3G2OA

Crystal structure of the glycopeptide n-methyltransferase mtfa complexed with (s)-adenosyl-l-methionine (sam)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
267
structure length
244
Chain Sequence
GPVRTPHADVLLASVGERGVLCDFYDEGADGTSEAREFATRTVSGPVLELAAGMGRLTFPFLDLGWEVTALELSTSVLAAFRKRLAEAPADVRDRCTLVQGDMSAFALDKRFGTVVISSGSINELDEADRRGLYASVREHLEPGGKFLLSLAMSEAAESEPLERKQVLHVRHLPAEEIQEITIHPADETTDPFVVCTHRRRLLAPDQVVRELVRSGFDVIAQTPFASGGAGRKDMVLVEAVMPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Transferase
molecule keywords PCZA361.24
total genus 70
structure length 244
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1040.60 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3g2oA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3g2oA02
3O4FA 1KR5A 2C7OA 4R8RA 2UZ4A 2UYOA 3CJQA 3BWMA 2R3SA 3B89A 3HEMA 2ONYA 4BLWA 2ZIFA 5DM2A 1NV8A 5DM1A 4ER5A 4AUKA 2EJUA 2FK8A 4FSDA 4FGZA 2IH4A 4MIKA 3BKXA 1QZZA 4DKJA 4GOLD 1VL5A 3ELYA 2JHPA 3LBFA 4EVIA 1JR4A 1KXZA 4C04A 5DTMA 4JXJA 5DT2A 5EC8A 4RTSA 2VZ9A 4GC5A 3EMDA 4WVLA 3FRHA 3DMHA 2NP7A 1B42A 1XDUA 4PYOA 3G5TA 3FUWA 3GWZA 3M6WA 2AN4A 1D2CA 5EEHA 3BWYA 4DQ0A 2ADMA 2QYOA 4C06A 2BZGA 2DPMA 1PJZA 2NYUA 5CD1A 5EHIA 3LPMA 3BKWA 3G8AA 3LX6A 2K4MA 2XYVA 1YF3A 2GB4A 3A4TA 5KVAA 1YFJA 3GCZA 3KR9A 4F85A 5EMMA 2CWWA 2H11A 3KQWA 1WS6A 4A6EA 3VYWA 1AF7A 5LQJA 4E70A 3LHDA 4C05A 5HILA 4YUVA 3DLCA 2IGTA 2IDKA 5EIFA 2IP2A 3NDIA 3CBGA 4DMGA 1R18A 2R6ZA 3KQVA 2EFJA 1JG1A 1RJGA 4CTKA 5DM0A 1FP1D 4F86A 3DXXA 3GRUA 3LKDA 4YUZA 5FULA 1R00A 3KQPA 1JG2A 2PY6A 3P2KA 2P7HA 1UIRA 3WSTA 4V0RA 2IBSA 1XDSA 3GXOA 3UJ6A 5EG5A 1F3LA 1VLMA 1JSZA 1VPTA 4QQKA 5CVDA 4RTNA 3BT7A 4GOOD 4MTLA 1R8YA 3UJ7A 1IXKA 2PLWA 3EGVA 1QYRA 1QAMA 2BM9A 3K6RA 3TPZA 2P3LA 3FUVA 1ORHA 3HVHA 4RV9A 3UA4A 1BKYA 4AX8A 3H2BA 1L9KA 2B78A 2ZFUA 3LL7A 3A27A 1BC5A 3SMQA 3DTNA 3CKKA 4OA8A 5DRYA 5CVJA 2PV0A 1YZHA 3B3FA 4IWNA 3HCBA 3LBYA 4V0QA 3M6VA 3MCTA 4X60A 5DXJA 9MHTA 2QE6A 3QV2A 3GO4A 5E9WA 3OU7A 3RODA 3G8BA 7MHTA 4RTKA 1HNNA 4HTFA 2AS0A 3B5IA 3EEYA 3TKYA 3JWJA 4KDCA 1HMYA 3CCFA 3FUTA 5DXAA 1IY9A 1FJXA 2ZWVA 2H00A 4F84A 5JUWA 3LDGA 5T67A 8MHTA 5EMJA 5T64A 2AN3A 5FTWA 5HEKA 3KQSA 5EOVA 1INLA 1XVAA 2VP3A 3JWHA 3KPVA 4QDKA 3G7UA 4BY9E 5DX0A 1X1AA 1G8SA 4OQDA 3UZUA 5EKXA 1T43A 2AN5A 3NTVA 2AOUA 4E33A 2NXJA 2IPXA 3HCCA 4FSXA 2KW5A 5K0NA 2GS9A 3PX2A 3PTAA 4C07A 1SG9A 2FCAA 3BGIA 3KR1A 3PX3A 1JQ3A 2PBFA 1I4WA 3U81A 3C3YA 5E1DA 3P2EA 2V74B 3KQYA 2P41A 2QY6A 3JWGA 3UFBA 1NV9A 1RJDA 2QRVA 2ZSUA 3C3PA 4FZVA 5HFJA 4ER7A 2C7PA 3L8DA 1NBIA 2PX5A 1N7IA 2CMGA 2PKWA 2ZIGA 3E23A 5KS2A 2BM8A 3NVKI 1R8XA 2FYTA 3G2OA 4OBWA 4QPNA 4XCXA 5D1HA 3EPPA 2NXEA 4ZTBA 2ZIEA 4P7FA 4PNEA 3G88A 4RWZA 2Z6AA 1NW7A 2VS1A 2FHPA 4PYMA 5HIJA 1XXLA 1ORIA 2OKCA 5EZQA 5C1IA 2AR0A 1G55A 2CL5A 2PX2A 4RYLA 3V97A 2YR0A 4R05A 2AOXA 1EIZA 2IFTA 3GRYA 5GIOE 3R0QA 3UBTA 5E9QA 3P97A 4HGZA 4R6WA 2PXAA 4KVZA 5DPMA 4C03A 5KQSA 3FUUA 4GBED 2AOWA 4RSRA 1H1DA 2AOTB 3HVKA 1VE3A 3OCJA 3VC2A 1N7JA 2ONZA 3FYDA 3PFGA 3T7RA 3G2MA 4Z2YA 1AQJA 2EJTA 2OXTA 1YFLA 3LDFA 3LDUA 4HTFB 1RJFA 1Q0TA 4E31A 3PFHA 1ZQ9A 1P1CA 1XJ5A 2FK7A 4LECA 5GINE 2YUIA 4M7RA 2P1DA 1SQGA 3F4KA 4YUYA 2PWPA 2ZW9A 3TOSA 3KQTA 5GP1A 4DM3A 3FPHA 4KIFA 2JH9A 4E2YA 5C9ZA 2ERCA 2V7EA 3MGGA 5CUQA 2BR3A 4HC4A 3G2QA 1I1NA 4KRGA 3C6MA 3NWEA 4ER3A 5K0JA 1Y8CA 4HH4A 3BXOA 1ZHFA 4PINA 4B17A 2I9KA 2JH8A 2P3OA 4Y30A 1Q0SA 1YUBA 2YXDA 4PYQA 2A14A 3KR2A 1VQ1A 4DCMA 2O07A 3NWBA 2NXNA 1V39A 2YXEA 4QVGA 5CVEA 4ATNA 2XYRA 2FPOA 1MJFA 3BWCA 3NVMB 5EGSA 1XDZA 3Q87B 4RTOA 5G02A 4EKGA 3LCCA 3RIEA 4M36A 3PB3A 5ICEA 1O9GA 3AXSA 3O31A 2OYRA 2G72A 4CXMA 2ZWAA 1DCTA 4Y2HA 3D2LA 5T6BA 2IDJA 4QVKA 1KYZA 3EVAA 3TR6A 3HCEA 4G56A 3DUWA 5BW5A 3PLAE 3KU1A 3P9NA 3C6KA 4QPPA 1X1DA 3NW9A 2Y1WA 5ERGB 2ZLBA 3TM5A 4PYIA 5ICFA 1WXXA 3A25A 3E05A 5FUBA 4M38A 2LD4A 5K0CA 3G5LA 5DWQA 5LQUA 5CCXA 2G71A 3MCZA 5DX8A 2Z6QA 3BGVA 4MWZA 3TM4A 4A6DA 1Z3CA 2XVMA 2C7QA 2Z6UA 3NDJA 5MHTA 5DLYA 1FPQA 1P1BA 3EVGA 1BHJA 4FT2A 4IKPA 2ZBPA 3QOWA 4P7JA 4EKIA 2CKDA 3I64A 4GUAA 3MAGA 4PONA 2I6GA 1G6Q1 1XTPA 5FWAA 4AZVA 2UYHA 4CKEA 4GOMD 2ZZNA 1SUIA 2IIPA 3OPNA 2XVAA 3OZTA 1L3BA 1MHTA 2AOTA 2UYQA 3FPFA 1I9GA 2WK1A 5DTQA 5DSTA 1SUSA 3CVOA 3KKZA 2XYQA 4OQEA 1VIDA 5EMLA 1SKMA 2UYCA 1NKVA 1UFKA 5E8RA 3TKAA 4PGGA 3ERCA 3LSTA 3M33A 4GQBA 5U4XA 3SSNA 3I5UA 4BLVA 3GDHA 1VP3A 3I53A 4K6MA 5E1BA 5B1SA 4C4AA 2ZTHA 3AJDA 2B25A 2AOUB 1JQDA 5LQNA 3LKZA 2FRXA 2YQZA 2DULA 2PXXA 1QAOA 4RVGA 4FR0A 1RJEA 5GIPE 1NW8A 5GM1A 3FPEA 1M6YA 1EJ0A 1DL5A 4XUDA 2F8LA 5BXYA 4XUCA 1FP2A 1PRYA 3KQQA 4YUXA 3OU6A 5DTRA 5F2OA 4LWPA 5D1NA 3UJBA 2OZVA 1AV6A 3HA7A 5K0GA 5BW4A 3VSEA 3M70A 3GRVA 3FTEA 1BOOA 3TRKA 5ICGA 3FUXA 3OE5A 4E2ZA 3CJRA 2YX1A 4EQZA 4RTPA 5H02A 3KQOA 3MHTA 5FA8A 1QANA 3ER8A 5K8VA 1L3CA 5E9JA 2HWKA 1G38A 5FADA 4PCAA 4CTJA 4AZWA 1YB2A 1M0EA 5FCDA 4PCLA 10MHA 3KHKA 3KR0A 3I58A 4H0NA 1KHHA 4P58A 1L3IA 1P91A 4KWCA 3RW9A 2G1PA 3DMGA 1WXWA 1VBFA 2VDVE 4U7TB 2P40A 5GM2A 3IHTA 5FWDA 3CC8A 3MERA 2JJQA 3CJTA 3GGDA 5HZMA 4C08A 1KP9A 3B3JA 3BZBA 5EIWA 3S68A 5K09A 1R6AA 5EEGA 4GC9A 4PYJA 1EJ6A 4PIPA 5EMKA 5LR6A 2OO3A 5EHGA 5BP7A 4NECA 3DH0A 2AZTA 3C0KA 4E30A 4QQNA 3EVBA 3GIWA 2E5WA 5FA5A 4GEKA 3AXTA 1RI3A 5FQNA 1RI1A 4U7PB 3AY0A 1WY7A 2N47A 3EVEA 3P9KA 2I7CA 4XUEA 1KPGA 1JSXA 3PVCA 4DZRA 5CCBA 2IH5A 2WA1A 3M6UA 4X1OA 2NXCA 2EG5A 3HTXA 3A7DA 3HA5A 5FHQA 3UJAA 2AVDA 3BUSA 3HVIA 3KQMA 2O57A 3DXZA 1N2XA 3FTFA 5HIKA 5DRTA 2I62A 1O54A 2PVCA 5FHRA 1XCJA 2O0LA 3R6TA 4PYKA 4CKBA 3KPYA 4PWYA 1G8AA 1O9HA 5FQOA 2ZZMA 4E2XA 4PIMA 4HG2A 1KPIA 4GF5A 5K01A 1FBNA 2HMYB 3SX0A 4OX9Y 3REOA 3T0IA 4YV1A 3EEOA 3MQ2A 3OE4A 2G8NA 3GNLA 4WXHA 3FYCA 3HM2A 3B3GA 3BGDA 2B9EA 3P8ZA 5IKMA 3DP7A 3EVCA 2ZZKA 1SQFA 1AQIA 1TPYA 3THSA 3R24A 2O06A 1OR8A 5K05A 1ZGJA 1JTFA 1XCLA 4FS8A 3OZRA 1NW6A 3HCFA 3MTIA 5EPEA 3QOXA 1L1EA 3GJYA 1F38A 4UOEA 2JG3A 2ZBRA 3EGIA 3LECA 1IM8A 4RTRA 4BLUA 3HCDA 4GOND 2OPBA 3KPJA 3DOUA 5EQJB 2NNWB 3DR5A 4KW7A 1ZG3A 3FZGA 3P9IA 1JG4A 5E1OA 2Y1XA 5K0BA 1D2HA 2BR4A 1JQEA 4QDJA 3GRZA 2OB1A 3FTDA 4IV8A 5DSXA 4ISCA 3SSOA 5E8JA 1EG2A 5HOQA 1NBHA 2OY0A 2B2CA 2JHCA 2QM3A 3A26A 3ANXA 5K0LA 3P2IA 4BP3A 3R3HA 4RVDA 1U2ZA 5K03A 3E7PA 3ORHA 3IYLW 3OZSA 3SM3A 4YMGA 2BR5A 3TMAA 4O29A 2PWYA 2B3TA 4HGYA 4MHTA 2ZULA 3V8VA 3VC1A 1JTEA 4IV0A 2PXCA 4ER0A 4AZSA 1ZGAA 3PS9A 2PGXA 2IH2A 2XBMA 3G89A 4X61A 5F2KA 2PT6A 3KPWA 5E2AA 3SR4A 2C7RA 3M6XA 4LWOA 4EK9A 3X0DA 3HA3A 4R8SA 2G70A 4KDRA 3HVJA 5HIMA 1P39A 2HTEA 3JWIA 1NT2A 1SVUA 1X1BA 1EQAA 3DXYA 3M4XA 3THRA 2OBFA 2VDWA 4CWAA 1DUSA 3MTEA 4PGHA 5GWXA 4RTLA 5M5BA 2GH1A 2HR1A 1WZNA 4ER6A 4DA4A 5IH3A 2YTZA 5E1MA 2ESRA 3EGEA 3DULA 3P71T 1KYWA 4E2WA 5CVUA 5K0EA 3HNRA 3UJDA 3GU3A 2PSSA 4QTTB 4RTMA 3P9CA 3UJ8A 1KPHA 3OU2A 3OFJA 2H1RA 2QRVB 4HSGA 4MQ4A 2YXLA 3T7SA 5F2NA 3FRIA 2OB2A 3K0BA 3LCUA 3Q7EA 3KPUA 3SXJA 3UWPA 3CGGA 5HIIA 5KYGA 1JG3A 3DMFA 5DM4A 3UA3A 2WA2A 3TLJA 2GPYA 3SVZA 1UWVA 3FTCA 1RI2A 2JHAA 1RI5A 5GOZA 1TW3A 1R74A 2HNKA 2AOVA 3A7EA 2AVNA 3HP7A 1NW3A 4M37A 3TFWA 4PYNA 3SSMA 2PX8A 3UJ9A 1VP9A 2P8JA 3EVFA 3I9FA 2ZBQA 3FPGA 5EVJA 2Q41A 2GAFA 4RVFA 3IV6A 3ELWA 3ME5A 4YV0A 5K0FA 3B7PA 4P7KA 1WG8A 3FPJA 4OA5A 2P3QA 4HRAA 3EMBA 3AWIA 5LQKA 2IBTA 5CIYA 5E2BA 5DX1A 3EVDA 2YVLA 4YMHA 1YZ3A 1TW2A 2BH2A 5EKUA 2GLUA 4DCGA 4YUWA 4RTQA 4AZTA 1D2GA 4X41A 5C0OE 3ER9A 2ZVJA 2EX4A 1EAMA 2P7IA 4L7VA 4OBXA 1M6EX 4EMSA 5LQCA 2PX4A 3T7TA 2ORED 5LQAA 3E8SA 5JR3A 3HCAA 4X63A 4DF3A 3OFKA 5P8WA 3ELUA 1ZKDA 2O05A 5EZSA 1X1CA 4FT4A 1RI4A 3DLIA 2P35A 3IEIA 3BWBA 3ID6C 4E32A 2PT9A 5CVVA 3ELDA 2GA9A 2VDUE 3LGAA 1NW5A 5CM2Z 4PYLA 1QAQA 1G60A 3GRRA 4LG1A 5LSAA 2ZCJA 2NP6A 5LQRA 1X19A 2HV9A 4P7GA 4RVHA 3SGLA 4RX1A 3G2PA 1NE2A 3EVZA 4BP1A 5KQRA 2CMHA 3UJCA 1KIAA 3PT9A 4POOA 4KIGA 3LCVB 4CKCA 4RTJA 2PJDA 4R6XA 3R9XB 3MB5A 4FP9A 3NJRA 3O7WA 4QTUB 4YV2A 3NMUF 3TQSA 5ICCA
chains in the Genus database with same CATH superfamily
3MOSA 3QU5A 1RM0A 1D6MA 2DWUA 4HUJA 3GJTA 3WZ2A 2BZ0A 1DDIA 1N5RA 1ZHHA 2JFNA 3BJZA 4K46A 2APJA 2FK8A 4AROA 2ROQA 2X7XA 3EFEA 4EKEA 3SN6A 1WVIA 4O4JF 3WLAA 2JLWA 1UANA 4IG4A 4LBZA 1KMHB 1N2HA 2YDYA 3AF5A 3AZPA 3L8EA 4GOLD 2KPOA 1QUFA 3MQ4A 4LRSB 3R6GA 1MB2A 5TDHA 1VKJA 4DKXA 2AKEA 1YIDA 2HW8A 1NQUA 2O3RA 5JDIA 2Z2IA 4HH0A 3GJSA 4A0HA 3B52X 4NOKA 2HDHA 3M3DA 4GC5A 1I6KA 4Y7DA 3C2QA 5KINB 3D1LA 1UC4B 1J0EA 1X0VA 3DMHA 1X15A 2DGDA 1W85B 3OQJA 3M6WA 5JO9A 3SHTA 4YDRA 3HO1A 1ZUD1 5D51S 2ADMA 2O2XA 4X6YA 4F8YA 4RETA 5EHNA 2BEJA 3U44B 4BQNA 2NVOA 4PFQA 1E2PA 1GKIA 4FBMA 1KIMA 4OXIA 3R3SA 2EC5A 3ADBA 2Q1WA 2ZUCA 3NDRA 1FMFA 4RIGA 4KV9A 3C3KA 5KVAA 5LP1A 3GCZA 2KLHA 5BRNA 1A5TA 2CWWA 2VDOB 3IIMA 4NZPA 1PSZA 3E1KA 3LA6A 1YBHA 3RLFA 4F5ZA 1D4FA 2PD3A 4ND3A 2OPHA 4L57A 1D6SA 3TJRA 3TAXA 5K6TA 3GEBA 3QKIA 3KZOA 5IKXA 2IP2A 3QIVA 1SBZA 1Y6GA 3AI7A 1RJGA 2Q6OA 2GUWA 2V96A 1FP1D 4YUZA 5KC9A 2SBTA 4JY7A 2WIKA 3I6IA 3RG8A 1SCJA 5K0SA 1TIPA 5BVGA 1H94A 4WNAB 3LBAA 2H2IA 5CR9A 5EG5A 4MIKA 3I9KA 1PW7A 1VLMA 1Z0KA 2WMYA 3E3AA 4B3CA 1CRLA 1ABEA 4Y7CA 2C9ZA 3KOYA 2J09A 3MS7A 4DLYA 2Y1KA 3QWIA 1Z0IA 2PLWA 4FE7A 3N76A 2QJOA 1HDOA 3HLKA 3NT2A 1N0WA 3TPZA 3WP0A 2DTDA 4EKNB 3DDHA 4DR7B 4WA8A 2Z3ZA 1GZ3A 1RWQA 2FY8A 3BBPA 3ROXA 5HUQA 1E8DA 3IO5A 1L4NA 2CHFA 2QA5A 3BERA 3NBZC 4O33A 4PSAA 5L3SB 2BDEA 1I36A 3KUUA 3OZEA 4UREA 5DNWA 4HH3C 1YJCA 2OCPA 3MCTA 4WESB 2OFPA 3RARA 4MUHA 2D8MA 1JB1A 3KXPA 1B00A 2QPLA 4G63A 4KYTA 4JK3A 4NV0A 1T15A 5AQ1A 3OPYB 5IBRA 1HTTA 3CINA 3CCFA 3IQIX 3PNPA 5DXAA 3RUCA 2VK1A 3TFQA 4P0PB 1N7GA 4HO1X 1W0KA 1KY2A 4YPOA 1QUEA 2OORC 2VAWA 3QFTA 1J1UA 4CNBA 5FTWA 1PJLA 2ZJYA 1M5UA 3WL7A 1ESNA 3STHA 1X1AA 3ADOA 1B1AA 6REQB 4OM7A 1Q19A 4D0RA 5J43A 1ZUNA 2GS9A 5CLGA 5I7SA 1SG9A 1ECFA 1O58A 5IDYA 2ZAMA 3W5IA 5EXDA 1JQ3A 5KEIA 2V74B 5B3KA 1JHDA 1ZINA 1H8HD 1XEFA 3JQ9C 2QI9F 5A62A 4PHGA 4CV1A 1QGZA 2FSVC 3U4AA 1SHZA 3V8NA 4WV3A 1RBZA 5FAKA 1UBSB 1WDTA 2C5LA 3GV0A 4EFNA 1UXKA 5JXWA 2W2QA 2PQ0A 4IQGA 2ZYHA 1KC1A 5KQPA 1XDDA 4PNHA 2AHOA 3DVQX 4M3NA 3F4BA 5C1IA 4TV9F 4FD3A 3EQ9A 3BWEA 1NNEA 3S2EA 2W42A 4BWVA 1NYRA 3VPCA 4GICA 1VHQA 5CYOA 4Y9UA 5TQJA 3R0QA 3SEFA 3WRYC 2UXCB 4BLSA 2BLLA 1TO6A 2X76A 3TS1A 4P35A 2C2MA 3I09A 4IJWA 3IC5A 3JZFA 4R2IA 1H1DA 4NG4A 3VX4A 4BO2A 3OUUA 2PGNA 4BRZA 4CIVA 3HVKA 2BMJA 3D7KA 3LX8A 4BB9A 1E3MA 4CMJA 1U2DA 3DV9A 4E6EA 3ETNA 3LDFA 1N1GA 1E2BA 3QVWA 1Q0TA 3S5UA 4HH1A 3WNVA 3AC0A 1J0BA 4HVAA 1Y7TA 3QLEA 4N47A 3DDWA 4P0TA 3ZDAA 3WRXA 4KIFA 4H6VA 4Q34A 3LWDA 3AR3A 2NUPA 1DIBA 3FJYA 3FMFA 3GJ6A 3BSFA 3IBFA 3GARA 1A96A 4G0VA 2C3PA 2QQGA 4ZVNA 4EBFA 2YQ4A 2X3UA 3A4IA 2WWFA 1N2CE 3NOQA 4FEGA 2EKDA 1TQ2A 1VM6A 3IBYA 1KAHA 4MIOA 4ZTZB 1D6NA 5AHOA 2ID4A 3DA8A 1WOMA 2C20A 3JATB 1PZXA 4R9VA 2NUTA 4CZ2A 4TZ0A 1O0SA 3BWCA 4EO4A 1YZNA 4XTCS 1HT1E 2QRJA 2JD0A 5EGSA 3U7QB 3F2VA 3ZTTA 2ACKA 2K87A 1QHHA 1FUYB 2ZWAA 4HNGA 2P79A 4BLTA 3BJMA 1OU4A 2Y1CA 3ETCA 3HCEA 3K1TA 3B1KA 2VDQB 1BAPA 2H4JA 1I80A 2HEIA 4UUPA 5DYIA 3VHLB 2X9GA 3ZKWB 3G9UA 4KV7A 4KZPA 2I6QA 4P2GA 4PYIA 3DEHA 5DK6A 4A16A 2ZUWA 5JY6A 1OW3B 2E0IA 1HYQA 4E3WA 4DB4A 3OIDA 5BXQC 1KMCA 1P4AA 1VRWA 4ME6A 2WHRA 2ZS9A 1S5PA 2GD2A 1GGVA 4PY2A 3ORYA 3W3AA 5AK4A 4AY6A 4G0QA 2IVFA 3INTA 1ECGA 3HFSA 1VJ0A 2EVWX 3EMVA 2VRBA 4KE6A 4OQYA 3MNFA 4WK2B 3UXHA 1M73E 2AMJA 4CETA 4ZVPA 3UPUA 4Q3OA 1NR1A 3CMCO 3LVQE 3QOWA 4LJ7A 3E22B 3BQ9A 3PC6A 3WJ7A 1J9EA 1IXRC 4A03A 2WJPA 2FQWA 2FRVA 3CRRA 1S1MA 4GOMD 2AG6A 4IOJA 1FP4B 2WAMA 2QUIA 3D5EA 3OPNA 4IAOA 5JFOA 3ES9A 4UNQA 4W1PA 1II8B 1FW8A 4II2A 4QNMA 3EWSA 2YRFA 2W6JD 1DS6A 2VJYA 4MYDA 5E3HA 3DF9A 5HKAA 2AE2A 2WV7A 4TYMA 2P5SA 1CXZA 3WX0A 2WRZA 4PGGA 1QU2A 3M33A 1SU7A 5LQRA 2HHAA 2ZS7A 5DASA 3ML1A 3UUFA 3AUSA 1W44A 1Y3BE 2B7CA 1FTQA 4URHA 1JFTA 3SBDA 4RV4A 4LMPA 2AI3A 4BFCA 5ICSA 1EWRA 2MDTA 1ACMA 2PZAA 3M4JA 5A9SB 2ATEA 1M6YA 1VIYA 3I5XA 1F12A 2I71A 4K9RA 2BUAA 4FNGA 5JZMA 1JQ5A 4FGWA 5TIIA 1VE7A 2C5EA 3DFUA 1RT9A 3ZXXA 1X9IA 5F2OA 1EZ4A 1ZHOA 2AFIB 3I8OA 5HM8A 2P69A 1PS0A 3U19A 4XCVA 3L0OA 1KDPA 4OAQA 3A2NA 4FHGA 1FW6A 1G8PA 2VBIA 3ROQA 4IGEA 2HNBA 1A9RA 3ESZA 3DAYA 5I4KA 1SBIA 4AFNA 4YIKA 2RHWA 1LB1B 3LJKA 2C9YA 3FZYA 4QGAA 4DAOA 2JLVA 3WGLA 1O6FA 4LX0A 1Z5NA 1QZXA 2PS0A 3QUCA 4OY3A 1HDYA 1RQLA 4TZKA 4E5UA 5CFPA 4J6EA 3ANNA 3L1KA 2QQEA 2VYND 2X2FA 2QWXA 3C3AA 1V48A 2WD7B 1PFUA 3KNZA 2YIDA 4JSRA 4M6WA 1L5RA 1GU1A 1EFUA 4KXXA 4EGJA 5BR1A 4RK6A 1UKCA 1UP7A 5BO5A 1P74A 3OZWA 4OSPA 3NZEA 5LR6A 1KQ3A 3BGWA 5F7JA 2PUAA 3O2QB 1HLGA 3PGKA 4AC9A 4EY5A 3TMKA 2FPIA 3CUWA 3Q1LA 4TS4A 2RCYA 1LH0A 3FOWA 5J1TB 4WLUA 1UKBA 1QH9A 4MV7A 1JFFA 3ZU3A 3D2AA 2QLBA 2Z2JA 4U7PB 3WKBA 2P90A 5JZOA 5KHOC 3AERB 2AF4C 1ZO8A 3JQFC 4XUEA 2Q4BA 3ITNA 2WA1A 5HKLA 3EZNA 1ZMOA 3HVNA 3F1LA 5DM60 1SHKA 5FHQA 3WYEA 1ICIA 5TJHA 3TB6A 1OC2A 4RH3A 1DNPA 3JYNA 1PNVA 2NSYA 5FPKA 5L3QB 4JN6B 2P4HX 1WB6A 2YN2A 4QIHA 4JIGA 4P5DA 4WMLA 1YJAA 1W35A 3KJXA 4HGQA 4PLTA 3WNBA 5H8WA 3R9WA 3ETGA 1DC6A 3OURA 3A6EA 1R5OA 4E2XA 2MYTA 1JJVA 5TEVA 3SNKA 1Y4SA 4CNQA 5LQMA 4GYWA 2O1EA 3L6EA 5JMPA 5NULA 4M8SA 5LXTF 1H3NA 4RPIA 5HW0A 1TM4E 4V0ME 4DDKA 5B3AA 1ARZA 1LPOA 2ZSEA 2NO9A 1EWVA 1NF2A 1S01A 2HRCA 4KFUA 1AS2A 1N92A 1D1PA 3PNSA 1AMNA 4BMYA 5GZ3A 3TE7A 4C6HA 1D9XA 1EGMB 2LWIA 3AEQB 1QRTA 4OJKA 4WLFA 4Z4CA 1U5BA 4GGOA 1TA4A 3WIEA 1FFBA 3FD8A 1GZUA 2PRJA 3M3HA 4JELA 4NR0A 4TX1A 1W88A 2G5GX 5IKOA 3IBGA 5SYMA 4BGUA 5C5DA 4TV8B 1JTVA 1ZG3A 5TMDA 4D9JA 1N5OX 4YAEA 3UMSA 1AO3A 2QD1A 1P62B 3EG9A 3LL4A 4B33A 2JHGA 3LQQA 2R47A 1BHQ1 4QHTA 1DC4A 4ZIRA 1C9KA 3KD3A 5BSVA 3ND6A 2YXNA 4OHUA 2H48A 2DJ5A 3C48A 4LJLA 3RTBA 3D0QA 2VAVA 2VQDA 5AUPB 4L5BA 4EB6B 4QUKA 4G4IA 3K9CA 2PUJA 1WA5A 3EARA 3I4CA 4A5OA 1KH3A 3WFIA 4Y2GA 5FLKA 3LC7O 5AI0A 1BMFD 1AD2A 1Z4OA 5CD9A 1M6WA 3ZY5A 3GBSA 3AEYA 3H2HA 4IV0A 4AIIA 4BMVA 4HBGA 1ZAKA 2W00A 5IXSA 4RQUA 5F2KA 5KVVA 4XDHA 2C7RA 3TBFA 4O02B 4ALMA 4S05A 1M8JA 3H9BA 3SSAA 1H4TA 1XQWA 4FE3A 5H3CA 1AO0A 4FMDB 1RHKA 2EFCB 2R25B 4P3XA 5B37A 2C84A 5JH7F 1KEWA 4OKNA 3RSHA 1OWLA 2MMCA 3ACDA 3ODPA 3P0FA 1ZH0A 4C22A 1D7OA 4FFBA 1PDOA 1O4WA 3M6FA 4G4SO 3MTEA 5KVQA 5GWXA 2NTEA 3WGJA 4LJ6A 2AFHB 3N2IA 5HPYB 5FLEX 3K72B 1D1QA 4G5FA 1Z18A 3GHHA 3I6ZA 1WMAA 1HE3A 5K0EA 1UBRS 2QJRA 3QLVA 1ILWA 2AMLA 3AUFA 4PBSA 3EAFA 1P45A 2ZXFA 4AAYA 4UXJA 4ZCSA 4LVCA 1Q1EA 2XNCA 5LIRA 3UV6A 4DY4A 2NU6B 4Z4QA 3VNUA 2XMCA 4L5CA 4U2EA 4MGEA 3NYRA 5HIIA 2OG1A 3TZLA 3F3YA 1JXQA 2G77B 3KJQA 2EJCA 4P4GA 4BIMA 2VJLA 4LZOA 3PFIA 3CM0A 4IDGA 5B6JA 3S8MA 3KKMA 6ADHA 1NW3A 1E3DA 1ONPA 3QG1A 4ZYXA 2BI4A 2RIPA 4RU1A 3EVFA 3N58A 4X1IA 4XRRA 4UXHA 4DADA 3UGQA 4DTCA 2C4MA 2O5CA 1LEHA 1Y5RA 3H9EO 3K09C 1IIBA 3L7IA 2L17A 2IHNA 1WUTA 4GGPA 4K3VA 3PHHA 3N05A 1QORA 1IOWA 2G9UA 2PN1A 3SLGA 4KCGA 1XHLA 1Z6QA 1C2YA 3L0YA 3TZCA 1U1GA 2HY7A 3AWIA 3NP7A 1AU9A 1EWYA 1Z73A 3MXTA 1NATA 4ZPXA 4BC1A 3MWDB 4KQ2A 4DG9A 8ATCA 1CUYA 1SXQA 3DG9A 4CFSA 3QHQA 4Y6PA 1J1ZA 1JV2B 5C7OO 1EHCA 1AQNA 1ZRSA 3WYBA 1GV0A 3FKQA 2CVQA 3QVSA 4Q93A 1MJGM 1SVOA 2JVKA 2IUFA 2PO5A 2WJJA 4JYCA 4EYSA 3G8DA 3QI7A 1NA5A 3B9RA 5JI3E 4GPAA 2PTHA 4BDTA 2QRGA 3NC1C 3HNOA 3ANLA 2CEKA 3JQBA 2OQ2A 3FMOB 4L75A 5CA1A 4TS3A 1N9KA 1WEHA 3WA6A 4Y2VA 1ZJ5A 5EXEA 3H9UA 3UPDA 1CYEA 2H85A 5HS6A 4F8EA 2KWIA 4DJDC 2OEPA 3ABSB 1F06A 3NNSA 4GVXA 1GL6A 4AKHA 5B3LA 1G60A 3OH8A 2Z2ZA 2JGNA 3E8XA 1OXVA 1Y8QB 1I2BA 4ZYVA 3V1NA 2YWRA 3BWDD 4DUYB 1FMTA 1R64A 2EGHA 2GK6A 3FBGA 4D1YA 4FHEA 4GXQA 4Y1RA 3F6BX 3TLCA 5IABA 4HAVA 5JJKA 4H18A 3H11B 3OCVA 3GUCA 2KSQA 4IPTA 3MLAA 4P80A 4TSRA 3UWSA 2J4CA 1UM8A 2R2GA 1MAUA 2W6IA 3FYTA 1L4GA 3GP3A 4REMA 2E87A 4AQDA 1O5TA 1E4VA 3C7DB 3FVQA 1EWTA 3CPSA 1JG6A 1MMFB 2JJ2D 3MWLA 1OCEA 4PZ0A 1NUAA 3G2LA 5DN6A 1TPZA 1Q3KA 3U61B 4C3VA 3T7AA 2BRUA 4DWJA 4LNUA 1ZX1A 2Y8EA 4DKJA 4MDEA 3V4RA 1P5RA 2WYUA 3QKSB 1C3VA 1YL7A 2BI8A 3ROMA 4WY8A 3D1VA 5LXTB 4W7IA 4JJ4A 3B6ZA 1BD4A 5A7GA 2WHPA 3HXPA 3OZAA 5I01A 1SCUB 3OQBA 4LZPA 4PLWA 1Z17A 4LHXA 2AFIA 1LBQA 1UPUA 3I9LA 2ASVA 4ZCPA 1TFUA 4L9WA 4BMNA 4XM2A 3GHYA 3JS5A 4D6YA 1ZONA 2NACA 3PGXA 5EHIA 3ZI7A 2ZT7A 4E7PA 2JS7A 3KWFA 4FMCF 2C2WA 4RA6A 3JQCA 2RK6A 3RSFA 1YZGA 1FF9A 2H16A 5CT9A 5C31A 1YF3A 3EIWA 1V16A 3CLRC 4F85A 1GIAA 1Q6ZA 1Z7WA 1D1TA 1UZLA 4POAA 1JR2A 4NHEA 2AZ4A 4ITRC 2G5PA 2RHDA 4YUVA 3IHWA 4PZLA 3S44A 1QX3A 1LXCA 4KQCA 3F1KA 4K26A 3R7DA 2IQIA 3U4DA 1FL9A 1JQAA 4Q4DA 4KAJA 2I3GA 2IEIA 5EE9A 2ONKA 1L5MA 1PZHA 4QFMA 1LK5A 3GGOA 4AG3A 1CY0A 3KJGA 2X0DA 1NNI1 3AVQA 4MGKR 2IEYA 4D9BA 4F4DA 1Z8NA 3VR6H 5JRJA 1BWRA 3IAS1 3D7RA 3ZX5A 3DEYX 5ILQA 5KHLB 1OX5A 3FIJA 4P86A 4W8GA 1C7FA 3NC4A 1SC6A 3U49A 1LX6A 4OIMA 2E4WA 1QAMA 1VKHA 4UEJA 4FEEA 3A2LA 4UBJA 4YA6A 4C29A 3JQGB 2QVZX 3WI7A 2H4FA 3NUQA 2IJGX 1U9IC 2R11A 5LQSA 1E20A 4ZYUA 2FZKA 2IODA 2X9QA 4RCYA 3CZ9A 3QA3E 5DO9A 1VHTA 5DRYA 1MA3A 2DPLA 1PX0A 4K03A 1YR2A 3ZDCA 1MFPA 2BHRA 4WX2B 3DAFA 1RXIA 3D2CA 3DO8A 4GNKA 5FTMA 4NBRA 2ZM5A 4QQFA 4LFCB 2PUFA 4J0CA 3SZGA 3EBPA 1VPWA 1A2KC 2W90A 4V2IA 3WK6A 5IVPA 1N9GB 2IPMA 4YJHB 2JCBA 2VNKA 2XD4A 3AHIA 2YNMC 3MUOA 4LSWA 1RC0A 2W22A 1Q15A 5B7GA 2AOUA 2V4UA 1GG5A 2FR8C 3E03A 5CYFA 1N6OA 3HCCA 4QDOA 3RREA 3AJAA 3TJZA 2YV4A 1HG1A 1Q3TA 3WYAA 5IEJA 4GP6A 3P2EA 3P0EA 3W5HA 3ZZNA 3S2ZA 1FFYA 1KEEA 5B64A 3T7JA 3CLVA 3RPEA 2X5OA 4AM8A 1V11B 1VLQA 3D7NA 1T5DX 2IDMA 4BNDB 4X71A 1BH6A 1D8TA 1LNZA 2YN0A 3AR5A 5ALFA 2ZP1A 3R5JA 1L8QA 4EHAA 2GHTA 2Q8PA 3TG2A 3JARA 3FA2A 3KK0A 1G3RA 3H6KA 4MJ3A 4J75A 2YJ6A 4O5AA 5CLIA 3AUTA 2NUAA 2BFEA 1JIQA 2VS1A 1PNQA 4TZTA 3QE4A 4M9ZA 4H3HB 4PYMA 1S89A 1Z07A 1M2KA 2GTIA 2ZTUA 4Q39A 3F71A 4XIYA 2WY2D 3E8MA 4NBKA 2VF4X 3FH0A 3HKBB 3N9IA 4PO1A 2W8ZA 3E9QA 5CX1A 5GIOE 2ZU0C 4MLCA 2ILVA 2XDWA 3OJXA 4Q3KA 1V37A 4EYKA 2XUHA 5IMBA 5CIWA 5DZSA 4D9FA 1NXWA 3JASA 4DIKA 1KL7A 2IEGA 3KD2A 3K1AB 1FNDA 2ONZA 4JJKA 5BR4A 4ENVA 3P1JA 1XZLA 2OQIA 3LT4A 5D00A 2QTHA 2D2VA 4KKXB 3I73A 5BV0A 3K6SA 4RLQA 5B30A 4MWGA 4E31A 4BAUA 1CPYA 2BHLA 2H5JA 3FNIA 4GS5A 2XQJA 2G9RA 1DBSA 1GNTA 3IT3A 3K09A 3QWBA 2H1FA 2WTAA 1K8RA 4FDUA 3M6LA 2HRRA 3DW1X 2RGNA 3F4KA 4R98A 3BXXA 4GLBA 3SS8A 3TOSA 4BRUA 3NT5A 1YE3A 2JH9A 4ZOBA 5J59A 2ZI5A 3WXMA 4QGFA 2Q28A 1SXJA 2X41A 1P2UA 1G5QA 4I6JA 3H0KA 3TEJA 2FJ0A 3NWEA 2EDAA 4HH4A 4QU5A 2JGKA 2ARKA 3LLMA 1K97A 2JH8A 2I9KA 1MX5A 3AM4A 1IN1A 1WPXA 3B82A 2I2AA 3AEQA 2O07A 1FQKA 4M0KA 4ZALA 4ZO8A 3BSWA 1K4YA 1QGAA 3AM5A 3DCIA 4Z9XA 4XGRA 3SK0A 4WKPA 3V8RA 5B55A 1ULUA 2X3YA 3TTWA 4EKGA 3PA8A 5F3RA 3RIEA 4M36A 1XMXA 4I50A 1L5WA 4OREX 3ITDA 5IDQA 4ZOLF 3EVAA 5AM5A 1RBMA 4YT5A 5KMGA 1EUCB 1PUXA 2D1SA 2PRSA 1FQWA 1X39A 1YMVA 3FIUA 3AM3A 4RY8A 2W2XA 2I7VA 3JALA 1FLDA 3SYLA 4K9DA 2ZYIA 2DT5A 4PO3X 3JYLA 2ZITA 1DHRA 2AJBA 3O3OB 3IP7A 4FJ0A 2IIVA 3A25A 3EOBI 4B48A 4EM6A 3G0BA 4G85A 7ADHA 4DSAA 1MC4A 5FTLA 4LZZA 4I19A 4GG1A 4QYSA 2EZUA 2JAXA 1QOPB 1FJ2A 4JFRA 1YS4A 4A6DA 1N7HA 2C9MA 2IXTA 4AO8A 1V8OA 2N0SA 3CO5A 3L6DA 2AL7A 2F6RA 1IN7A 2I54A 4D9IA 1H65A 4NQZA 1DKQA 2B7LA 1KMMA 1YRBA 2WLTA 2Z5GA 4GUAA 4N82A 5FXMA 5JYDA 3BHNA 4MQBA 3TUZC 4HNHA 4CKEA 1E5DA 3GJ8A 3OF2A 2IEBA 4LY3A 4V0KA 1E7RA 1E79A 3S1AA 4G4GA 4EX7A 5J58A 5AQEA 3U9TA 4YRZA 1G8FA 2I9PA 1VMIA 2XYPA 4B74A 3TTSA 1GN8A 1KY5A 2W2KA 3Q12A 2ZQZA 4D80A 1BSVA 3OFNA 4DPKA 4RCZA 1IY8A 4XJXA 5A6SB 3RC9A 4DNXA 1HXHA 1E7QA 1ZA2A 1EFRD 1DT3A 2YWFA 1JDPA 2X3FA 2XQKA 3L7MA 4L9RA 3T9CA 4FKBA 4DEVA 4FE4A 3ZV4A 5E1BA 4W5JA 2BEWA 5AJTA 2UVPA 4L4UA 4H6PA 1E1DA 1P0FA 4W5OA 6REQA 1M2NA 4MITA 5L7WA 4WZAB 2ZUBA 4ACBA 1NW8A 3F9RA 3QNMA 5E7MA 1I9CA 5GM1A 3UK2A 4BBPA 2BP7B 2ILTA 2VXYA 5FTJA 5TY0A 2RE8A 1RWWA 3MINB 1H6AA 1MAAA 1AOXA 5CBPA 1DCFA 3VBEA 1E66A 4MWCA 3UXYA 1I01A 1G8JA 5ALRA 4J4BA 3HLTA 3M70A 1PNOA 4IDFA 1Y6QA 3LT1A 4MA4A 4UM9B 1TK2A 2QE7A 2YQ5A 3A1TA 2YYAA 3KVNA 1U2TA 4CMEA 4FOTA 3HTXA 1XU4A 4EFKA 4G9BA 2GZRA 3ER8A 4LJRA 1QANA 4TKUB 4B35A 1SC9A 1G41A 3RYHA 2OMKA 3ZE6A 1BA2A 2V6FA 3O2JA 5A5DA 3FCAA 2CUKA 3NOXA 3IIJA 4G5YA 1R7RA 4DW8A 10MHA 1P4RA 4E4RA 2OQRA 3FFAA 4L0DA 4BV3A 3F3SA 4RUKA 1L1FA 5GM2A 1YVPA 2YC4C 3RDPA 3OTOB 4QSHA 1GYRA 3VAZA 2C5SA 2I91A 4F2PA 3LQRA 1KYQA 2YWDA 4PIPA 1V6AA 1DJOA 2WVHA 4LE1A 2C2HA 4NECA 1IIRA 3VVMA 4N4AA 2X6TA 4GSKA 3UYLA 1W36D 3EIFA 5DTEA 4XRGA 1JS1X 3K0CA 2B82A 1YJBA 2QZJA 3QJGA 3QLUC 5FQNA 3AY0A 4EFDA 2RD2A 1CRQA 4AMUA 1JPVA 1KQOA 2XH8A 4RGBA 3FZEA 1WBDA 3TQQA 4RA9A 2JGJA 2B1QA 1TQ4A 1WLSA 1ZEMA 4MKHA 3V55A 4XQ0A 5JVDF 1L2TA 2I3DA 1KK2A 3A7DA 3BUSA 2J5BA 4B09A 2A0KA 3L7JA 4D6PA 1G4HA 4OJMX 4QEZA 4YS6A 3U7RA 2BYTA 2F8MA 2YJZA 4TRNA 5HR5A 2LDBA 3ZDQA 3ROPA 2FWIA 1JT9A 4R9RA 1ZMBA 1JHRA 2QXYA 3K0KA 3RFFA 4D8XA 4ZZ3A 3J81k 4WKNA 4H7PA 2M6LA 4KR9A 2I8AA 2WHXA 3WAKA 4PIMA 2IYAA 3JYHA 4RAOA 5FV4A 3CF6R 4JMLA 2H06A 2HK7A 1QHHB 2IP4A 3A0RB 3TB4A 1R0XA 3ZEIA 1MQ9A 1R3DA 1EKXA 3OJFA 4GRDA 4R84A 2V65A 1QFJA 1SQFA 4DQXA 3R24A 4A1OA 5EJ2A 3GW8A 4Z1MA 3KEGA 1LQTA 1V5FA 3OZRA 4XWKA 3GCDA 1E89A 3W79A 2PCJA 3UK6A 3C45A 2HQOA 1P73A 1ML3A 2V59A 3PPVA 4JS0A 3WIVA 3EUAA 4Z86A 1V25A 3F6PA 4YCLA 1NBMD 1Z34A 3G5AA 1GUFA 1Z35A 4KW7A 1G5HA 3FZGA 4CG2A 4MLZA 3E5RA 1DOHA 2FPGA 4A10A 5BSHA 1CUGA 3HSYA 3S7TA 1EJBA 4JB0A 2X4DA 3R09A 1EM8A 5DNUA 3NHMA 3CPHA 4MX8A 4NWIA 3BHMA 3MQFA 1W4RA 3MTAA 5K0LA 5C1PA 3KSAC 2HFKA 2PRYA 1A8HA 4CCSA 2I3AA 1YS2X 4WJKB 5F23A 2X4IA 3VZDA 4NAVA 5DMXA 3OLZA 5J9FA 1THGA 5BWMA 1T8WA 5HQ3A 2IKSA 4WOCA 2P75A 4MKIA 1KEEB 3SKXA 3CUEF 1DTDB 3PS9A 1RPTA 2PGXA 4KDFA 2R65A 4U2BA 4BNIA 3A1WA 1W5AA 2CY0A 2DKFA 5I51A 3VVCA 4MINA 1JL3A 3GYGA 3KG2A 4YDSA 3TSZA 1WXGA 3OZUA 5LMNB 5BN3B 1U65A 5JISA 2UYGA 5JLJA 2Z2KA 3KJNA 3FMGA 1KEKA 4L6AA 3HBLA 2ADOA 3LU1A 4KTVE 4E3ZA 3A05A 3KWMA 2EL9A 1W6UA 2E4ZA 4QXQA 2HR1A 4ZJUA 2DTXA 1UK8A 2FZ5A 1QIJA 2LPMA 2W8BA 3GFGA 3IX7A 3KZVA 4DQUA 4JYZA 4LVOA 5GTDA 3R6LA 1VDMA 2QW0X 4GX5A 4P22A 4LK3A 3UICA 1KFBB 1Y9DA 2I4LA 4JYPA 3UJ8A 1JLRA 3A6KA 1R27A 2RB4A 2V3WA 5G2OA 1ONSA 3C3MA 2YXLA 2H9AA 2RARA 3KEOA 4B3MB 1Q0QA 3UCFA 1MH1A 2XNKA 4BECA 4TKVA 5LNK1 3GFRA 1JRLA 3WLKX 3R5SA 1KK0A 1LKZA 1RZVA 3OQPA 4NFYA 4F71A 4TMZA 3T7DA 5M34A 4PSVA 4B7XA 2VDPB 1RI2A 1OFTA 2ZPTX 4I1PA 4YQEA 1Z45A 1MXHA 5EP4A 1OXSC 3IUBA 4FCWA 4NEQA 2DFLA 5FDFA 3GT0A 5INTA 4HUQA 3E15A 1I33A 3MELA 4FFMA 4KX5A 5GV7A 3TCXB 1G4AE 1VGQA 1CYDA 3B3AA 4D5EA 5DEIA 5K0FA 3DVLA 4DR6B 2ZBFA 3B12A 2WIJA 3KUKA 1N4AA 3RFUA 3AX6A 2E5FA 1LU9A 4KKVA 3T34A 3CH5A 5CDSA 3UN1A 4AVYA 3ICCA 5SYAA 4C0AC 1B16A 2GLUA 1U63A 1XCOA 1CZRA 2CB0A 3IUJA 3P9QA 4OU5A 5C35A 1AGPA 2OBLA 2HOQA 3CURA 4ESHA 2ASEA 2HRQA 1A8QA 3LNTA 1RXEA 4F5YA 5B4UA 1AQJA 2GN4A 1L0BA 4B7ZA 2JKVA 1PT9A 3BIXA 4A8JC 1B6TA 3JZIA 2E18A 3AGQA 2PMDA 5EIHA 5AIAA 5EXPA 3O93A 3AVTA 4RNDB 2DSNA 1VCMA 3VJLA 1PL8A 3DE7X 3O73A 2FU5C 3RJMA 4IMJB 4F21A 2PT5A 4J4HA 1SOVA 4DXAA 4C2TA 5KTMA 1YR8A 1L5SA 2REQB 2W6JA 3AK4A 1UMCB 2GPAA 1MHPA 3DUFA 4LG1A 4P2BA 1O87A 2A9OA 1Y1PA 3A2MA 5B58C 3AF0A 3FYUC 4K40A 5EIOA 2HU7A 4JQOA 3CG0A 4MP8A 2QQ5A 3EVZA 5KQRA 2WM3A 1N8SA 4N0QA 3EA4A 4H7FA 4N7MA 2FVYA 4NMXB 5JWHA 4UUQA 5B1YA 1VJCA 2J46A 1IEXA 2HMUA 4FC6A 2WDPA 4Q3DA 1L5GB 4ZODA 1MRZA 3O4FA 2Y92A 1OZGA 4OFXA 4PQRA 2QMOA 3T1OA 2BDUA 1PWEA 3B89A 3VTZA 1IUPA 1Z7YA 3JAWB 1L5ZA 4YAGA 1UXOA 5M3BA 5A6SA 4O2AA 3FNHA 3GPLA 3DZFA 3D1JA 1FS6A 4Y0AA 3WGYA 4CDMA 4ER5A 4BQQA 1PGJA 2OAQ1 3L1JA 3WLMA 1HH4A 1AZSC 1CB7A 2BEVB 2GBIA 4Y2YA 4M8IA 3CBQA 4BO0A 3ESXA 2Z43A 3O21A 3N8HA 1RWNA 1VKRA 2DFPA 3HDHA 3V8MA 4E5PA 5YASA 3MINA 1XLTA 4PAQA 3Q8MA 1FNNA 3UT6A 1YULA 2ZJ2A 3HJGA 4P38A 3AESB 3GWZA 1XWWA 2H52A 2H7VA 2IY8A 3HCRA 3LYUA 2VUHB 2Y9PB 2P4UA 1TEVA 1Z39A 4C06A 1I14A 1XLVA 2QJFA 5D87A 1XWIA 1UQRA 5B7QA 3UMCA 1MDBA 2HJVA 3E6AA 2WB4A 2BHNA 3M4NA 1KP2A 4EJ2A 3U09A 4WN9B 3VZQA 2GB4A 2J3MA 1CS0A 4LWQA 1BKSB 4BV9A 4ZQEA 2EBWA 4TKMA 1BYUA 2AZMA 4D0SA 5EIFA 2ZRMA 2DLNA 2NYVA 5FBZA 5A9RA 4B3DA 3BD7A 1I4EB 4BATA 4CEJA 2KJQA 1S1CA 1YS6A 2ZYTX 3WNZA 4A6PA 5F3WB 1MO4A 2IBSA 4Z7QB 4XLLA 3V8EA 3LW7A 2CK3D 3FWYA 1QR2A 5HF5A 1SOMA 3E2IA 1HM5A 4UBNA 3G8YA 1CBUA 4LDQA 4KOEC 4CHTA 1J8QA 3VKWA 2WUVA 3PZRA 1EQ2A 2CFSA 3QW4B 3OM8A 4BZZA 4DJ5X 2QN7A 2FUEA 4B4UA 2BMEA 2IXDA 1BCRB 4RV9A 2QX8A 1E9BA 1TOAA 4F2GA 1Z83A 5FOVA 4LYAA 3H2JA 1KEUA 1ZW1A 1E3SA 3O38A 4HN9A 5DWDA 3WGNA 1T6NA 4A27A 2R5NA 2PUCA 3P2JA 2R2AA 1NOIA 2IX9A 1ULBA 4HTFA 4KU4A 1TJ4A 3TZEA 3EEYA 2DF8A 4XGIA 3FBTA 5BN5B 1S2IA 3MGBA 4WT7A 2CLMB 4TSKA 4F2HA 1NPTO 1QO9A 3HI4A 5LC1A 4MI6A 5AHXA 2PJRA 3QWHA 1DAFA 1O6GA 3QNWA 1HNWB 2CLEB 1XVAA 5CYPA 3SP1A 1QVVA 3QIAA 2Y0BA 1PV2A 4I4TA 4E5SA 5DX0A 1SQ6A 4ZV7A 1B6SA 4GR9A 1VHWA 2YBDA 3H2SA 4MVJE 4CJXA 1RLIA 5C34B 2MSNA 2FN9A 3O8NA 4KO2S 5H0IA 2OYSA 1TXGA 4FHCA 3VSAA 3RSSA 5IMSA 5EAIA 4TRJA 1PSWA 1UOQA 1JEAA 2PBFA 4FYMA 2PYIA 3KQYA 4IDEA 1L4BA 2XE4A 3IRVA 1S3GA 5HFJA 1MTZA 3IBSA 1XZKA 5HJEA 4MB6A 4G0UA 1OWPA 4BLOA 3OM0A 1GTG1 3E9YA 4MRSA 1KF0A 3PNMA 4S1PA 1VRCA 4OBWA 1FUKA 1U7UA 4AJNA 1XRLA 1JH9A 1S2MA 2WYOA 4L4YA 2WYIA 4IZIA 1F48A 4BU0A 1CUCA 2AJTA 5BORA 4R83A 5C81A 4X6LA 1M75A 1HY3A 2ES4A 1X7GA 2JGDA 2XF8A 4H35A 4TT3D 4YMSA 5C4GB 3GELA 1NJ5A 5LU9A 1P0IA 3WK8A 2Q5JA 2PX2A 3BF8A 2FRDA 2I66A 1BS9A 2AI1A 1VLVA 2FZVA 1RVDA 2Q27A 2WI8A 3A3OA 3AUUA 3BDAA 1AF4A 3IDOA 1WVGA 4PTLA 3ZXIA 2CT8A 1PJBA 1R12A 3DFKA 4XPIA 2Q1TA 1KJJA 3MZ0A 4WLVA 1XEXA 4E5MA 3UTCA 2VTKA 3HPQA 2Q3FA 4JLWA 4TRMA 2O7NA 5LJLA 2FMIA 1WIWA 3DWGA 2H5IA 1CY7A 1ZJ4A 2LRHA 1RLMA 5AH0A 2QRQA 4AN4A 4QUBA 1V5GA 3RF6A 2VBCA 4BTVA 4DNOA 4OSEA 4CF6A 3D02A 4Z51A 5ILGA 4CM3A 3L8FA 1H2EA 1QR6A 1U8YA 3IHKA 5ESWA 2BPOA 5F35A 3ZE9A 4CEIB 2FK7A 3SKVA 1AGRA 2PX3A 5A1TA 1OMOA 1OAAA 3OO1A 4JJGA 5I7UA 3RFCA 4IUYA 2QK4A 1X7WA 3BK7A 1R4NB 2PWPA 1KI6A 4G0XA 1QFZA 1M1YB 1ZXBA 3I0ZA 3L01A 3PEFA 5GONA 4PGMA 4DM3A 1LI5A 1UT6A 2LW7A 1HDXA 1ZH2A 4ARZA 4OHFA 5CFOA 4U9HS 3MTGA 4HC4A 4HNAA 2LV8A 2QSUA 5DHRA 1GTL1 1H0SA 4EG0A 2FOIA 5J4YA 3EPLA 4G9EA 1ZHFA 2VWHA 3OEHD 2OGZA 1Z74A 4BNXA 4BO4A 4YJHA 3S2SA 3N6VA 4HNVA 3K9HA 4P7BA 4CRWB 4BQEA 1G8MA 3PEUA 1P80A 1YB1A 1V11A 2CJWA 4EI7A 1X8XA 4YQFA 5DHAA 2Y1DA 2O6LA 1E32A 4WLOA 2OBXA 3IUQA 4PV7A 1R0YA 5E4TA 3UKJA 4RKWA 3WZMA 1JFLA 5IAJA 3H3FA 1IL0A 2YFQA 1MD9A 3F98A 4MR9B 4L50A 4ZDWA 3ZHXA 3DWIA 1D2EA 3IB6A 5IVIA 3VR2D 4BZWA 1L1RA 1Y42X 1E7MA 2IYZA 2W2LD 2XBLA 3QKUA 1TO1E 5KTKA 2G09A 1A5ZA 4OF4A 2PH7A 5CX4A 2G71A 4TL6A 5HQ3B 1EA5A 5J5VA 2JLUA 1CDEA 5AK6A 5IM5A 4MWZA 3BA6A 4OUKX 4RHCA 3CXUA 1JHUA 2YOGA 4K9MA 4OO3A 5DLYA 1W94A 4HKTA 4D4KA 1ULSA 2C03A 4X1YA 4PF1A 1T13A 4BFTA 5KU1A 4B9EA 1JVNA 5J2TB 4UZFA 3VR4D 2ON6A 5C7YA 2HA7A 4ZVKA 4J7UA 4OQQA 4FYXA 2DBQA 1GHTA 4RK5A 4GT1A 5JMWA 1MHTA 4Q3AA 4UM7A 5C8ZA 1BE8A 1ISFA 3KKZA 1T6YA 3BWVA 2FGKA 5DYYA 1CQWA 4Z4IA 1ZGHA 2BSXA 3K0FB 5K20A 4PX9A 1JYSA 3ERCA 3KLMX 3K0SA 3WYFA 2OBYA 1RMYA 3KOZA 1J5PA 5H4HA 3SKYA 3WDKA 3HQ4O 3ETHA 3OC0A 4S35A 3DOOA 2Q8QA 2AV6A 1G7CA 4I4LA 4LNHA 3JQDA 4UM9D 4HWKA 3WWPA 3G13A 4ETNA 2O8DA 4X9XA 5GIPE 1E1CB 4CT5A 4CM6A 1CEYA 2WUWE 3FYUA 1UC9A 3L4BA 5FNZA 4AZ0A 4FX5A 1R5BA 2GSWA 1A7KA 1SRQA 3GRCA 3L0ZA 4HNSA 3VNQA 2WZCA 2FLVA 1NWHA 1WHSB 1GU7A 1DU4A 2GD1O 2WT9A 3RTAA 2JCYA 4EJSC 3GRVA 4UJ3A 5L3ZA 3IKTA 1J0DA 1PL7A 1G2OA 1YJQA 2CLFB 2QMQA 3PBKA 5ES3A 4YP5A 1Z2OX 4EI9A 2AD1A 3WLQA 4O5OA 4BQIA 2YH2A 5F5NA 5JVDA 1TEXA 4HCJA 4IJVA 3NYQA 1LVHA 2ZWIA 4WBSA 1CERA 2WJ3A 3CFYA 4PCLA 1BRMA 4PRZA 2C9BA 1F8UA 2H5EA 4R0VA 4Y2RA 1CTQA 4N3NA 1L3IA 2HJRA 3JQAB 1F2TB 2WWHA 3P26A 3PC2A 3RCBA 4M83A 2RKOA 1PFVA 2VDVE 3QBTA 3H2ZA 4H3VA 1D2RA 4UNPA 2AYZA 2ZI9A 2QR5A 3GEGA 5ELLA 4EPTA 2QE7D 4LOHA 2OV1A 2X77A 2ABZC 4BEWA 4JJIA 1K8QA 3GT3A 1EUZA 1NLMA 2JFGA 1D09A 1FP6A 1IU9A 4LV6A 1XQ6A 2FSFA 3MRXA 3EGXB 4I1SA 4Q3LA 3Q7PA 2WW8A 3SHFA 3L7BA 1G0NA 2W2KB 3IUPA 4LQLA 2XW6A 4EKYA 1V3UA 3F0TA 2ZR8A 1VI6A 4BQFA 4G2TA 3D8BA 4ZJZA 3KJIA 1Y7IA 4J0HA 2VK4A 2JI7A 4P5PA 4X1OA 1DQNA 1QH1B 2PMEA 4TROA 4JBWA 1ISSA 1RP7A 1UODA 1IPHA 1I51A 2WP0A 3MT9A 1PFQA 4QOJA 5H16A 4MQFB 4FZJA 1FNSA 1MIOB 3AETA 3LPLA 1U81A 2YJNA 4Q7MB 4CFZA 4EAAA 4I3GA 2RBEA 4EVSA 3F6YA 4MJLA 3J81A 2B92A 1DAOA 3GLGE 2QENA 3KPYA 1ENPA 1R6BX 3ONDA 1X7XB 1TI7A 1VYTA 4EARA 4IIUA 4O4JB 2AR7A 4O63O 4FD2A 5IC6A 2RSLA 4IIVA 4ANFA 1OY1A 1XMIA 3OLWA 2Z08A 3EEOA 3OE4A 1KO8A 3AB3A 2RB5A 2WEKA 4X91A 5JFTA 3B3GA 3OO0A 2ORIA 2NMVA 2JCSA 1AQIA 1MXFA 3I39X 3IUSA 4PZAA 1OR8A 4QU9A 3VJMA 1PE0A 3RVBA 2HA4A 3BORA 4X84A 4ZZ2A 3ZQJA 3KZXA 2D1QA 1QOQB 3GJYA 1FUUA 5DB4A 2HA3A 1UF9A 2P77A 1A5AB 4XSVA 1CUUA 3HL4A 1QB8A 4IXTA 4H4DA 4Z0TA 4F3NA 3TZKA 3DOUA 4JB8A 2P3SA 3GVCA 3P9IA 1E1QD 3AUJB 1RXSA 2Y1XA 1CE8B 1V5WA 3AJ9A 4OHRA 3WWYA 1BQ3A 3WG9A 4ASUA 4Y2UA 2I4TA 2HA6A 3ICPA 1AHHA 1Q57A 3GMSA 1CEQA 4FOOA 1EFVB 5HUHA 1X42A 1DAEA 1BE6A 1HFEL 1WE2A 2NZXA 3BEOA 3DOEA 3GAAA 4GZLA 4LWZA 4PG5A 4UASA 5TVKA 5DCYA 3H18A 3BFPA 4WFKA 3P2IA 4F6LA 5F9HA 1S2GA 1RE0A 2KLBA 3HU1A 2QUHA 4LJSA 3VA7A 1FRFS 1SGWA 4JLMA 3W6ZA 3PX7A 4YCCA 2PYDA 3DHYA 4R4JA 3QE9Y 2QY9A 3QUSA 3KDAA 2QN8A 5F1YA 2YHSA 2G4CA 2JLRA 2ZTSA 4P3KA 1TM7E 5E7JA 4XASA 5IAEA 1XXHB 1ZOIA 2H08A 3FNQA 3M49A 3QELB 5ALOA 3SR4A 4RLHA 1WBBA 1NUTA 1SU4A 3G5UA 4R8SA 3MOGA 2O20A 1LPBB 5FI3A 3SFVA 2OGWA 2WKSA 2ZI3A 5AI6A 4J3NA 1B14A 1GLVA 3CB2A 4Z2AA 3HACA 4ZARA 3VPBA 1KE1A 4EB8A 1V7PC 1J22A 1VMEA 1ZA1A 2GVZC 1MX1A 1W5EA 3Q40A 4DA6A 1PD1A 3PF9A 3VKUA 2E4AA 2NZVG 3CPEA 3ND7A 1WZ2A 1PJ4A 3AEKB 1SELA 1BDBA 3S2IA 1IHPA 3QMWA 1U0FA 5LLTA 3ZLBA 5HXAA 3SY8A 2RGAA 5KZMB 1OWNA 2UXDB 3ABIA 3ESAA 3QPWA 1ISJA 5DK4A 5KCZA 3IAFA 3SQNA 1NZDA 3AR4A 2WBLC 3WC4A 2X86A 3PWZA 3QKTA 4RZHA 3TSWA 1DT5A 1JG3A 1H0HA 2OGUA 3UA3A 2KB0A 2P9JA 2WA2A 3AUYA 3JX9A 4YAWA 3W5JA 1JSCA 2PS1A 3SVZA 2A9FA 5KTYA 3O2SB 4AXBA 1STOA 3FTCA 2F3SA 1S0UA 5DP1A 4BFUA 2WP8J 4JI5B 1EBUA 3V42A 4C7BA 2ZIZA 2VT2A 1ZIPA 3MYYA 4QPZA 1R6VA 1WW3A 3I9FA 3I01A 3RT7A 1KKLA 5EXTA 3E7DA 2JCXA 4BGVA 3F6CA 2VA8A 1OBOA 1TD1A 1NU6A 3C5CA 5B2ZA 3R74A 4L08A 5IT4A 4EHBA 1FTNA 1DKPA 3CY6A 1K2VN 3C16C 2WT4A 4PTYA 3WMFA 4JYAB 3R5FA 4K86A 5DM70 1XZJA 1A3CA 3II6X 4I1VA 2GCEA 2A92A 3HZZA 3WTBA 2BEUB 3BMNB 2I2WA 3FAZA 2ZB3A 1G6KA 3VOAA 1NXXA 1QX4A 4OHBA 3OTHA 1G6HA 4KK4A 1NC3A 2P7IA 1DTSA 3QTTA 4C4YA 5IPFA 3RAGA 1YRLA 4HHEA 5BWBA 1T9AA 2VYVA 2ORED 2EDCA 3EXEB 5KCMA 1EVJA 3UMRA 1PNRA 5L4SA 3IV7A 2WHEA 2WWWA 4J6FA 1ZD5A 5E95A 5IF3A 1IC6A 1KNQA 2Z9DA 3OZBA 3ADDA 1C3EA 2NIPA 1X8LA 1ACLA 2X7JA 3PLNA 1OVMA 2ECQA 1B8OA 1W75A 1SUAA 3T3GA 1QNLA 3DMNA 2O48X 1WR8A 2GM5A 4W5QA 4ZI2A 3MRTA 5BSEA 4WK4B 4A9AA 1SD1A 2B61A 5EWJA 4D82A 4D4HA 2V58A 5CCDA 1XZFA 1IDN1 2AN9A 1BYIA 2G67A 3FOBA 2POQX 3H7AA 3LUGA 4L2IA 4U2DA 2Z1MA 3PT9A 1NXTA 2REOA 3DZIA 2PJDA 1R2QA 4Q7JB 1LDGA 821PA 3R9XB 1QZUA 2WWIA 3TQSA 1FRVA 3QKRA 4PZPA 4M9XA 5E4FA 4C76A 4QBFA 2NU7A 2GF2A 5ICCA 4FWTA 3KT0A 2VF8A 2YWXA 4LE0A 3JQEA 3KUDA 5C8YF 3CVWA 1FVHA 4IXDA 3U3RA 1RQXA 1JLMA 2P9YA 1XTSA 5IUNC 2MWMA 4PPQA 2YVKA 1I6LA 4K8RB 5DLQC 3BKXA 5T6MA 1XZEA 1QZZA 2JIPA 1FS4A 4AB1A 1KZYC 5A7FA 1XTUA 1CUDA 1PAUA 5LYJB 3VC7A 4ZVTA 5I7RA 2A1TR 5H59A 2W2TA 3T7EA 2O3QA 1XZDA 4RV5A 4ZA2A 4A2CA 2HA5A 5EINA 1CKEA 2SKDA 1U8AA 2BFCA 1FFAA 3JQ8A 4BEBA 1KZ6A 4PYOA 3HDGA 1F0YA 2PGAA 5KYXA 3L8YA 1GTMA 1DJQA 2AN4A 2NO6A 3T06B 5A3RA 1HURA 5AK0A 1JQKA 1JALA 1GPDG 3VTAA 4JJAA 4S2EA 4K05A 3BXEA 3NAQA 3AP1A 3IMGA 2IS2A 1BJTA 2W98A 1QQ6A 2QTGA 1RRPA 1GR0A 4HLDA 3BKWA 1AHIA 3W7AA 1Z2EA 2Q5OA 4ALIA 4ZYYA 5F21A 3U62A 8ABPA 1PR0A 2I2DA 2H11A 1OWMA 2HU8A 3MFYA 3MT8A 3PFCA 3QOYA 2BZSA 2JZNA 3WMEA 5EHZA 3HWX1 2J3DA 3EXAA 1RYEA 1OXBB 3A31A 2WJHA 4PRYA 4CTKA 4K6KA 5DM0A 5LL6P 2P5TB 3T3IA 2EZ8A 2YOFA 5KOJB 1U3UA 3O4IA 3W8FA 3CW2A 5FUMA 2EJBA 4HX2A 4ALKA 3P0RA 3NTXA 4I5EA 2YV2A 4W63A 3EZFA 3QEKA 1EVEA 4RM3A 1F20A 2AW3A 3MWDA 5PNTA 1R9JA 1KNXA 3K92A 1VPTA 4RC9A 4BO9A 2W6ID 5CB8A 3CSUA 1CR0A 1TCUA 5ELXA 3HJFA 1URPA 2IK8A 2N1MA 5BSUA 3A06A 1HMPA 2BAGA 4IX9A 5CDHA 1F2VA 3L7AA 5C2JB 4N8SA 1ABFA 1QRRA 2JZCA 4Q02A 4Z6KA 4LGMA 4GRIA 4S2UA 1QK4A 3FUVA 2IU0A 4WIAA 3REGA 5ED0A 1U3GA 3SICE 2XWPA 1OSNA 3M4YA 4WOBA 3GAZA 1F1JA 3WQQA 2VHUA 1SUDA 1Z0DA 1XCPA 3GEDA 1GA1A 3ILSA 1OLXB 2VP9A 4JKIA 1O95C 3NANA 4MUMA 1WMSA 1KK1A 2ZRHA 1YQXA 4QG7A 5AOAA 5BQFA 2WKRA 4KGVA 4NJEB 7MHTA 1TRKA 4E07A 5BVHA 5TMEA 3TKYA 1A8IA 2O8DB 3JWJA 2I03A 4JX9A 2R7LA 3ND5A 3EXG2 2ZVDA 3OM9A 3DBLB 3AF2A 3ZVLA 4Z9BA 5BOSB 3EZYA 1CUJA 4BOYA 2H65A 4IIJA 3IF8B 1UAGA 2FP4B 5BNIA 2WTUA 2Q07A 4YJFB 5JBIA 3PC7A 1A2BA 1BZYA 1ZJZA 4QDKA 3LNCA 1NJFA 5IJ9A 4EUNA 4OQDA 5IHPA 1UDAA 2O5VA 1XZNA 2R1UA 2H1SA 3NKFA 4RSGA 3D31A 2IPXA 4O2BA 3AESA 1TCCA 2Q3JA 4MQMA 1W4AA 2VDLB 3MK31 3DD5A 1YKGA 3GNTA 1MA0A 4OI2A 3T5MA 5JZBA 4YJ3B 1LV8A 4EVRA 3G0HA 2OHHA 4J7AA 4URFA 4GKJB 3SI7A 4ZQFA 2O2DA 2FG5A 4REQA 3C1OA 2WMOB 3ROKA 2Y4NA 5CG1A 1PFWA 2KX7A 5D2CA 3V1UA 1XNQB 1CY4A 1XAJA 1W4BA 5L8VA 3DBOB 1H2WA 2JFOA 3AJ8A 2VPYA 1P29A 4YRLA 3UAWA 3CWCA 1U99A 5B1DA 1ZKMA 3OOWA 4HWOA 1QP0A 3TQIA 3V34A 4AKGA 1HNXB 1K6JA 1OLOA 1ORIA 1LA2A 3A1DA 2WU3A 1T1JA 2E7ZA 4HS4A 3SM9A 2QM8A 4NV1A 1AGNA 3PQ4A 4D9GA 2P91A 3K2EA 4AP5A 1DAHA 4M99A 4HDMA 4XI9A 4R6WA 5COAA 3TR0A 4EELA 5CITA 1RABA 4NNOA 4GBED 5IULC 3QPCA 4MWSA 1ODSA 1CR6A 2ACEA 2ZI6A 3LPDA 4A1FA 3UC9A 4EKDA 2C1ZA 2Z9BA 2OXCA 1MENA 1W48A 1SU8A 2PR2A 3VC2A 4B6RA 2EJTA 3KFVA 1P5ZB 1Q84A 1YFLA 1HDGO 1ZN9A 3QVGB 2XB8A 4L9AA 3W8DA 3SBEA 3PDUA 1YHZA 2XUKA 1W7AA 3TQHA 1YS7A 4YRDA 1XNHA 4KWEA 2ZYDA 4C0QC 4G97A 3G6WA 5HBGA 4ZYLA 3MCWA 5JADA 3SMVA 2OHFA 4J1TA 1EEXB 1GG9A 3A9WA 3ZHQA 1E5VA 2H29A 4X6UA 2XE6A 4KPEC 1QQTA 2I29A 4TUYB 1Z08A 4W9NA 2AC7A 4B17A 1TD9A 2DMRA 5JPDA 5I8PA 1BJRE 3EHDA 4KGXA 3VHXA 2KI5A 1SHJA 4K87A 2G5TA 4H1HA 4MUNA 1RLTA 3VH1A 3WSVA 2J0SA 1DKMA 5IYZA 1XD8A 4EIWA 1N8NA 1UDWA 3W5BA 2OC9A 2OAP1 4NE7A 3HDYA 4IGFA 4FVTA 5ICEA 4OQFA 4DA0A 4XEUA 4BX3A 1KR2A 4YDQA 2HQSA 4DSTA 1Q7GA 2ZATA 5ENZA 5TRTA 3GQBA 5KNBA 3ENWA 2JGAA 3M1AA 4N5DA 4DLBA 3FF1A 3AL0C 3PNKA 3WWEA 1N6RA 1NE7A 1EDOA 4IMRA 5B12A 3CO0S 4FK8A 2Y1WA 1NKSA 2AUTA 2ZIWB 5GPBA 4PFKA 4FEYA 4LDNA 3AOEC 1VZ3A 2QHXA 4DJJA 1GQRA 2IV2X 3IR7A 1B3RA 4BO5A 1SM4A 5FUXA 4RKFA 4ETIA 3D81A 3U7HB 1SNYA 5AVWA 2C7QA 3L5OA 2P9HA 4P3NA 1TYCA 2OV6A 2WD7A 1NSTA 1FPQA 4XB2A 3TIVA 1X7YB 1K89A 3K30A 4OM8A 4BJ5A 2FF5A 4LBVA 1VYHA 3EC2A 4Y2QA 3CR7A 3KLPX 1RYMA 2W2VA 2Q2QA 2ZBEA 4IIHA 4XYMA 1DX6A 2HF7A 5TPWB 2XR1A 1DBRA 5KX5B 4O4HB 3WR5A 3WWOA 3GA5A 1HTWA 1N3BA 5JXHA 2AFRA 2F64A 2YMLA 1D0VA 5CH8A 3UKOA 1JFFB 2Q1UA 3D59A 3E2MA 3LLSA 2ZU6A 1GGFA 1VIDA 2D6FA 4DV3B 5E8RA 3QBEA 4OK3A 1RQPA 1R9NA 4XLTA 4D96A 4BX2A 3IP1A 4U2KA 3RVMA 1ECBA 4CMAA 5B3JA 3KE9A 4JR1A 3UUWA 1K0UA 1R4NA 2HBQA 3ZHUA 2J4DA 3SFTA 4FR0A 1WZEA 2EQAA 5IUJC 2JGRA 3IOEA 5HWSA 2Z2YA 2XKKA 4U02A 3ICOA 1WP4A 2A9RA 4XUDA 5IFKA 3ZU6A 4BO3A 1F8FA 3NWOA 2GCNA 2NXWA 3WL4A 4Q4LA 3JWEA 4RZQA 1QV7A 1RZRA 1L5OA 3PFWO 2Y1EA 3U16A 4RMGA 4ARAA 2VQSA 3L43A 2HLNA 3DCYA 2CYBA 3H65A 4NZNA 4WOJA 1YKSA 5EJGA 3BCHA 2I2CA 3OZCA 3Q2OA 4KMMA 1EJ2A 3N7AA 4KREA 1USGA 2DFKB 1MIHA 4E2ZA 1IQ0A 4N9WA 2Y0PA 4LC1A 4NIMA 1KO4A 4X97A 1G3UA 3RC3A 1U1CA 2OCIA 2ZJ8A 3O8LA 4UHEA 1YNOA 3LFUA 1OGYA 4Q47A 3KKOA 1M5RA 2XB2A 3ZBQA 1AZWA 1EQUA 4EY8A 2AYXA 1R6UA 1HQKA 3HCNA 3RTEA 1BMQA 4DBLC 4TT8A 2V7XA 5KUTA 5FCDA 3PF8A 5BPFA 5J1SB 3GEHA 3EB9A 4H0NA 2WAOA 2OO5C 1L9XA 2B20A 5LYJF 1A76A 3NAGA 5KDOA 1J97A 3ROFA 5TLSA 1WXWA 3K96A 3GLIE 2P40A 4JZYA 2QZ4A 5JBNA 1JEQB 3Q72A 4YJ2A 3P9SA 4F4IA 1UWKA 1KP9A 2AG0A 2BT4A 3BZBA 3K5HA 3RC2A 4J43A 3RSOA 1RAGA 4C01A 1ES9A 2VJMA 2MSDB 1BMTA 5GVRA 3DHVA 4GYKA 2IYNA 3FDZA 1TUGA 3GGGA 1N2GA 1GUZA 2Z4TA 3L06A 4I4NA 3C0KA 4QDTA 2NZUG 1KH1A 3RS3A 4DMFA 1MB0A 3ZCRA 2N47A 1ZK3A 2OV8A 2RHHA 3EDCA 2YWCA 4AF7A 2Z5VA 4E5KA 4FS3A 5EZYB 2CDBA 2XRFA 3FGPA 3ZGNA 4MW5A 5TXGA 6ABPA 3HBMA 3HN6A 3KX2A 3DKVA 1UC8A 3T12A 1UBFA 3PLRA 2AVDA 3CF2A 2KBEA 4IDNA 4OXXA 3W8EA 3ZD7A 1NY6A 1Y3AA 1SHUX 3BEDA 3DDOA 4BNKA 4F3RA 5TT0A 4PYKA 3L1HA 3PKJA 4CKBA 5FP0A 4RDCA 1W1WA 4F3YA 5IWCA 1CP2A 1I94B 4XZ3A 1O9HA 1E5LA 4PSKA 1JQJC 2A35A 1DRVA 4DUGD 3Q7TA 3R6DA 1ZFLA 2AJCA 4XXHA 3FN4A 3H4IA 3VZPA 1V9SA 4GDMA 3NEYA 4JYMA 2W7TA 5IARA 1RIIA 3T54A 1UZNA 1JDBB 2JANA 3E3MA 2XQGA 4JASB 4OUDB 2PZKA 1UBUS 1FYXA 1NW6A 1RYYA 3A1UA 3MTIA 5HQJA 2IGBA 2QIOA 3KM0A 4I9GA 3HXQA 2XA1A 1JU9A 4UOEA 1BDIA 2DTEA 1OI7A 4C87A 3CH4B 4MI9A 4WADA 2B37A 2IPOA 2IOFA 4UAVA 3ICQB 1BFDA 1KAQA 1FSZA 1PV4A 4LDPA 4PGAA 1OREA 1UDRA 2YMPA 1GEGA 2GLXA 4Q12A 2JEYA 5DSXA 3DYVA 3CLKA 1M33A 2QTMA 4PO9A 1JR6A 1KJ8A 3QVXA 4N39A 2VN8A 4QBKA 2DQSA 3TQRA 3P45A 2YCLA 3BTVA 2X15A 1IK4A 1IFXA 3QX8A 3C14C 4O2RA 3GWGA 1ADCA 3H1AA 3WL8A 5ILOA 4RMIA 4AJPA 1MAVA 1RRFA 1OKKA 2DPHA 5CNKA 5JFGA 5BSTA 4INZA 2PT6A 4M49A 5B36A 5A0TA 2BL4A 2V9PA 3N39C 5IM4F 3GLGA 4N76A 3WIOA 2QXTA 2CMKA 4JB2A 2JRLA 4ZQBA 4QEDA 3MLEA 1Y6RA 3AB8A 3LBIA 4KQWA 4BTLA 4JVSB 3MA0A 3KQNA 4RA6B 4Z7NB 1K5GA 1KSGA 2UUCB 4YALA 1M2VB 1DI0A 4MDYA 2OBFA 1CF9A 1P1JA 4RLSA 2O8CA 1U9ZA 1JIXA 4M1ZA 5D5PA 1X87A 1WUYA 2J07A 1DKOA 4ZVMA 4BXOA 1RPJA 1VLLA 1B41A 4UEWA 3FR7A 4B2LA 1U5AA 5JDCA 1GSOA 2CDCA 3PI6A 2OWEA 4UDNA 3S2FA 1N2BA 3LIIA 1VMAA 3MEQA 4U8GA 4Y3UA 3C3XA 1AUVA 1P4SA 1A0OA 5ITVA 2GJAA 3RSCA 5JCJD 2CYAA 5JD4A 4J94A 3T3MB 2WUEA 2R8PA 1QP4A 4U4AA 4G5OA 1CK4A 3V8BA 2ECKA 3GFFA 2QVXX 3CGGA 1U3VA 3K5PA 4UTZA 4NJEA 3P0HA 4R8VA 1UJBA 3QBJA 3W8NA 4Q9KA 1UBJS 2XZTA 3M2PA 4HAZA 2IPAB 4XTRA 1BU8A 3R7NA 3TDMA 4Q82A 2HNKA 1KZ9A 4JYBA 3U7QA 1A5SB 5KOHA 3K6KA 3H6HA 4J0EA 4WA7A 1KJWA 3QKSA 4BNTA 3DBVO 3TSCA 3STUA 3EDMA 4BKQA 1FDRA 2AFIE 1GVNB 1BHO1 1MO2A 1VSVA 3PUYA 5AVTA 1I3MA 2R68A 3PUKA 2PQ6A 3L9WA 3PC4A 4P7KA 4TWIA 1T0PA 1W0JD 4FJ1A 3SCZA 4B3SB 3EMBA 1O0BA 3Q9LA 4B2YA 5FBLB 2ZRPA 4ZAFA 1NC1A 3W1VA 2Q4TA 4EUKA 5AUNB 2Q29A 3F47A 2YVLA 4YMHA 1MOSA 1TW2A 3EASA 4P34A 4RXUA 2F3PA 3AIOA 2E82A 4M53A 1TFRA 1SC4A 2ZDGA 4M6WB 3RRNA 1M72A 3RVLA 3WY9A 1G19A 4NRDA 5A3VA 4AZTA 1XC7A 5J3JA 2ODNA 1PHRA 5CB6A 2J41A 1AN9A 1Y80A 2PG3A 2VT7A 3ESQA 4DC0A 1FBTA 5D6NA 1U0OC 1T4MA 1TYEB 3HZOA 2XKJE 3RYIB 1ZKDA 4U1RA 1BU5A 2GBLC 1SQ5A 1GQSA 2A67A 1PWZA 2QTZA 4KUHA 3GPBA 4Z4FA 3HEAA 1KK3A 1DOZA 1GL9B 4HDMB 3VUFA 3PRKE 4IJQA 4KEAA 2DBVO 4PYLA 4YRMA 4I46A 1OI4A 3LP8A 4KG7A 2VYVD 1YZKA 1LBHA 3VR4A 1SUCA 3HJCA 2K7FA 2M1ZA 3LZCA 1G9SA 3R5XA 2F9FA 4JHLA 4BP1A 3GLUA 6PFKA 1O5OA 5HX7A 4POOA 4KFSA 4KIGA 3MVEA 1BWSA 1US8B 4LA4A 4JVLA 2DQKA 3LI2A 3T52A 4COKA 5HKKA 1VIMA 4I1OA 1U9IA 4QOGA 1VJ1A 4F6RA 2FPRA 4RSMA 1MV8A 5F73A 4R8RA 5FLYA 1UP4A 1Z0FA 4C4RA 3VSBA 4HAOA 2LCIA 5JI2E 3KXDA 1MW9X 3KCNA 5EE5B 4J3JA 1G7RA 2ZSDA 2I0FA 3TLGA 2FMKA 2IF0A 2ZJ7A 1WXEA 2D7JA 2NU7B 3LLVA 1B8VA 1XHFA 3S8EA 4LF6B 4YROA 1FCJA 2E1RA 3E7FA 1VL5A 3ELYA 4XM1A 1AXEA 1TA0A 1T8PA 1E9CA 2JHPA 2BDTA 3RVDA 4EVIA 3B9PA 5FBRB 2QJTA 3CX4A 2VNAA 1OBHA 2J9FB 2XUOA 2DU8A 3D3NA 2QLMA 4OB8A 4XWWA 4UFOA 4H6XA 3ESBA 4BKPA 4GL2A 1IXYA 1W2HA 3AJRA 1GRRA 1YTLA 1Z6ZA 1QMPA 1GGKA 2DPMA 2ZJ4A 4HNUA 3RH0A 4LMBA 2JLQA 4F3TA 1IWOA 3HFGA 2K4MA 1PWYE 2NPFA 5IBQA 3CRVA 2WYWA 4P08A 1VMDA 4I99A 3CVXA 1DC7A 2QGFA 4HDRA 3EXFB 5CDGA 1HR0B 1QIHA 1WS6A 3OZFA 4PG6A 4RCVA 1YDGA 2X9VA 3NHLA 4XR4A 4PXAA 1UJ4A 2A59A 2BGTA 3KLNA 4HUQB 4NH4A 2O50A 3CR3C 4M1WA 1JYEA 4RY0A 4M0LA 3PL5A 4YH1A 4ZGBA 1ZRNA 1HDIA 3I0NA 2ZAYA 2R6ZA 1RYHA 3QVJA 4M8NE 5KVCA 3X1KA 3TK1A 5KTOA 2C8VA 4AICA 4F5WA 1CVLA 4S1OA 4D8WA 1C8BA 4U3JA 1CY1A 4JCOA 3ZBTA 2R97A 1OAKA 2OO5A 2X6QA 3ZOKA 4CW7A 4Z0HO 2VJMB 1Y82A 3FUCA 2DPYA 4ZAWA 4AO6A 5CVDA 3TIIA 3E3NA 2BKEA 1ZN2A 4BCDA 3BB4A 3VPAA 3HMKA 2BFBA 3WISA 2ZEJA 2I34A 3PR1A 4BWGA 2QLFA 3V2IA 2F1OA 3OLYA 3N59A 4A26A 4P8RA 2GRJA 2EP8A 1E60A 2XUZA 2XZPA 3VYRB 4YNBA 2IYTA 3CQ9A 1FPMA 3HVHA 1T2DA 1O57A 1PGQA 1G3IA 4K7JA 4J7XA 2JAHA 4RFLA 1KP3A 2CFTA 5EI5A 4MSUA 3K1AA 4NDNE 5TV2A 5F64A 4TT3A 4AP9A 5E9WA 2CNKA 2A9QA 1N9GA 4TL7A 2GVNA 1CFJA 3S81A 1JDTA 4Q1VA 1P8JA 1HMYA 2IY7A 3BXFA 3SYTA 5JE8A 3N74A 4DIUA 3D4IA 5T67A 4TMVA 4BLPA 3IV9A 3GY0A 1K86A 1NL3A 1MGOA 2CLSA 2JJ1D 3GBPA 3L92A 3TEMA 3M9LA 1A5BB 4FFWA 3EUWA 5KKAA 3ZY4A 5IXYA 2YOHA 4FDAA 1CVRA 3BTUA 3LZ6A 2R751 3A9RA 4XEHA 1XXHE 3CVUA 3L8GA 1YA8A 3S2GA 2H8GA 3LPAA 2DCUA 3NTVA 4FYVA 1KMNA 2GYVA 3GR6A 4MVJA 3VSDA 1GTVA 4BFSA 5ADUS 4FSXA 5K0NA 1CP3A 5EZ5A 2YICA 2I33A 3BGIA 5K8CA 4EI8A 1CF4A 4OGKA 1EFTA 4LN1A 1FU8A 4IO0A 1G3QA 2X8WA 1QG0A 2AC2A 1NFRA 1NV9A 4GBGA 2QI9C 3GLFE 3X2FA 2FXIA 2R4QA 3ZWVA 1K2WA 2FR1A 2PX5A 3DDSA 3WGOA 3HV2A 5L45A 3BVPA 4I36A 3PVZA 1SKAA 4OAPA 2PPLA 1G2PA 4M88A 1VKNA 2ZIEA 1A7UA 3QEAZ 2ZREA 3V9AA 1W2GA 1YCGA 2WSSA 4YJ2B 4CDRA 4GSYA 5DNCA 3EQ8A 4H1VA 4P53A 1AKWA 5DXFA 3M6IA 1WV0A 1KJNA 1YH3A 2XSZA 2ZG6A 3EQ2A 3M0EA 4OHVA 1S4MA 2Q7XA 4TLLB 3RUEA 1JLHA 4OL9A 5H9WA 3H19A 4E15A 3RC8A 2ZUEA 4PE5B 4BNGA 5JS7A 1U5BB 1KJQA 4NVRA 4UDOA 4A5SA 5LD2B 3IHLA 4HB0A 3E48A 5KYYB 3Q7QA 1K0FA 2Q4RA 4JV5B 3GDFA 3SZUA 2RGDA 2CFRA 3KT8A 3LDAA 3BE5A 1ZOOA 1RJFA 1UPXA 2Z95A 4KN9S 3KWLA 4WDRA 2BFAA 4MLDA 1JLSA 3FHCB 2CHEA 3H2YA 4LECA 2WG2A 4JP5A 2UZIR 1Z4MA 2YUIA 3EWNA 4GZ6A 2CV2A 3G79A 4LJ9A 2J67A 4BJ3A 4DCSA 3GN2A 2DWCA 3EVTA 3EOAI 2QZPA 2CJFA 2VPQA 4B3FX 3LWBA 5FV7A 2QTVB 2BMWA 3EGCA 5ECYA 1A8SA 2GYWA 4B6SA 2GYYA 2FWJA 3WBKA 3QE3A 2PEYA 4JQYA 5CDUA 1WTAA 2J9GA 2X5XA 4LZAA 3V7UA 1M1ZA 3NHSA 3KR2A 1E5XA