A 3VO1A 1XL1A 1ZNWA 2FU5C 1PTJC 2CK3D 4GGOA 2NZYA 3N0XA 4Y6OA 4Z0HO 5F9FA 3I12A 2OGUA 4XUDA 4EG6A 5LZ2A 1HOTA 3UGTA 3WRYA 3K5IA 5C18A 4I8DA 3G0GA 1I1OA 1I1NA 3OPQA 2W6QA 3IP9A 3OLXA 4LSGA 4TVOA 3RTGA 3KXLA 1IQPA 4LS3A 4EK9A 1OZFA 4Y2PA 4R31A 4R69A 3ZK8A 1GGEA 1JFSA 4K6HA 2NZVG 1UC5B 1QGZA 4N03A 3ST7A 1V5IA 1CRQA 4AJEA 3IOEA 4LCBA 2AMFA 3CBGA 4IIYA 4ITVA 1IFXA 5ALHA 2A4MA 3GW8A 1E2JA 3VH4A 1VL5A 3B8EA 3M0EA 3CHYA 4L8WB 1EWKA 1YE5A 3N0WA 5JMPA 3GP5A 4KQJA 2O7SA 2UV8A 5UKDA 4YIKA 4D6PA 3DLHA 3JAKA 3W3AD 3GFGA 4NSNA 4UUMA 2RONA 4TV9B 4RMHA 1E2BA 3KDSE 5B7NA 1EESA 2TMYA 3I4FA 3MOGA 3T7TA 4D9FA 2PUBA 4RC9A 3DUFA 2ZW9A 3W5SA 3S7ZA 3VSCA 4BNDB 3LG2A 1G5RA 5CVUA 3V1UA 2ECFA 3VDRA 3VZCA 1TVEA 5JCOC 2IY7A 3DBOB 1FBTA 5EIFA 3FCXA 4X20B 3ZNNA 4C9BA 3L1JA 2QLLA 3MPUA 1T4CA 1HT3A 3WK6A 2BFFA 2JAQA 1ML3A 2D1RA 5A71A 2DQYA 4JLOA 3IH5A 4CT0A 3MWLA 4YJ3B 4Q4CA 4DR3B 4CKEB 1X7DA 4A1OA 3F9IA 3EGXA 2ZYAA 1GTZA 3E23A 3ORSA 3GMDA 1JJAA 2BOVA 1U5CA 2ZREA 2O57A 3O93A 5AI9A 1XTUA 2X5XA 1Q1ZA 3WK7A 5HBRA 1DOAA 4B3JA 1HE5A 3TNFA 5F9HA 3EOBI 1KA9H 2G6BA 2QUIA 1V5WA 1DDOA 1N5MA 2XUAA 1WCIA 3AF0A 3DDHA 3FBGA 3I2HA 4HP8A 4JLUA 4NHEA 3RJMA 1FC0A 3KKMA 3IT0A 3T3MB 3TNLA 1YS7A 3WO1A 3WYDA 1FNNA 1IE3A 2ID4A 2XF8A 4GSKA 3PXDA 4QOEA 3SR3A 5C3MA 3PD7A 4AZTA 1ZH4A 3QPCA 3FYDA 4AS3A 4PVCA 2I03A 1UJNA 3F98A 3G9TA 3UHPA 3V6LA 4A8HA 2P8SA 5JZOA 4HWSA 1V11B 2RI1A 1HDRA 3BWDD 4J43A 1QONA 1YA8A 1NLMA 2YW9A 1FFCA 3MHPA 2XVXA 2FCAA 2FUEA 1JHXA 3DDCA 1XF1A 2GJKA 3CXRA 3JQFC 3CUSA 3WWYA 1Z6TA 1VKHA 2NXCA 1S02A 3AY0A 4E2FA 3BX1A 2CDAA 2P1ZA 1JQAA 1E1DA 4JQOA 1IBRA 4P22A 4D8TA 1EFAA 4F9EA 3FYSA 3PVZA 2CEKA 4KDCA 3UMFA 1PTJA 4CNQA 4KP7A 4RF2A 3VZBA 3EZLA 4D9BA 4EHIA 1WDWB 3INRA 3ABRB 1DJNA 3ANMA 2CLEB 3PB3A 1RVDA 3KKLA 3AR7A 3ZS9A 4DDTA 2O5CA 1Y9JA 4G8DA 3WK8A 1C7RA 1YCDA 2WP0A 5J4KA 5C53B 1KDOA 3MN1A 1IWBB 5DTRA 5HDBB 2O8EB 4DCPA 2R8OA 3EGDA 3U9LA 4ZQHA 4QT4A 1IUOA 2ZVJA 4LGMA 1GNQA 2CLHB 1HOXA 1E1RD 5E1BA 3HTXA 2FHSA 3QKIA 4GZMA 1MAWA 4NZ9A 1DQSA 2ODBA 4GKJB 3WGOA 1BROA 1EXWA 2VEDA 3EXEA 3ILSA 1PP4A 3JWPA 3LRXA 4MH0R 1GSIA 4GZ3A 3VAZA 3LOQA 1ZGCA 2OWDA 2WG1A 3MUEA 2Q8NA 5HIMA 3SZMA 3AZQA 3NIBA 4DLPA 1RRFA 1KMNA 1CUSA 4NXMB 1T5IA 4P31A 2HK9A 5B1DA 1ZI6A 5DXAA 1GFIA 3F6CA 4D8YA 3M9XA 4HQRA 4F06A 1GPLA 4YY3B 1I3CA 3VOTA 4AECA 5ESWA 3O4RA 3GRVA 4BN0A 4JKYA 1YRHA 3NC1C 2VPWA 3F6SA 3KB1A 3U1VA 4G84A 1H23A 2J3KA 4TTJA 1R7RA 1G9XA 2P3LA 3ZGZA 1FSSA 2YN4A 1L4EA 4Q9IA 3PHLA 1I7SB 5JCOA 2RAFA 4C07A 3MA0A 3TKAA 5C2JB 1RI1A 1GARA 2IV7A 4ZI7F 3RAFC 1FFYA 2NTJA 3PXEA 4JYBA 1CUGA 1Z5UA 2IPLA 4EIWA 4A8JB 4U2FA 1P1FA 4YQZA 2I9PA 3I34X 3KVYA 3GVHA 4XR9A 3BRWD 5B6JA 3NPAA 3E8MA 4MWZA 2WG2A 1IEQA 3OSUA 2PXCA 3OH8A 2OQVA 4BBPA 2N47A 2WOOA 3IT2A 1U28C 1KJQA 3O3CA 4DSUA 1WY5A 2WKPA 2EIHA 3FPHA 4CL2A 4C4OA 1SZPA 4IJVA 2VNIA 4I46A 4D46A 4L85A 4H31A 4OQYA 5BSVA 1C0KA 4QASA 3JQBC 3BH7A 4O4LF 3GYBA 2IEZA 3KPWA 4NAUA 4KAJA 5G0UA 5KVCA 2G1UA 1XCBA 1XQ9A 2DF8A 1YNSA 3I8XA 1HLDA 4TTTS 1TK3A 1XZFA 4UM5A 4YCLA 4ZT6A 1U1FA 2IPOA 4EW6A 4R2WA 4ZQBA 4DNPA 2ZI4A 3TRHA 1H5NA 2JFOA 1NOJA 1Q0QA 2I33A 3JQFA 4B48A 5CT8A 3JVVA 1EEHA 4PHTA 4XSHA 5IASA 4FMCF 2GYUA 4YXFA 1W36C 3BUSA 3MS4A 3CN7A 1ICIA 2AI2A 4URXR 2D1TA 4UDNA 2KM1A 3H5TA 4G1VA 2VCYA 4ZK2A 3QVKA 1H4TA 4W7HA 1WABA 3I8SA 3JAKB 3PUJA 1ANKA 3FDXA 1C7IA 2WUFA 4TYMA 1M8PA 1QIDA 5DRYA 5GINE 3G0IA 3WLSA 1FDOA 1J42A 1MGPA 1NXPA 1X8LA 3TD9A 4YRMA 2OZLA 1I36A 3PRJA 5KCMA 5MF6A 1YSCA 1PT8A 1ZQ1A 3T4PA 3RSSA 3UCFA 3ZHUA 2VJOA 5K9ZA 3KKKA 1A2OA 3QVSA 4F84A 2ZM5A 1GADO 1V95A 1MD9A 5KNCA 2JGJA 4Y1RA 1QQ5A 4JELA 4O2BB 4IDDA 4HLDA 5DULA 1QDEA 3ZDFA 3W5CA 2G9NA 2BFFB 2QSYA 1WXFA 3P27A 4YRBA 3TKYA 2GTHA 4R1MA 4A82A 1UBCA 1HWYA 1BQEA 1KARA 3KHTA 3L7NA 1TU4A 3EGXB 4R5MA 4YC7A 1LNSA 5CW2A 4DRYA 1IN4A 1ZMBA 5DLEA 2RH4A 1DRKA 1VJGA 2QXTA 1ILWA 2YZ7A 3F9RA 4IIXA 4QELA 2I3DA 4XYBA 5BURA 1G98A 3OZGA 3I4LA 4BL5A 4PRKA 1QHYA 3K8QA 3NOVA 4I4LA 4FYKA 3MT7A 4HXFB 1W52X 3WGGA 1WCIB 2HF9A 4NBUA 4BV3A 4C7BA 3CH6A 1RDFA 2Q2NA 1Y89A 3MLEA 4LPKA 3SX0A 5ES4B 1VQ1A 1KXJA 2Y77A 1XTKA 3JQGA 4LQDA 2J48A 1EA7A 1M2HA 3ENQA 2BKVA 3FHOA 3H65A 3I6IA 4OX9Y 5JXWA 1YZYA 4JP1A 5DISB 5KYYB 1GN9A 4E2ZA 1PHPA 5IXSA 2WT8A 3PTLA 3QI2A 4HAZA 2OKCA 3I8OA 1FYVA 1KDZA 1I94B 2Y2VA 2HYIC 2GPSA 4G5XA 2XHZA 3MFYA 2QT1A 3DVSX 1CRPA 3QIAA 4KQXA 1GZ5A 1U28A 4O02B 4PQGA 4FQ5A 5FTMA 5IVIA 5B7QA 1G4UR 3OOHA 1K6JA 2DBRA 4MR8B 4BKQA 4OG2A 4Q48A 4N7RA 3WWCA 2O2YA 3JQBA 3ZQ6A 3BAZA 3REOA 1ODKA 3AB8A 5HCIA 2A9QA 1XRNA 1H69A 2O0LA 5E6RB 3QWHA 4RTQA 1ZU4A 2HEIA 3B6ZA 3NORA 3C6ZA 1CHNA 1E94E 1MOPA 1ORDA 2AN1A 2VZ0A 3ZLTA 2NN3C 4EO7A 4XYEA 2ZB4A 3CKLA 4Q6WA 3QJ5A 6LDHA 3LCMA 4KPEC 3FHLA 3ZWVA 1GQQA 3EZ6A 3K0FA 4MYCA 221PA 1E60A 1L5NA 4EVIA 4RACA 1W88A 2C98A 4ITUA 5K8CA 3VISA 3H9GA 2GNPA 2BONA 4TSFD 1OTHA 2CD9A 4IOJA 2BEKA 2FWMX 5DGHA 3UHJA 3NHUA 1GKLA 4NBNA 4TZ6A 4RGBA 4YRRA 4CIWA 3NU1A 2LKDA 3UCXA 1SUPA 2JI6A 3A1EA 3BCRA 3B36A 2R1VB 1CWUA 3WNDA 4YO7A 2FEPA 2AC7A 1NKVA 2QVZX 2RJ3A 2GASA 2I2CA 3EBOA 4CG2A 4C7XA 3I5YA 1FU7A 3IQXA 4BGVA 4KUHA 2P2DA 1W35A 4XJXA 4K40A 2VC2B 3W6ZA 2H17A 2NU9A 5BSTA 4S35A 3FYUB 1HI9A 2PYZA 4TS1A 4NNPA 4U2CA 2JLUA 3N8GA 2O3QA 2WICA 1M0SA 3AKYA 3E27A 4DCJA 4B6RA 2BFBB 4UREA 4RXUA 2NUPA 1JA1A 3WLMA 4AF8A 2I2AA 5DX0A 1TQ2A 1TCCA 4B7XA 1FFBA 3ZQUA 2E55A 4Q1VA 4UEOA 4Q16A 4UNPA 2G63A 1UKEA 2WU3A 2BGTA 2RHJA 4DDMA 2BMAA 2NXJA 1P6XA 3F8TA 2ZDQA 4HAWA 2JK1A 5JHGB 2AFIA 3SDZA 1CZKA 2K7FA 1QF7A 3QTBA 4NF2A 4TKUB 1HTTA 4G4SO 4URHA 4B2YA 2I62A 2ROQA 1DG9A 5ICEA 2GJAA 2B1GA 5KHLB 1Q0RA 4IDCA 4XM1A 5LDGA 3SHWA 1N9GA 1NN3A 2WABA 3TB6A 1ZNZA 3VGJA 1ESEA 3KSUA 1YZVA 3PI7A 2R8RA 2YJNA 1VB5A 1I3LA 5H3CA 2NUAB 1BWPA 2DGDA 1ZY2A 2FB9A 3HCCA 4HNTA 4QYWA 5HS4A 5HJ2A 5ISMA 2BFNA 1BMTA 1VLLA 5FORA 1T1SA 4BNKA 2X0KA 3JARA 2QM8A 4WK6A 4NG5A 5TJ9A 3HC7A 1QHXA 3PQ4A 1B6TA 4PINA 4RMIA 3AL3A 3Q6IA 4RDXA 1R4MB 1KP9A 5F1YA 1A9RA 2J3MA 2PK3A 4DHEA 2V3WA 1RI5A 5DBIA 2EP8A 3D3KA 1Y1RA 1VKRA 1KQ3A 3C3YA 4WNYA 2D8MA 2GM5A 5LQSA 1EDBA 2OL4A 1U7HA 2JJ2D 1XLTC 4IZHA 1U0TA 2I80A 4JDPA 1XQWA 1B7GO 3ZXYA 2GLUA 1IIRA 1PW7A 4J0IA 2H2AA 3SFTA 2LP4Y 3HCEA 5FBKA 5JD6A 1RQXA 3PFNA 1UJCA 1VIMA 1Z6XA 4NBTA 5EQDA 1M54A 1ZG3A 3ZDYB 5LP6B 2J0SA 3E82A 4IHQA 4XQCA 5DRTA 3OWOA 4RD0A 1ZCBA 1QJCA 3DMHA 3V8VA 3H0EA 4M38A 4F9FA 3G8BA 3NGMA 4FMDB 4UHDA 3BC1A 3ZQKA 5EJ8A 4M8SA 3SNKA 2E0IA 1E7RA 1FTNA 1KP2A 2FWPA 3FSGA 4UM8B 1YZ3A 5J1TB 5K6AA 4ZAVA 3MTJA 2I7VA 4JMPA 1V48A 3U1TA 3LC1O 3HZZA 4R5HA 3CX4A 4Q4AB 3ABIA 5BQOA 1PT5A 4BNFA 1FFEA 2YW2A 1ZEJA 5B1SA 1D2CA 1YJAA 2X0DA 2BFOA 3AW9A 2R2AA 3GJYA 3OEYA 4L22A 5E4FA 3COVA 3L43A 3LW8A 5AW4A 4KV7A 1LNZA 4CR6A 4Q3EA 4YJ2B 2AZDA 4BWYA 4KWIA 1EDEA 3CY6A 3FFTA 2YQZA 3SKVA 4B7UA 3ELDA