3G2QA

Crystal structure of the glycopeptide n-methyltransferase mtfa complexed with sinefungin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
267
structure length
247
Chain Sequence
GPVRTPHADVLLASVGERGVLCDFYDEGAAADGTSEAREFATRTGVSGPVLELAAGMGRLTFPFLDLGWEVTALELSTSVLAAFRKRLAEAPADVRDRCTLVQGDMSAFALDKRFGTVVISSGSINELDEADRRGLYASVREHLEPGGKFLLSLAMSEAAESEPLERKQVLHVRHLPAEEIQEITIHPADETTDPFVVCTHRRRLLAPDQVVRELVRSGFDVIAQTPFASGGAGRKDMVLVEAVMPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Transferase
molecule keywords PCZA361.24
total genus 68
structure length 247
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1040.60 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3g2qA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3g2qA02
1AQIA 3KR2A 4BLVA 3Q7EA 5D1NA 1SQGA 3BT7A 3EVGA 2H11A 2BR5A 3I58A 4DMGA 5B1SA 3PLAE 2NXEA 1VP9A 3CBGA 3ELUA 1AQJA 3EVFA 4YV0A 4LWPA 1RI5A 3UJ6A 1I4WA 4EKGA 1QAOA 1NW5A 4EMSA 3SGLA 4DZRA 3B3JA 4QQKA 3SXJA 3AXTA 4DM3A 1UFKA 2NP7A 3DUWA 5CVUA 4RVGA 3P71T 4P7JA 4QDKA 2G70A 5U4XA 5F2KA 5FA8A 3GCZA 3NVMB 1PRYA 2NNWB 2P3LA 2JJQA 4LWOA 3NTVA 1P91A 2A14A 3AY0A 3HP7A 3FZGA 5CVEA 1X1CA 1NBHA 1L9KA 1V39A 5FQOA 4AZSA 3O31A 3E23A 3SMQA 4FS8A 3KPUA 3LDGA 2AN4A 1XDSA 3T7RA 4RSRA 2ZZKA 3G2PA 5K0EA 4DKJA 1NW3A 3GWZA 4BP3A 4C05A 4E2ZA 2YTZA 4GQBA 4RVDA 3B89A 1M0EA 1EQAA 2PSSA 4QQNA 4R8SA 5EHIA 3I53A 5K0CA 5LQCA 2YXDA 5ICGA 1NV9A 3EVZA 1L1EA 2P8JA 2PBFA 3UZUA 4EKIA 2ONZA 4F85A 1RJFA 4BLWA 3DULA 4P7KA 1G60A 3RW9A 5T64A 3TPZA 3EVAA 2JH9A 2OZVA 3NWBA 1ZKDA 3FUUA 1O54A 2UYOA 4RTLA 4H0NA 4RX1A 3GXOA 3P2IA 2IBSA 2BM8A 3BWYA 1JG4A 2VZ9A 2ZTHA 1H1DA 2KW5A 3ANXA 1TW3A 2CWWA 1DL5A 3BGIA 3NDIA 5CVJA 1SUSA 2ZCJA 2AVDA 2B2CA 3DMHA 3LDUA 3M6UA 1NT2A 1O9HA 1SQFA 3KR0A 2PT9A 3LBYA 4C07A 2ZIGA 4F84A 5JR3A 3LECA 2NP6A 4RTQA 1I1NA 1Z3CA 3IYLW 4IKPA 2GA9A 5EMJA 2HTEA 4QPPA 1X19A 2ZW9A 1I9GA 2ONYA 5DT2A 3MGGA 2I62A 2O57A 3VC2A 5LQNA 3HNRA 1P1CA 4CTKA 2HWKA 2CL5A 2G71A 5GIOE 2GAFA 1JTFA 3BWCA 4A6DA 2IH2A 2IH5A 3ELDA 4JXJA 2YXEA 5K01A 2PY6A 2QRVB 3HA5A 3DOUA 3PT9A 1XJ5A 4M37A 1M6EX 2UYCA 3JWHA 1EJ0A 3G2MA 3A4TA 5JUWA 2IBTA 3FUXA 1Q0SA 3OE5A 5ERGB 4FT2A 5FHQA 3BWBA 2AZTA 3HA7A 3OCJA 1R00A 4KWCA 3HA3A 4XCXA 4HGYA 3U81A 3PB3A 4YUVA 4HRAA 5E2BA 5FULA 3LDFA 4FR0A 1RJGA 2P7IA 2HNKA 3FRHA 4E2XA 3G2OA 2IDKA 3O4FA 3MHTA 2ESRA 2I7CA 4LECA 3RODA 3SVZA 3LBFA 1L3CA 3B3FA 3A26A 3I64A 2ZWVA 2VDVE 5EIWA 5T6BA 3SM3A 3V97A 2P7HA 4GOMD 4HTFA 1ZGJA 1ORHA 3CJRA 3G8BA 3TKYA 3LKZA 2ZZNA 2AOWA 1WG8A 5HIMA 5FQNA 3HCFA 1FJXA 3UA3A 2B25A 3GDHA 3X0DA 3BWMA 4X41A 4EVIA 1P1BA 3E05A 1ZQ9A 4U7TB 1SG9A 3B3GA 2FPOA 2O07A 3KQSA 3A7EA 1WXWA 2BM9A 3ME5A 3ORHA 2ADMA 2V74B 3KPJA 3MTIA 4R6WA 5DTQA 5EKXA 3C3YA 3GGDA 4RV9A 4YV2A 2ZZMA 3TKAA 3FYDA 3BKXA 4R6XA 4ER7A 1AF7A 4OQEA 5HIKA 5GIPE 2PT6A 2ZULA 2I9KA 1D2HA 5DLYA 4HC4A 4IV8A 4MTLA 4OA5A 3CC8A 5P8WA 2HMYB 1SVUA 1NW8A 3M6WA 3P9KA 2YQZA 5BW4A 1IXKA 4M36A 2XYVA 3ER8A 1R74A 1KPGA 1IY9A 1JG1A 3VYWA 3P97A 2JHAA 2OKCA 3R3HA 5F2NA 2VDWA 3FTFA 3IHTA 2PVCA 3OU2A 4KDCA 1AV6A 1KYZA 1IM8A 2DULA 1R6AA 4GEKA 2F8LA 1ZG3A 2NXCA 5EQJB 1VL5A 2EFJA 2WA1A 4AZWA 2QM3A 5CVDA 1JR4A 3R0QA 3R24A 1KPIA 1UWVA 4L7VA 3G2QA 5HIJA 4UOEA 5ICCA 3FPGA 4MIKA 1TPYA 3TM4A 5HOQA 4NECA 3AJDA 5ICEA 4YUWA 3EGEA 3THRA 3FRIA 1HMYA 3HCBA 3TM5A 3P9NA 2PX2A 3T7SA 2JG3A 4Y2HA 3G8AA 4RTMA 2JHCA 3LCCA 3NWEA 4O29A 3TMAA 1HNNA 4FSXA 4PYKA 3GU3A 4B17A 2NYUA 5ICFA 3LX6A 3B5IA 4KDRA 4ER0A 1N7JA 2C7PA 4KRGA 4RVHA 3QV2A 5DTMA 3VSEA 1KIAA 2C7OA 5FUBA 5CIYA 2FK8A 2PXAA 3JWJA 3KU1A 5HEKA 4DF3A 2AN5A 5EGSA 4YMHA 4GOND 3BKWA 3EMDA 5E9QA 5CCXA 2UYQA 4QVKA 1YUBA 3T0IA 4BY9E 2IDJA 3T7TA 2GH1A 2QE6A 3CVOA 1JQEA 3R6TA 4QDJA 2OBFA 3KR1A 4ER6A 2G1PA 2P3OA 3MCTA 5DSTA 2XYQA 1QAQA 1D2CA 4A6EA 1X1AA 5EPEA 3KQPA 5FWAA 4CWAA 5EMMA 3GRYA 1FPQA 4HG2A 2AOTA 2O0LA 2ZSUA 3BUSA 3HVHA 3UJDA 4BP1A 1NW7A 3LHDA 5CD1A 1OR8A 2P3QA 3C6KA 4OA8A 4QTUB 5IKMA 1B42A 1WY7A 4R8RA 5K05A 2EX4A 3KPWA 5K0BA 1QYRA 1YB2A 2B9EA 3UJ9A 2ZIFA 5GM2A 5LR6A 1YF3A 4CKEA 3OZSA 4C08A 1XCJA 1WZNA 5DX8A 4DA4A 2PLWA 2OB1A 5DWQA 5DRYA 3VC1A 1D2GA 5BW5A 3P9IA 5E1OA 4C04A 5H02A 2CKDA 3JWIA 5DTRA 2BR4A 2UZ4A 4CXMA 4P7FA 3BGDA 3DLIA 5G02A 3PFGA 3FYCA 2ZLBA 1JSXA 3KQQA 3OU7A 1G6Q1 3RIEA 2ERCA 4C03A 3OU6A 1N2XA 3TLJA 4V0RA 3KHKA 1NE2A 1NW6A 4M7RA 4E2WA 4GC5A 3IV6A 3K0BA 4IWNA 3GRVA 4AZTA 4FSDA 1FP2A 4X60A 4E32A 2Y1XA 3BXOA 1F3LA 1L3BA 1X1DA 1XVAA 2P40A 5HFJA 4YUXA 4RTPA 2GPYA 5EZQA 5HIIA 5HZMA 2O06A 3R9XB 1RI2A 2GS9A 3M70A 4ER5A 5EMKA 1MHTA 3DXZA 1R8XA 3DXYA 3EMBA 5E1DA 1RJDA 5FADA 3SX0A 5BP7A 3QOXA 1RI4A 5LQJA 2ORED 1VPTA 2PJDA 3ERCA 3K6RA 5IH3A 3G89A 4KIFA 3GNLA 3MB5A 4GC9A 5KVAA 1FP1D 2OY0A 5E9WA 4PYIA 2R3SA 1BC5A 3G5LA 5E1BA 4E70A 3UJBA 2GLUA 2G8NA 3UJ7A 1ZHFA 1G38A 3O7WA 3PS9A 4DCMA 3E8SA 2ZIEA 3PVCA 3PX2A 2VDUE 3GRRA 3KQTA 1RI1A 1BKYA 1G8SA 2AS0A 3LKDA 5EZSA 2P1DA 3UJAA 4KW7A 3LSTA 3ID6C 5EG5A 3OZRA 1BHJA 4FGZA 1KR5A 3DXXA 5FWDA 2Y1WA 5EVJA 2FHPA 3FUWA 3PX3A 3FTEA 2EG5A 4GF5A 5DM0A 2PXXA 3A27A 3PFHA 3E7PA 3HCEA 4POOA 3GO4A 4WXHA 3M4XA 4ATNA 1VQ1A 3GRUA 1KP9A 3KPYA 3KKZA 5DPMA 3FPJA 5DM1A 2JH8A 4AX8A 3IEIA 1KPHA 3SSNA 4XUCA 1VIDA 3HCCA 2QRVA 4F86A 4HH4A 4OQDA 2EJTA 5E8RA 5FA5A 1KXZA 1NBIA 3C0KA 5LQKA 5K0JA 2ZBPA 5E1MA 2K4MA 4GBED 3SSMA 3HVIA 3EVEA 2DPMA 3C3PA 3EVCA 4QTTB 5BXYA 1VBFA 3NJRA 2P41A 3B7PA 5FHRA 5GM1A 4M38A 3UWPA 2BH2A 3THSA 2NXJA 3NW9A 1BOOA 2PWYA 3HCAA 3KQMA 5E9JA 1QAMA 5EIFA 4G56A 5DXAA 3UJCA 4RTNA 2OPBA 2VP3A 3FPFA 3NMUF 9MHTA 3P2KA 1DCTA 3P2EA 4C4AA 5DM2A 3CJTA 2IIPA 5KYGA 1JTEA 4P58A 3LCUA 2QY6A 3FPHA 3ELWA 5D1HA 5K0FA 1G8AA 4YV1A 5FTWA 4AUKA 2AVNA 3V8VA 2PXCA 3NDJA 4C06A 3I9FA 3AXSA 5DX0A 5HILA 1KHHA 2HR1A 2B3TA 2PV0A 2AOXA 4EQZA 2R6ZA 10MHA 8MHTA 5C9ZA 3H2BA 4X1OA 2XVAA 3SSOA 1TW2A 4WVLA 3WSTA 4PYQA 4V0QA 1QANA 1VP3A 4PIMA 3DR5A 4HSGA 2V7EA 5CM2Z 1DUSA 5F2OA 5K03A 3CKKA 2N47A 2YUIA 3KQYA 1SUIA 1NV8A 2H1RA 1JQDA 1ZGAA 1JQ3A 1INLA 2WA2A 3DTNA 3EEYA 4PIPA 5EC8A 3SR4A 4PYJA 1U2ZA 1MJFA 1WXXA 3I5UA 3DLCA 2AN3A 3OPNA 2JHPA 2ZFUA 3GRZA 2IH4A 4YUZA 4PYOA 4ER3A 3S68A 1UIRA 2FK7A 4DQ0A 3HTXA 1WS6A 2IFTA 2IGTA 5EOVA 1T43A 5E8JA 4E2YA 1FBNA 2YR0A 3EGIA 3OFKA 4X61A 3TR6A 1XDUA 4GOOD 4YMGA 2ZWAA 3OZTA 3KPVA 1R8YA 3TOSA 2ZVJA 4PWYA 3HCDA 2CMGA 4Y30A 3CGGA 4DCGA 3M6VA 4XUEA 2AOUB 2H00A 2O05A 4MQ4A 4MWZA 2OB2A 2YVLA 3F4KA 4Z2YA 4X63A 5K0NA 2PX8A 3D2LA 1SKMA 5FCDA 4QVGA 3UJ8A 3UBTA 3KQVA 2QYOA 3TRKA 4PGHA 4PGGA 3DMGA 4RWZA 3C6MA 1EJ6A 3MQ2A 4IV0A 3OE4A 3LL7A 5CVVA 5DXJA 2EJUA 4ZTBA 3EVBA 1X1BA 2Z6AA 2PX5A 1RI3A 1RJEA 3MCZA 3TFWA 2YX1A 3DP7A 1EAMA 1PJZA 4CTJA 2PKWA 5MHTA 5GWXA 3REOA 4BLUA 2Z6QA 4U7PB 5DRTA 1JG3A 3P9CA 4LG1A 2IP2A 2ZBQA 4QPNA 2FCAA 3FTCA 4ISCA 3BZBA 1XXLA 3PTAA 4YUYA 2CMHA 3L8DA 3M6XA 3MAGA 4RTJA 2VS1A 4CKBA 3OFJA 2C7QA 1YFJA 3KR9A 5T67A 2Z6UA 2G72A 1JSZA 3EGVA 3DH0A 3HEMA 1N7IA 4GUAA 5M5BA 2FRXA 3ER9A 2GB4A 3HM2A 3M33A 7MHTA 3ELYA 3MTEA 4GOLD 4K6MA 4PYNA 1O9GA 3JWGA 4RTOA 1EIZA 2BR3A 2OXTA 3FUTA 3GIWA 2B78A 1L3IA 5GOZA 4RYLA 4R05A 4EK9A 4OX9Y 1YZ3A 2AOUA 2FYTA 3LGAA 4RTKA 2PWPA 1P39A 2OO3A 2P35A 4PINA 4KVZA 1Y8CA 2AOVA 5K0LA 3UFBA 5KQSA 1M6YA 3EEOA 4HTFB 1XDZA 1JG2A 1F38A 1YFLA 5LQRA 5C0OE 5KQRA 2YXLA 3HVKA 1KYWA 1ORIA 2IPXA 3HVJA 4XUDA 4OBWA 4E33A 2NXNA 4PCAA 5CUQA 3CCFA 5DX1A 3FUVA 3G88A 1XTPA 5EKUA 5LSAA 4PYLA 2WK1A 3TQSA 3A25A 3Q87B 3KQWA 4CKCA 2BZGA 2E5WA 4RTSA 2HV9A 3QOWA 5EEGA 4FT4A 3DMFA 3EPPA 1Q0TA 1VLMA 3P8ZA 5CCBA 1YZHA 3G7UA 2PX4A 2AR0A 5EMLA 1VE3A 4E30A 3AWIA 2PGXA 4FZVA 2XBMA 5K09A 5K8VA 5DSXA 4E31A 2AOTB 1R18A 5GINE 5E2AA 2I6GA 4PONA 3FPEA 4PNEA 5K0GA 2C7RA 5GP1A 4MHTA 5LQAA 2Q41A 3EVDA 2LD4A 3KQOA 4PCLA 2XYRA 2XVMA 3GJYA 3LCVB 2OYRA 2ZBRA 1QZZA 4RTRA 2UYHA 3CJQA 4P7GA 3UA4A 3MERA 4AZVA 3FTDA 3NVKI 4FP9A 4RVFA 5LQUA 1G55A 5EEHA 3BGVA 4OBXA 5DM4A 3G5TA 3LPMA 1EG2A 5EHGA 4PYMA 5C1IA 5KS2A 4HGZA 3A7DA 1XCLA 4KIGA 1NKVA
chains in the Genus database with same CATH superfamily
5D8DA 3SXUB 3E5NA 1VLLA 3SQWA 3DEKA 3O8BA 2NVUB 4X1KA 3RBXA 5D5HA 4A5SA 2AC2A 5LN1A 1JHVA 1GZSA 2F00A 2Z9BA 5B1SA 3F67A 3ELUA 3BZUA 3HBMA 4Q34A 4FZRA 2EV9A 3EDCA 4UCFA 3AY6A 4CUJA 4ENSA 4IIHA 3OFVA 4L9SA 4DWJA 2JBAA 2HPAA 4YC7A 4F9FA 3F71A 1RZ3A 3G9ZA 4I1UA 3URKA 1PQPA 5CVUA 1E6MA 2G4LA 2LW7A 3C1AA 2O8FA 2DU8A 3U4IA 1IBLB 1JQAA 2JCBA 3GP8A 1A97A 3CFYA 2YWGA 5U4XA 1XA3A 2JI9A 1W0JD 2RCNA 3UAOA 1E9EA 1I33A 4J91A 1H42A 2JJQA 2ZK7A 3DO6A 4LWOA 3TBKA 3A10A 3KVRA 1RC8A 5JVDA 2QRJA 1YKFA 3ZGZA 4ZVLA 4IP0A 3GXBA 1J42A 4LCBA 1ZA2A 4LQLA 2QTAA 4IIFA 3U39A 2AHOA 1POXA 1YI0A 2HXYA 1OX4A 2W2VA 1MJGA 1XDGA 2CVPA 1JA0A 2Y0EA 2E89A 4N5NA 2PU7A 2IOHA 1XDSA 2EW1A 2SECE 4LDAA 3M6MD 2GD1O 1W94A 2EX1A 1A4RA 2NUAB 1NW3A 2ZTMA 4IGAA 4OOFA 5J4YA 5TGZA 1CIPA 1ADCA 1OMOA 3KEQA 1L5SA 5GGYA 4DJ5X 3ZWMA 3H83A 4XWAA 4G8CA 4E13A 1ZI8A 2Z30A 1A8PA 3QXJA 4NY1A 4A2CA 3VBEA 4BOYA 3R1IA 1NV9A 2REQB 5E6RB 3OLZA 4YCNA 1ZOLA 4MDFA 1Y8QB 1J2TA 4IQ8A 4BE4A 3GCGA 4G3XA 4F21A 1HSOA 1MIOB 1OHHA 5BQXA 5T64A 4TX1A 1NQWA 3UAXA 2WE7A 1BMDA 2Q99A 1OIVA 3DAHA 1XYVA 2GXSA 1MPTA 1N8NA 3MINA 1VIYA 4KE6A 3H9CA 1UH5A 1QR2A 3OOHA 4NCBA 3CVXA 2QN1A 3LH5A 1NBMD 5CFRA 4PGFA 2X15A 3I9MA 3M6UA 2OFXA 4K46A 4B3GA 3L7MA 3VPDA 1K68A 4G0UA 1MB2A 3N76A 1SUPA 4YMUA 4RTQA 1DBIA 5JNWA 2YMQA 3OPXA 4IKPA 2A1UA 5FLXA 1OBCA 1RDFA 4WLEA 3MJ4A 3GFPA 1X1RA 5ALLA 2FQWA 2OXFA 3OCVA 4IMIB 3RC3A 1DPFA 1DUVG 1R6VA 4DGSA 1RXWA 2CN1A 3OPVA 1YACA 3JWPA 4JVNA 1XA0A 2C2BA 2J5QA 4R1UA 2Q7XA 2B1JA 3BMNA 2IH5A 2Q8QA 1CQXA 3NB0A 4Y0AA 4R16A 1SCDA 1XRMA 3P94A 2A1TR 5A71A 1MO5A 5FWNA 5DGCA 2IBTA 4HHEA 3UWPA 3G9QA 4NARA 4Z9YA 1TM7E 2X2OA 5KREA 1VDZA 2XNDD 4QODA 4F3YA 1ATZA 4DLUA 3UWSA 1M1YE 2P6PA 1CW2B 4UM8B 4FFNA 3AZQA 3LMKA 4IEIA 2LRHA 3FBTA 4K9PA 1WWKA 2IHJA 3RODA 3RG2A 1LI4A 4YJ3A 3SVZA 3V2GA 2NXWA 4MCIA 3JQCA 3G0IA 4DMFA 2A35A 2OK8A 2ARKA 4LX0A 2WIFA 4TV9F 3RI3A 4BQQA 1A8SA 4CM3A 2D1RA 3UATA 4OP1A 4CM9A 4CN9A 1Q22A 2P9HA 3E9MA 3BFJA 3UMFA 3TNYA 1TQ6A 1QGYA 2Q9UA 4QO8A 4ZFNA 1W7AA 3MD0A 5EN4A 1I1QB 4JKYA 4E5PA 5CB6A 3GOQA 1JHXA 4AFNA 4FDAA 2GKSA 1A8UA 2GJAA 2ACWA 5DXFA 2WQZA 4AY4A 2AK3A 5ICSA 1V48A 2QTBA 4HADA 4HR7A 5KNDA 3FPBA 4YV2A 3T94A 3TMYA 2ZUSA 1BX3A 4B6RA 4KN8A 4V1CB 5GIPE 1E1RD 1JDSA 1UC9A 4OA5A 1ZJYA 1T0BA 2CC2A 2R47A 3MCUA 1P9RA 3GJXC 4LJYA 5HCNA 3OJEA 4CL3A 1NBME 5AM0A 1NLZA 5T41A 4EJSC 1FX1A 1J2EA 2B7CA 2YHAA 4OH7A 3VYWA 3KB8A 3ZDZB 1XX6A 2EBHX 2J3LA 3FTFA 3ZNNA 1RMQA 2X41A 3M4YA 5DHPA 3ZIAD 1NQOA 1Z5NA 3NM6B 4I19A 4AXBA 1CUJA 4UEOA 3LUPA 1J7JA 1QS0A 3A6EA 1ZJ6A 3HP4A 1N0UA 1WDLA 1UWVA 4RIIA 1QE3A 4QPJC 4YP6A 4MIKA 5G0WA 4TS9A 1SHKA 2VLBA 4YO8A 2C57A 4OHVA 5C3MA 2YZNA 2VDOB 3HUUA 5AXBA 4ALMA 1XRNA 5JAOA 3BK1A 5HF5A 1E5QA 1FMCA 3IP9A 2JDIA 4BVBA 2H1OA 1ACLA 1II9A 1V2GA 4LI3X 3LCCA 1JLRA 4PYKA 3UFXA 3I5MA 3L5OA 3PNPA 2JBHA 5JC8A 5HFAA 4ZO7A 4Q9DA 3R76A 3TTUA 1IK4A 1C0KA 4KPFC 1VCHA 1P81A 1ZIYA 4RVSA 5FUBA 5E4YA 4RPGA 3KU1A 3V6MA 4HNAA 4DHEA 4OHUA 1BROA 1Q7EA 1GG2A 2VO1A 2XVZA 4K03A 1VG9B 2AWNA 2M1ZA 2FZEA 4LDNA 3A4VA 5DIZA 1M2FA 5ECYA 5AKHA 1U6JA 1MN6A 3T0IA 2IDJA 2PQ6A 4GMDA 4JI8B 4B40A 4ACAA 1HZZC 3Q15C 2Y71A 2C9OA 3CIOA 3LA6A 4EHDA 2CXNA 5H68A 3TZCA 3FMIA 2G1PA 4LZJA 3LZDA 4QGHA 4F1WA 3JQAD 5EPEA 4N6NA 4YRDA 3ZWCA 4JUDX 2FEXA 2A5DA 3H8JA 4DXAA 5K2MA 3OF2A 1UINA 3MF4A 4JZYA 3CTPA 1DKOA 1ZK1A 4BTEA 2ECFA 4YFVA 1VG8A 2GNPA 3DZFA 1DCFA 4UEKA 1F9AA 1WUHS 1MB0A 1M75A 1YVEI 2MINA 2PDAA 5DNWA 3LHKA 2FFAA 1UEIA 3IV9A 3Q11A 4WOKA 4TXNA 4C08A 2CE7A 4FEYA 2NU8A 4DA4A 2NYRA 5KYXA 3K8YA 3LUKA 2KLHA 2VRWA 4JVLA 4GL2A 5JS6A 1FQOA 4W9NA 2ILTA 2OBLA 1WVIA 2M2IA 1G18A 4D96A 5H02A 1HI9A 2ZRNA 4J1TA 4C2AA 1GDTA 4P7FA 1ZVJA 3VOBA 4F38A 3H5OA 4Q6BA 4XX1A 5K3AA 2C0QA 1C50A 1H3FA 4N76A 2ZLBA 2H5IA 4CM4A 1Q77A 5J2UF 2RG7A 3VO9A 1C2YA 1Z75A 4G25A 4UE6A 3RVKA 2RK6A 2WTEA 2WD7B 4LC9A 3Q9NA 1YU9A 4E2WA 2Y4OA 2HEGA 2LDBA 3GVIA 4D6PA 2MJLA 3RKUA 1R16A 4JI0B 2W2LA 2WUVA 2JLYA 2HBRA 3JQFA 1C1XB 2UXBB 1HE4A 4D8YA 4N7MA 1W49A 2P40A 4L6AA 3G1WA 1SCIA 1YAHA 3JD2A 4ASUD 1GUAA 4EELA 1OLSA 1I4LD 3I2KA 4IVRA 2V45A 4RLQA 3DXYA 4HQKA 1KEVA 3JQBA 4KP7A 5J4LA 3TAHA 2C54A 1JEOA 2FSHA 4IDQA 4TRJA 1VE1A 2Y27A 4NWIA 1PJ4A 2YL2A 1XLWA 4XOUA 2Q5CA 2C8JA 1EP1B 3JS5A 3DZBA 3OUUA 4UEWA 1K6XA 2A2ZA 1VM6A 5EWLA 4EY7A 1CR6A 2J9GA 3E9RA 2E55A 4QASA 2CFOA 5AI0A 4AY2A 2FGKA 1GLVA 3VR3A 2XB2A 3RD5A 2AS0A 4EJSA 1NJ5A 3LXMA 2OHGA 2YRXA 1QPGA 3TLBA 3IQZA 4ACBA 3UBMA 1PKXA 4EL5A 5EG5A 4KQGA 4DCSA 3UWMA 2B7BA 3KNZA 2YMPA 5I5GA 3VR6D 5C5IA 2A8YA 3P4XA 4F1KA 1L6RA 4KQJA 3MMSA 1R4NB 2JGAA 4E09A 3BL5A 3CONA 3MXTA 1KK1A 4IF4A 2AD1A 1LVUA 4NS4A 4YAWA 3V4ZA 5TIIA 2Z2XA 4UMEA 1TTPB 4TZ6A 5I8PA 4S1PA 1QF6A 1W0JA 1GO2A 1T8PA 2Z2ZA 3DE5X 1QQAA 3WWZA 2F1RA 221PA 1DT3A 4ZVPA 3T7IA 3G79A 4WOPA 4XUCA 4ZQCB 2BMWA 3I6BA 4WUTA 1LTKA 3CR3C 4QUGA 1Z08A 2APJA 1CY0A 3BRSA 4DLYA 3NHPA 3C48A 4B4UA 4BNIA 1PVDA 2ZBPA 5DYIA 3AVQA 4FWIB 3EVCA 2MU1A 3F74A 1NFRA 2JJ8A 4UVDA 4QFCA 5ETJA 1RYYA 2C4UA 2O2YA 4RPKA 4C6RA 4G56A 5KKAA 3HP1A 2CXQA 4TQ9A 1Z4QA 5CDFA 5LYJA 2R8BA 3CN7A 3AG5A 3AMVA 4JOBA 1NAHA 2GXUA 3K0EA 5CLIA 2IIPA 1AH2A 3HACA 3LCUA 1SBQA 2FZVA 2FTKE 1A9OA 4QBGB 3KJQA 1A27A 2PRSA 3RPEA 4MQ5A 4C0XA 2C4WA 5EP3A 3ESCA 4HVTA 2O6HA 2AMYA 5TT1A 4JU9A 5AW3A 2HR1A 2V7UA 4EQZA 4RVCA 4DJDC 2GO7A 2C8KA 4J29A 3MMZA 4GHWA 3AFNA 4ND4A 4AWBA 2R8XA 3H65A 3SPXA 2VHTA 1DUSA 1Z5PA 3OMLA 4UU1A 3DE6X 4DDHA 3A1EA 1K5HA 2L0XA 3D7LA 4RDHA 4V3BA 3HDGA 1ZM2A 2VJLA 4EF5A 5BN5B 1D9XA 4TYPA 3U4HA 3QPDA 3DLPX 2AN3A 1CZOA 1HEUA 2GPWA 2RBEA 3LC7O 4QDXA 3ONDA 2IH4A 1CY1A 1HGXA 1PNQA 3W5VA 1U81A 1KSGA 1P8AA 3SQMA 5DLDA 3KBOA 2IY9A 2XDYA 3EGIA 1ULZA 3MYYA 4E2YA 2QEQA 2ZYSA 3FTPA 4HH3C 4HAZA 3OICA 3RRYA 4EPYA 1B8OA 5J2TB 2FPWA 3OZTA 1JP7A 1MT0A 4GM0A 4RQAA 4YDSA 1WL8A 4GR4A 4EA6A 4PWYA 2V4MA 3B51X 4J16A 4EHFA 3O92A 4MO9A 1MPXA 3CW8X 5DHQA 1M7BA 4OPMA 2QLNA 1U4OA 4ZCRA 5EIXA 2JGKA 3QNMA 5AR1A 5H59A 3EXG1 4ZTUB 1RCFA 3UWOA 3KS9A 2WKWA 1D1SA 1M2VA 1I2AA 3IMGA 3VJMA 4AF7A 2UVDA 1I7PA 3MBKA 3PEUA 3E7XA 2A5JA 3QYFA 4JR2A 2VPQA 5DNEA 4PGGA 3RWOA 5AW8A 4HH1A 4IEFB 1K88A 4YCAA 1Q3TA 3MLBA 3PZBA 5DXJA 5HTKA 3S81A 1U94A 1DT5A 4NJEA 4TWZA 2N9UA 4QYXA 2IZ0A 5ALWA 4AUEA 1XJCA 1B73A 5AVVA 3G6KA 2ZI5A 3ST7A 3ZKWA 1JG3A 4HUJA 1L5OA 4KFUA 4ZCMA 1XMPA 1MOSA 2ZBQA 3SE0A 5ITSA 1MXHA 2WFLA 4HWOA 1Z07A 2Z0MA 2I2AA 4O0MA 4BKRA 4EX6A 3IQHX 4JSYA 4YUYA 3EC2A 2ONJA 2OCGA 4XQGA 5SZJA 3CGWA 1H0SA 1RYFA 4CG0A 2A7XA 2C7QA 3T5DA 5CTAA 1O5OA 1TU4A 3D7SA 1WUIS 3TVTA 3OPYI 1GY8A 3NC4A 5CHEA 2REOA 2Z1MA 4GZMA 2WY2D 5AJWA 5M5BA 5FLEX 4E3ZA 3ZYCA 3PFCA 1N8TA 2GB4A 3QWBA 5HX7A 3H0EA 7MHTA 2Y1LA 5EHZA 5JOQA 4DA9A 1Z6PA 4MVJE 1O9GA 3TW6A 2DT8A 2F3QA 1JEYA 3FCYA 3PCTA 4UZEA 3RBVA 1S96A 4ZRDA 1XROA 5FORA 3SKVA 3CUYA 1HF3A 2JFOA 4ZI3A 1Z7GA 1T6XA 1BEZA 1U2QA 1Z7EA 5TNXA 1KVUA 3Q5EA 1RPJA 1ADFA 1Z5ZA 5FB3A 1UZLA 3W5IA 2W0MA 3V9PA 2Y1OA 1VXRA 1JDTA 4CMEA 3IAXA 1GNLA 2BIFA 3CMCO 5KSPA 1EUDA 2IXFA 1YZTA 1KY3A 3GD5A 3JQ8A 5C0OE 2PUWA 3LT2A 3UAZA 1N2HA 2AJBA 5IG2A 1MZVA 2YVKA 1UBHS 2WJ3A 2NACA 4CETA 1NMSA 4KPUB 4PG5A 1NT4A 3FUVA 4IGKA 1Z2OX 4OD0A 4PYLA 4OREX 1L7XA 3D4BA 1NPDA 1I4EB 1U28C 1UIMA 4YX9A 2GCOB 1DFGA 4FXPA 4MQEB 4P53A 4B34A 2WUGA 2R2AA 3CQ9A 3R7WB 5C18A 1XEXA 2CXTA 1X1SA 2AFHE 2AYZA 2XTJA 1Z2PX 3JD3A 4LXTA 1EUCA 1P0PA 4YCSA 9LDBA 2BMDA 4EI8A 3ZXYA 5FLKA 4JX8A 1EFKA 3ENKA 2I1WA 4FHFA 1AKEA 1EVIA 2Q41A 3EZ6A 2AR9A 2LD4A 3QVXA 4MAFA 4NG4A 4YI3A 3U3XA 1KEPA 2ZXFA 3MGAA 1ZUNB 3OVMA 3Q8KA 2VP6A 4EHHA 3N28A 3N53A 2DVMA 2J87A 4HRVA 1HMPA 4TMFA 1IIBA 2F6RA 4MW5A 4GR9A 2JS7A 3KT8A 1CYEA 4UHEA 3LI2A 5F3DA 2ZE8A 5JQGB 1R4ZA 2IVZA 4YRKA 3FH0A 2GAIA 2LKCA 1CUGA 5EHGA 4KL8S 3LK6A 5KS2A 4KIGA 1DDOA 3NH6A 4C3VA 1YMQA 3C8UA 5D1NA 3H18A 1SOUA 1U3GA 1C4KA 2JD1A 3ESZA 4FCCA 5ED0A 4HPJB 2Q5HA 2R6DA 2Q4EA 3J80A 1E4EB 3THYA 1EA5A 5EXXA 4NBSA 5D01A 4EI2A 4Z4FA 4LDRA 4AS3A 1S2OA 1CU1A 1TUIA 3PJFA 1U3FA 4CE6A 1Z2DA 3IDSA 3HMQA 4QYMA 5G1OA 1VRWA 1FTNA 1BXRA 4LI0A 4WT7A 5BORA 4X24A 3CLVA 4FYHA 5T57A 2C2HA 2PD3A 2QSZA 1JPNA 3GG2A 2XX3A 4GP7A 4N40A 4LTNA 1GPJA 1BFDA 2EBWA 1R64A 3FF4A 4O2AA 5IASA 3DA8A 4PEVA 3S44A 4D46A 3I9NA 4KN9S 5KWIA 4MQFA 2DFTA 4OMCA 4BB0A 3V1UA 4BTVA 3HP7A 1P1FA 3VR5A 2B0JA 3PENA 2WEKA 3O31A 2X3FA 3H1AA 2CZGA 3SMQA 1THTA 3HFJA 1A9QA 4EB6A 5JCJD 1ND5A 2UZ1B 2EGGA 1LDYA 3G7SA 5FTLA 2XNSA 3AV3A 4JVOA 5B1DA 2PSJA 4F7WA 1F5SA 2BEUB 3EWAA 2ZB2A 2W5UA 4TV9A 3X1DA 4DYDA 3E5RA 1UAYA 3PDHA 1U1DA 3JQ6A 3ZDCA 3TQIA 1P0IA 3EEIA 2QAGC 5H4GA 4ZAFA 1GA4A 1EQAA 1W4CA 3K0SA 1F0NA 2G9QA 2X5XA 3CIFA 3QKSB 4W5TA 2ATIA 1G60A 3HKEA 4ZWNA 1HOXA 3D0OA 4H6PA 2CBXA 3OIUA 3SEQA 1U9JA 2ZI3A 4LA4A 4NAUA 4P81A 4R7TA 1XEXB 4NU6A 3B38A 4MKHA 1G17A 1E7RA 1JG4A 2ZM6B 2EL7A 1QP4A 4U7FA 3OC0A 1Q6YA 1ZZEA 1WKVA 2FA9A 2VTEA 3ADCA 3HPRA 2YJNA 1W87A 3OZDA 3OM1A 3JVVA 1AM4D 2B37A 3DTTA 3G1UA 3WYGA 3KSMA 2DTDA 3E9DA 4HATA 4KXYA 4UUAA 5G41A 3OE7A 1PIWA 2HF9A 4GG1A 4A23A 4WKBA 4HYYA 3CVUA 2R62A 2PPLA 3KRTA 4HEJA 1EHIA 3EFBA 2PL1A 5EWMA 1M2OA 1FJXA 1SOMA 3MJVA 2WFAA 4UBIA 4RK7A 1U0SY 4YRFA 4K5QA 4MV6A 4BXOB 2QRKA 3WGTA 1GQRA 3FUXA 1Q0SA 4H6VA 3ZWXA 3CF2A 3ZY5A 3COSA 3HA7A 2VK1A 3PUYA 3VV3A 4BNUA 3HA3A 3EXHB 3PDJA 1DELA 2MYTA 3J81A 1ISHA 1ZAKA 3EIHA 4I1PA 3G2OA 2VJCA 3IHKA 3O4FA 4Q3NA 5F21A 2DM6A 1Z0FA 1S5PA 3X44A 3EXIA 4KGXA 3A26A 3SM3A 3JZMA 3AUJB 4PR3A 3V97A 2Q9BA 1NVGA 3R7NA 1TYEB 5H83A 1CQWA 1R5BA 1WMSA 5I4IA 1YS7A 4AP9A 4G63A 4L8LA 3HCFA 3I1YA 3UA3A 4RKWA 4DUZB 3BDAA 4MYHA 3DEIA 3KJNA 3E05A 3KSBC 4O4HB 1IEVA 3QUTA 1EBFA 2UUPA 4NZOA 1E3LA 1MKYA 3EXIB 4Y6QA 1E96A 4ZT7A 2O07A 1FP6A 4KWHA 4ROTA 4EOGA 5KYKA 1EQUA 2FOLA 2UZ0A 3CLRC 1DAEA 2JIQA 2OM2A 3E9QA 2VATA 3PEFA 4J1QA 4Y2VA 4YAIA 2OC4A 3QYPA 4UAVA 3K8OE 4MI1A 1V25A 1GCIA 4L4SA 4GVPA 1IEXA 1XN1A 2PMFA 3KKQA 4R31A 1KKUA 4QQFA 1L1RA 5JY1A 5FL7A 3CW9A 4Z0HO 3IUMA 3C7CB 1KVTA 1E5DA 3ZWBA 3P9KA 4DCUA 2WF5A 4XLZA 3BXEA 3ZU4A 2R7LA 2ZDQA 3UMBA 1N9KA 1PZHA 3K7EA 3P2JA 1PD1A 3P97A 3LYAA 3S4YA 2VZEA 1J21A 3FVTA 2BHLA 2ZU0C 1IM8A 4LSMA 4R9NA 3GB9A 4MLZA 5HMMA 3TCKA 3X1MA 2SICE 1HRKA 3TQFA 2Q27A 5JJKA 1N2EA 1XTKA 4EEXA 2FWJA 2JFQA 1PN3A 3MELA 5JS7A 3L0CA 3R0QA 2TS1A 4D98A 1K97A 2R4QA 3FR7A 4OYRA 3TRJA 1NBWB 1H8HA 2Q6IA 3TTWA 2ZSDA 5EJ6A 1JDJA 4AB1A 3EGEA 3R6LA 4IUYA 1VJGA 2VBCA 3FPKA 4EUKA 4AZ3B 1KEKA 3CX4A 5DHSA 3OP4A 3SF8B 4TT3D 4RZQA 4EM6A 1RPAA 1Z6XA 1EFPA 1CWUA 1KZYC 3GJ0A 3DCNA 2H2HA 4PS1A 2WJVA 3VPFA 5A4IS 5L95A 3FRJA 4WESB 2GCPA 2WSSA 3L82B 1LFAA 4IIBA 5EIEA 2ZB3A 5KNLA 2C7PA 4QSHA 4E5UA 4EJ6A 3ACBA 2P9CA 4TRNA 2HO4A 3KZXA 2FK8A 4TTJA 3LZ6A 421PA 2WB4A 2CXOA 3HCRA 3CF6R 2IW3A 5EGSA 1PLJA 3WIDA 3IR6A 1FS6A 2RI6A 4XM0A 1YRWA 1L5LA 4GIBA 4DYVA 2YYSA 3PGMA 4PV7A 2I2CA 2ZWMA 2CHQA 4GYKA 3A0UA 3QW2A 2AJDA 3UEOA 3KZMA 4JLDA 5AOCA 1RC1A 2C2WA 3V32A 1W76A 1XLVA 2CVFA 3ZQ4A 4DCPA 1AC5A 1ZDMA 2HMTA 4MMYB 4IG9A 5BWCA 3UJDA 3ZWYA 3GEPA 1AQUA 4OA8A 4MR8A 4FWBA 1L7BA 3M2PA 3NHFA 3EAFA 4IHJF 2YV3A 2NPOA 3HV0A 4IS2A 1JV2B 5AD1A 1CP2A 3U7RA 2Y0CA 1NP3A 4ZZ0A 4I9GA 4RPCA 5PGMA 3E3LA 1RRMA 5LP6C 5BW5A 4YRSA 1ODKA 2ZJ1A 1OFVA 4LX8A 3ZVMA 2JCSA 2ZS8A 4ZT3A 4LK3A 5GONA 4JJIA 1QE0A 4KO4S 2R1ZA 2BFOA 3LUDA 1HG0A 4KWEA 3STWA 2WI8A 4C03A 1UWKA 5CNJA 2DSNA 3TOVA 1XCMA 5T4BA 4DW8A 1R12A 3QMWA 3W7AA 4ALLA 2BGGA 5EJFA 2WHQA 3O94A 3WBBA 5CURA 5EWLB 1DRWA 1EBBA 3JASB 2RC6A 4H1UA 3NHYA 1U1CA 4NKRA 3RIYA 5M7EA 2OL4A 3WDSA 3R9XB 5IMBA 5EP4A 1ZLXA 4J6FA 3DXZA 3UG6A 4ZODA 2QN9A 1UKVY 2EZ9A 2Q5QA 4I46A 3LY9A 3AJ9A 2OLEA 3G89A 1FDUA 3L0ZA 2EP5A 4GI2A 4R9VA 4KBGA 1PV4A 3R3VA 3MBOA 1UDXA 4FDUA 4FGUA 4YP5A 5CB4F 4WLVA 2R7MA 4HDNB 1ZHFA 3F6YA 3NBYC 2VHYA 4DA6A 4DCMA 4D4LA 3FWHA 4ZJYA 5HJEA 2J0UB 4UATA 3T3OA 2WYHA 1OASA 5IF3A 3V8PA 1F4LA 1ZVMA 5FYQA 4RH0A 4P5EA 5E0OA 3SYRA 1X80B 1SU4A 1CQIA 2VHCA 2F4VB 2H85A 3AJEA 1U2DA 3A3NA 3DXXA 4FDLA 4I2NA 4OBEA 3MTDA 4F4HA 3ILXA 4J75A 5IHPA 3L6BA 3C3JA 3UHOA 5E3IA 1V8OA 2B5OA 3WRWA 4LVNA 1S9DA 2F1HA 2WAOA 3QQ5A 3LUHA 4REOA 4M1ZA 2VIIA 4LDPA 4WY5A 4HZGA 1LRKA 3OMWA 4MJ7A 1LNQA 1P5HA 2QTNA 5DP1A 2Q07A 3DMNA 3H1FA 1KE2A 2H9YA 2OCAA 4ZHQA 4E14A 2Y9MB 1BQEA 3N6XA 1R9MA 1WV0A 4NEHB 4HMOA 4XJTA 1NBIA 3Q41A 2W83A 5NLLA 5BSRA 3QKTA 4FGSA 3U3MA 3C3PA 2YHIA 1HDOA 4GMFA 4M89A 2CBZA 2GFHA 3RADC 3KLNA 3IMEA 3FYTA 4ZIRA 1U63A 3EW7A 2GSDA 4BUCA 4D80A 1ULHA 3GVHA 1SXJD 2MR6A 1T3SA 4J4TA 3ZJ5A 2VWQA 1RAIA 3O3MB 3A3KA 3OZFA 1WW2A 1MEEA 4KQFA 3GJ4A 2ZIAA 1PV2A 3D0QA 1BWSA 4HOYA 1IONA 1QGUA 3GZ4A 3OLVA 4HVAA 3STVA 3TQOA 3VJKA 5B64A 1P1RA 2JI6A 3DOJA 1QCDA 4N5IX 2RGYA 2JFBA 3DMTA 1H9AA 1KHHA 4YT2A 3VZBA 1RJ9B 2D06A 1M6HA 2C7BA 2FW1A 3ZDQA 1N8KA 4F4UA 4MV7A 3K0CC 1N77A 1QH1A 1CY6A 3KZVA 2QZJA 4L5BA 2RC5A 3KXDA 4PIMA 3BQ9A 4COOA 5AXDA 2RKWA 1Z88A 2CFRA 3GRAA 3ZKWB 2R0QC 1HY3A 1U0GA 3SIRA 1INLA 2EFDB 4ARUA 2XUOA 3I2JA 3IPXA 1JAZA 1Q1ZA 2EDCA 2XUAA 4BQFA 2Y76A 3WKEA 1FXSA 2PNFA 2NAFA 2XGMA 3JWEA 1PNTA 4YDRA 3THSA 4BFVA 1UPXA 3EPRA 4YMTA 2X0JA 4RD6A 3ECSA 1CUYA 3OFKA 5HUJA 3GCXA 4NV0A 3DSRA 2Q4DA 1OYYA 1WXFA 1AN9A 2I71A 3EQ6A 3UXYA 4DQUA 3T1OA 2C88A 5DTIA 4OQQA 1CRLA 2QN3A 3WLLA 2PLRA 1VYTA 4E4TA 2UVPB 3ND7A 4CL0A 5BSKA 3NOQA 3LT0A 3O26A 2XTAA 2D4HA 2A0KA 3Q3EA 3QG1A 5G40A 1KOLA 3TI7A 1U7OA 1M1NA 2YINC 1C7JA 2Z2IA 3R6DA 5AOAA 3ITEA 1E2KA 3HKBB 1BIFA 4PNZA 4LXGA 4H1VA 1YL7A 3D7MA 3BHIA 1I24A 3OAAA 4Z9AA 4EYQA 5BWMA 5LMUB 4RA6A 3QW4B 4LYAA 5JXGA 3RQSA 2AMVA 1PSZA 3CNEA 3QLTA 4ZOBA 1MD9A 1W1WA 3KQLA 4BNNA 3QKRB 1TAGA 2SHKA 1NJSA 2XCUA 2E6KA 2YDXA 4W5HA 2GZ1A 1XMJA 5GWXA 1B14A 1I2BA 1XD9A 1XC7A 3PJVD 4G2NA 3RH0A 5KNBD 2AFHB 2AXQA 1NXXA 2CKMA 4CTMA 2D3WA 3FTCA 2ILVA 3AVWA 3DDNA 3GELA 4TSRA 1PFVA 4MO2A 1U0BB 2XGJA 1OXTA 4NIMA 5EGNA 3TL2A 2O9JA 2YOHA 4HEA6 4Z7OB 4BJHB 1E0DA 3DLAA 3IVCA 4MUGA 4CKBA 2FSSA 1I3CA 3RS4A 4ZHSA 3WADA 5T67A 2BC9A 2P4EA 1MUUA 1A50B 2AG1A 3GGSA 3IEPA 3M33A 1PHRA 4D9KA 1GDDA 1OREA 1K6MA 3L4BC 3UPTA 5JS8A 1ZNXA 5BNZA 3C3CA 1V16A 3KJFA 2P2NA 2R8PA 3NG1A 5DT9A 4FFSA 3GROA 4R05A 4EK9A 4CEHA 2D5CA 3BMOA 3E82A 4OX9Y 1YL6A 2BMAA 4LBYA 2OO3A 4M9CA 4ND7A 5B6IA 4KVZA 1R6UA 2AOVA 1W96A 4NONA 3EISA 1TEHA 2NU9A 4OJKA 2WU8A 3IBYA 1GRRA 3OBIA 4KVFA 5LQRA 2PWBA 3WLOA 1ZCAA 2J9XB 1GZ6A 1LLDA 1C0EA 1KP3A 1HH4A 4HB2A 1RYZA 3U4AA 1NFQA 1RWXA 4YRBA 5K0SA 2VR1A 5DX1A 4QPCA 5EKUA 3I37X 3SHVA 3UK0A 4DDKA 3GLRA 1BGWA 2HC9A 4OLAA 3A0RB 4NMXB 2FQQA 3IALA 4OYYA 3HGTA 4PLZA 3OD5A 2R6GA 4JOQA 1UOEA 5FJJA 2XRMA 4FZVA 5EWMB 1DTWA 5IJAA 5IDWA 5DSXA 4QARA 3HLYA 3W9UA 4JR0A 5K8VA 4PXSA 2J6HA 1E4OA 4EG4A 1RXIA 1Z15A 4KH0A 4FD2A 2C7RA 3DE1X 3HXMA 1IZ7A 3BIXA 2ECKA 3RWBA 3KQOA 4JJKA 1HDRA 3AP2A 1GYPA 1XSEA 4WD3A 3L7IA 3ROGA 1T4BA 2GVNA 2OXIA 1YHNA 2Z1NA 1HDEA 2GN1A 2PZ8A 1EU1A 3LT1A 3NHUA 1VKHA 3PV0A 5DLQC 5LC1A 2Q0HA 4XIJA 4OBXA 5I9BA 3VOAA 5FPQA 1GCGA 1SULA 1Z0IA 4OYHA 3A7DA 1XCLA 3GMSA 3MEQA 2WM9B 3HU2A 5EJ2A 1WULS 3B7WA 5BV7A 3JVDA 5D5QA 3DV0B 3GX1A 1Y4AE 4JI3B 5A5DA 1NXPA 5T3YA 3BGSA 3U7GA 1WPQA 4BO7A 1NVUQ 3HJCA 5A3QA 4K88A 5JD6A 1RI5A 4BE7B 1FRVA 2WWRA 3R7AA 4E46A 1L8XA 4DZRA 3EG9A 4JEUA 3QVMA 2J0EA 1WQ3A 4LSWA 4CM9D 2QP3A 5SY4A 5MGNA 2NU8B 1Z5WA 1DRJA 3ELBA 1U2RA 4BO5A 1TA0A 3GEEA 1RRKA 2BLLA 4UE3S 3GLFB 4FOOA 1V5EA 4OCZA 2AFIB 3RASA 4BYMA 3WGZA 4TPKA 4B74A 2A14A 4P0PB 4XJSA 1TA4A 2RKOA 2AG8A 3P5SA 1PU2A 5BWBA 4N7BA 4EGQA 1EG7A 4FFPA 1OB5A 1V39A 5FQOA 5HK8A 3THXA 1DP4A 4I50B 2XE4A 2MSWA 4UHDA 3LDGA 1XEAA 3QFCA 1N9GA 2WWWA 1A69A 1N6PA 4AMYA 2H4XA 4NXNB 1DTSA 4LJ7A 1Z0DA 3AR3A 5FLYA 2Y1FA 2QG6A 4ID9A 4HRXA 4BP3A 3FSGA 4WERA 2JNWA 3JQFC 5JS2A 3M3DA 2QD1A 2H4FA 3OECA 2QGNA 2GJ4A 2VUUA 2P1RA 3K35A 1JBEA 1I4TD 3C3AA 1YZQA 3QEJA 2PZAA 4CMIB 1M0EA 4CF7A 3GUVA 3OZIA 1GFWA 3JRXA 4EWLA 1M6VA 4ENUA 4EBBA 2UXCB 1RCTE 1T4MA 4OLFA 1KC3A 1OX5A 2VZ0A 2EVWX 2OQ2A 1CKEA 1WUYA 4AO8A 5DO9A 4J49A 3DZHA 1ZXLA 4N48A 3K16A 3NWBA 5CA0F 1M1XB 1YTUA 3H2JA 1OWPA 4UARA 1AG9A 3MIIA 4CEHB 1E63A 1ESZA 1Q0PA 1ZC3A 3FGOA 3MWJA 4K9KA 4LXHA 5DEOA 4HC4A 1JFLA 2ZTHA 3UMJA 4C0LA 1K7SN 2H5JA 4C3ZA 2X1MA 3E2PA 2HSEA 3SJZA 5AW1A 4FCTA 5AK5A 5E2IA 3MWGA 3NUZA 5LL6P 3I4LA 1YHYA 1WSDA 1WOYA 4M87A 4IINA 1A88A 4C7KA 4E5MA 2YWFA 5JSZB 5IT4A 1XFAA 3LECA 4U9HS 5ENZA 1E3DA 4B5KA 5CH3A 5EMJA 2RGEA 1V3VA 3ICCA 2ZREA 3K9HA 2PANA 1I94B 2VJDA 4KREA 5SYMA 2D8AA 1H4VB 2I62A 2IQIA 1JMVA 4LBZA 4QYIB 4RPJA 1T8WA 2Z2JA 4CTKA 1EGVB 2C83A 2I78A 3X3HA 1NXTA 1CJCA 3PGJA 4UFOA 4WK4B 1KAEA 1P9WA 1SCAA 3R7WA 4CT5A 4XGNA 2TECE 3GFBA 3SZMA 1AB6A 3MWDA 4MHOA 5LUBA 2LIPA 1NMEA 3OE5A 4QSMA 3HKDA 4Q37A 1N3LA 1WCV1 4BJ6A 3PB3A 2QW8A 5E2BA 4YUVA 3TK1A 4BGDA 3L02A 1JKXA 2Q2NA 1UJ5A 4HDSA 4JYMA 5LZ4A 4EUHA 5AM3A 2YWJA 3QJYA 5FTMA 5I7RA 1EUDB 5KNCD 3HJAA 5LXTB 4RGVA 3ASUA 4QU0A 5HGJA 1KERA 1ZGJA 4A92A 1GU7A 4L4UA 3U3ZA 1P4HA 3PDCA 4RVUA 1XR3A 1B16A 3DHYA 3GDHA 1PT8A 1NDQA 2OTCA 3IT1A 2WVJA 4B3BA 2YS6A 3UKJA 3ZWPA 4WGGA 1FXUA 4R9RA 3ZVNA 4P33A 4KQ1A 1PP4A 1M33A 1XVTA 3GJ5A 4KWIA 3UENA 3QEAZ 5KDDA 2BBOA 1GA1A 3D8SA 3N2YA 5C5CA 1Z7BA 3T7EA 1XZQA 1E9FA 1IULA 2QORA 1F2UA 4IZ6A 4B35A 4B6OA 1RQRA 1DINA 3AUFA 4IV8A 5CA1A 1KMNA 2V0CA 3H99A 5AW4A 3GRKA 1LS1A 3G2LA 3M6WA 4EW3A 4HVLA 3WIUA 1YZUA 2OOSA 3DVRX 3N0TA 3ONVA 5BW4A 3ER8A 1OTHA 4XGIA 4C88A 1CUFA 2V03A 3V4FA 4LYJA 4MIOA 3U4MA 4UU8A 3HYSA 4ETIA 3G2JA 3PIRA 8OHMA 4JJAA 4A3SA 2XXAA 4Q21A 1EAYA 1JPJA 1C3VA 1J9ZA 2GYUA 2HZBA 3DT9A 1IJEA 4GLLA 4I1OA 4LCJA 5BSVA 1TVEA 2RSLA 4Z99A 4ZTZB 4D97A 1E60A 1YT5A 4B32A 2NZXA 2DQKA 1BDIA 1QUEA 1SPBS 2HF2A 4CG3A 2HN9A 1GADO 3QQPA 4FEAA 4TUYF 721PA 3TM4A 4MA0A 2C5AA 3VISA 1W8IA 4EABA 1IN6A 4ARIA 2WJPA 1LBSA 1HPLA 4YN3A 1QZXA 3TXYA 1G20E 4Y2HA 2YHIB 3VAZA 2XYHA 2NX2A 1ESNA 3A6DA 3K30A 1RACA 4XB2A 4RTMA 2VYQA 3SD7A 1CUIA 3BMQA 2GZAA 3NAMA 3WZLA 3JD0A 4Y0NA 4ER0A 3QZUA 1KSHA 1AX9A 1RHMA 1T1RA 2YY6A 3CXUA 2D00A 4KRGA 1YJXA 3UTCA 4CVNA 1WZIA 3J7TA 2GEBA 2PXAA 1NJ2A 2TYSB 3C15C 3QE3A 1A9XA 3P9PA 1XZGA 4IOLA 3BKWA 3SFZA 1IUPA 1U04A 1B8VA 2ZS7A 2AEJA 2ZRKA 2H2DA 2CL6X 4BY9E 3A58B 5BQ3A 1K6EA 1JHQA 3IILA 4OO3A 3RGGA 1YGYA 4B6JA 2IYUA 4DRXA 1SQ6A 2JCGA 3R0IA 3HKDB 2P9ZA 4GSYA 3HABA 1EVQA 4BO9A 3I0MA 2P3OA 2WJGA 1JUDA 2DOKA 4KLZA 3ZGVA 2AA3A 4A1FA 1RYHA 1O97D 1WDMA 2M9MA 1QP0A 3COJA 1NUUA 5DASA 5I3CA 4OM7A 1QHFA 1YDWA 2AOTA 3H9EO 4BGUA 2XOKD 1IY8A 2FWAA 2HAEA 2WJAA 4B3RB 4H7PA 4GZ3A 2EX4A 3MWYW 4MRMB 3ZBUA 1SQ5A 1T5OA 2DWUA 3D64A 4L08A 4XSHA 3HI4A 3HJGA 4Z5XA 1ZVVA 5B1HA 2BKLA 1IPEA 4OL0A 4JNKA 1W5EA 6GPBA 4LV5B 4BEJA 4QGSA 2XWSA 3JQPA 4UXJA 3ZHOA 1M5UA 1SC3A 1CV2A 2PMWB 3CZAA 3GEHA 1E1CB 2C96A 1CJVC 2FEAA 1DEAA 3QLEA 1NNI1 4PXYA 3NPMA 3R9XA 1LLUA 3SIWA 4BRZA 3ADDA 3IDQA 5YASA 4JX9A 5CDTA 4OB8A 1L4KA 2WZCA 5JNLA 1YK1A 2Q6VA 3FCCA 2HPZA 3VHLB 4CLDA 1N2XA 4GKJB 4V0RA 1VL2A 3V3KA 4IDBA 4BB5A 1RZRA 2IUYA 4R5HA 3BPSA 3DOCA 2QQGA 4R1PA 1HYQA 1N6HA 4JI4B 1Y4DE 3H2IA 1M1YB 3ZJYA 1QE5A 1R2QA 1GHTA 3EXHC 1VPEA 2JAUA 3UK2A 4MMXB 2SCUB 4IF6A 2J08A 4H1WA 2V7XA 2LZ0A 2H7VA 1Q91A 2ORED 2PJDA 3OCUA 5EMNA 1Q19A 3HBLA 2AMFA 2X3UA 3E84A 5DJ5A 2HSDA 4RE6A 4K6CA 2AX4A 2Y2UA 2QTWB 1JHYA 3UJ7A 2HV8A 4O4IA 5CMLA 2DTEA 2JPDA 1N1DA 1MFZA 1TQ4A 3IAS6 4H18A 3GF4A 3ASVA 4WK2B 1XIVA 5M3BA 2GILA 5KYYB 3DQZA 2PS3A 4F2DA 3D6AA 1QIKA 3KTDA 1LDBA 3V8RA 2DHCA 5J4HA 2JLSA 1BHJA 1FFXB 2OBXA 3OZRA 4HDKA 1QHIA 3ZNPA 5KTNA 3MS2A 3UANA 4WXMA 1GXSA 1Z6AA 2FHPA 5EZYA 1LSSA 1DAPA 4GMHA 2VZLA 3HCEA 1K8ZB 4GOXA 4OQZA 3MUOA 2H1VA 3CSUA 4EX7A 2VAPA 3M1LA 5EJIA 1B23P 3D6FA 2R44A 3PGLA 1FA9A 4DV7B 4UAGA 4OQPA 2Q3JA 5CPFA 4AX8A 2FWIA 1ZFLA 2PGOA 3RSZA 5JDIC 1NG9A 1QHXA 4JBIA 4BMCA 4RLFA 2FZ5A 4MVJF 4RL6A 5ALFA 2JC3A 4URXR 1IMOA 3HZHA 5E8RA 2FW8A 1A0OA 2OV8A 4EMTA 2BGWA 4GBED 1DHRA 2INGX 5FBKA 1DIBA 1VBFA 1VYHA 3N2KA 4KITB 1A2KC 2XMBA 3WS7A 1CRZA 3PFFA 4MROA 3UJCA 2VK4A 1OZ0A 2XCIA 3JVUA 2OPBA 3L7NA 4DLXA 4CKCB 1L4LA 4IFEA 1XAGA 3BSFA 5JMOA 1JTEA 1G1MA 3DM9B 4JXZA 2IUUA 4B84A 1VSUA 2F1JA 2V7TA 3CE6A 4G1VA 2RBKA 2EKBA 2RGDA 5WRFA 4UFPA 2F8SA 4FOSA 4KEAA 1BRMA 1FFYA 2ZRJA 3W3AH 2J48A 3D1JA 2XH8A 1Q2XA 2Q4BA 2RGGA 4RHUA 2C61A 3JVEA 4MJ3A 5FDFA 4EW6A 2QXTA 2VAXA 2N47A 1VCIA 3AQIA 2LPMA 5IWAB 5C5DA 1KK2A 3PGKA 4K40A 4PHGA 2DCMA 5DLPA 5KAMA 5JS1A 1AK9A 2VF8A 4JP3A 2QU7A 1JYEA 1JS1X 1OFIA 3M6IA 3I5UA 4QUKA 4D7AA 2O4CA 2O2XA 3Q0IA 4UKDA 3WLTA 4AQDA 1GNPA 2K7FA 3WP0A 4PRKA 3SP1A 4U7JA 4AO6A 1ZIPA 3AUAA 4XR4A 1WS6A 4Y6SA 1DI0A 3F8WA 4ENQA 1VTKA 1WB6A 1S2MA 1NFFA 2FW9A 1Y6JA 2VH1A 3F98A 1TEXA 1FC0A 5ALQA 3VOSA 3HCDA 3W06A 1YB1A 3NV9A 4X3CA 1ODFA 2RMKA 5HKBA 2Q5LA 2WSIA 2LKDA 1ZMOA 3KJIA 3Q1KA 4J3FA 5FBLB 1W59A 1PEDA 3OCXA 5JZMA 5EJGA 3AT1A 2PX8A 3G59A 5BMVA 2OHHA 1TLFA 1Y7TA 1XALA 4WLFA 3GLHE 1YJQA 2PGNA 1FFCA 2WU0A 3A6LA 1LPNA 3GR6A 2JIDA 3H9QA 3KQVA 3RKRA 5KJCA 2GM4A 1L5RA 3AHDA 4PU0A 2PX0A 5B6JA 4L72A 5LLTA 3DZKA 3X1YA 4CYMA 1VSTA 1YJAA 1HLPA 1NW4A 3V42A 1ID1A 3DP7A 4BWVA 3TAUA 3O8NA 5B2EA 4FYKA 3P4UA 2VPTA 4KQ6A 3LG2A 4U7PB 5DRTA 2XEDA 1YDGA 3F7MA 3AINA 3N7AA 2FCAA 4GX5A 5DTEA 4RKRA 4D99A 4DPKA 1CG6A 5F5LA 3WISA 4AK9A 3MAAC 4HQNA 1HT2E 2QTFA 2ZJAA 2QVBA 4MVJD 2X4GA 4RZHA 2IPMA 3W7VA 3WNBA 1E2IA 4BPRA 5TVKA 4EGSA 3B6MA 3M49A 3TEJA 2QRLA 1P6QA 1ZMXA 2XQGA 5H81A 4EY8A 2DLNA 1NJGA 4NC9A 2EAUA 3DH0A 4PRZA 3RVSA 5SV2A 3D8RA 3NTXA 3WL5A 1OF1A 2QPTA 2QL5A 4LQDA 3Q0EA 4D41A 3P9RA 1JHZA 2KBEA 2Z5VA 4PLVA 5FP0A 5KDLA 4H31A 5KYTA 3U3KA 1YMVA 5LB2A 4QEKA 1L3IA 3HWRA 3PIIA 4BRWA 4E1BA 3GJ3A 3V80A 3W34A 4NCNA 4Q12A 4QJIA 1EWVA 1R0KA 2UVPA 3B1KA 3UAYA 4ON9A 3OT5A 4B80A 4CEJB 2DERA 2PR2A 3OY2A 2QAIA 5LQMA 1XDZA 1PUXA 3MMPA 1AK2A 3UUEA 3OTQA 3F90A 3DMRA 2FLKA 1E5VA 5J5VA 4P2GA 1ZONA 2IPXA 1AKUA 3HUEA 2FRDC 4OQMA 4PCAA 4AJ9A 1GPBA 2UZAA 5C8YA 4DABA 5KPDA 4MZDA 1QQ5A 2J5XA 1C9JA 4BU1A 4XZ3A 4L7QA 4UTZA 4BNTA 3DEZA 1K4KA 2G9ZA 3GPBA 5AVKA 4DLRA 1U2TA 3KKLA 3VSAA 4RKYA 1F14A 2D1QA 1JSRA 2V6MA 3AR6A 3U1VA 2YYAA 1KMMA 3S3TA 3HWSA 3PI6A 5CM8B 2WSBA 1LWNA 3ZY3A 3RVJA 3W8RA 2FPGB 2IYNA 1M6WA 3T1HB 2QG4A 3GP5A 3GGCA 3PC8C 1C3OB 1NXVA 4FI3F 1LJUA 1RJ9A 4MV9A 3V7YA 3EVDA 3ZVKA 1TF2A 4P4TA 1I4OA 3D7KA 2FN9A 4GZ6A 2WU1A 4I0WB 1I3NA 2WJYA 1OBOA 2I33A 1DIGA 4NZMA 4DJTA 1P2FA 4EG6A 1XNQB 3DAPA 3LBNA 1Y6FA 1DZ3A 3UA4A 5BVGB 4MP6A 4AZVA 3TIXB 3AV0B 3TOZA 4CDMA 2QD5A 3D6UA 3UV7A 3TUJC 3NT4A 4P8RA 1XBTA 1CY4A 4BVKA 4MPJA 1YS9A 4IIYA 4LXQA 4ZIRB 3F73A 4WNAA 2XD4A 1NJ8A 3L01A 1EGAA 5JVDF 3LYUA 4H35A 2XWJI 1GZDA 3AUXA 2JGEA 4EG5A 1KS9A 1IAQA 3EGDB 3EJ6A 2CB9A 3L0YA 1UPCA 3O0DA 4U63A 1UBTS 2NXEA 1KF0A 5FPKA 1SPXA 2XHZA 1JVSA 2EU8A 2GK4A 2H3HA 3LQ2A 4DILA 4EYKA 2HHHB 4QDOA 1QAOA 1XRJA 2K87A 1NW5A 2VNIA 2X13A 3GLUA 3R23A 5AM1A 4JBLA 3VVCA 1UAAA 1IC6A 3ILVA 4B9AA 4RF3A 1UKZA 1O96A 3DUFA 1UJCA 2X1LA 4EY3A 1E64A 3WMGA 1E99A 1XZDA 2XBUA 1MF7A 4IRXA 4F92B 2JK1A 4MS1A 2G1AA 1A82A 3GCZA 1A9ZA 4HN2A 3GUZA 1ZRHA 1QVWA 5CFOA 5K51A 2SNIE 3VU3A 3COZA 3CUTA 1L9XA 4AS1A 1V7QA 1K6JA 1NBHA 2CNDA 2FOXA 2MSKA 3MT9A 3PG5A 3QVTA 4L6CA 4UUOA 2W48A 2KSQA 3KZKA 1GKUB 1SN7A 2P6OA 2QYSA 3CUWA 2J6CA 3GLQA 2F67A 5J9FA 4D9MA 3ZE9A 1A4UA 5JC1A 2BCEA 4PX9A 1EM8B 2GKGA 1DO2A 1Y1RA 2H9AA 3CX6A 3NJ4A 2H0RA 1TU0A 1M3JA 4R2WA 3E8XA 3QXCA 4FINA 4BNMA 3EQ7A 4UZSA 4DHWA 1GXSB 2AN9A 4LRUA 4AP5A 1QH8B 3I53A 5LQCA 3K9CA 5HJ7A 3HKCB 5EERA 2MINB 3EVZA 4F85A 1E1QA 3PRJA 3E1SA 1IY0A 4R0MA 3SZ3A 4E5KA 1P61B 3V6LA 1UDRA 4XM1A 5IXSA 2IP4A 2XZDA 3FOEC 3ORQA 1H05A 2JLCA 2QTTA 2JH9A 4RPIA 1E8DA 4UHBA 3ZEAA 1FJGB 5CXUA 1J07A 3TSCA 2LIVA 3AYZB 4BUZA 3RYCB 2Y1KA 5JCPA 4RA9B 4UTRA 1SC6A 4WIAA 2KW5A 5LM3A 1XEWY 1KORA 4LHXA 2E49A 3HM9A 1Z5UA 4I8IA 4JLOA 1XZNA 2VSQA 1NF3A 3W4JA 4KOEC 1XXHE 1AU9A 3UAGA 4KN5A 4JIGA 2Q2OA 4D6XA 5GV8A 2NO1A 5E7QA 2C92A 3CCBA 1I1NA 5TPWA 4LF5B 3H11A 4UUPA 4AI6A 1CUDA 3L0IB 5L4NA 2QM7A 1T5IA 4DVGA 3PYLA 5KWSA 4CL8A 1OV6A 2ONYA 3VSDA 1PO7A 1S3GA 1JT9A 3ABQB 1HQDA 3B13B 3LS2A 5KU1A 2DBVO 3DAGA 4C7BA 1UBLS 2C2ZA 3A2NA 1XLTA 1Z3IX 2G5GX 1JEJA 2GAFA 3BG5A 2DECA 3IOYA 3QBEA 4ZT6A 3SJCA 2YXEA 3G85A 4EQ6A 1IVYA 2BEJA 1OH8A 4P0QB 3UMCA 4EAQA 5BVHA 1DJQA 4X6LA 3ZCPA 3MRXA 4FOLA 1O03A 3EF0A 3GZNA 4KB5A 5I7EA 2W2PA 2PJRA 1RM3A 3IS3A 1CVIA 4JLKA 3QSGA 5AFSA 2G06A 3FF1A 2H2FA 2D5IA 5JSUA 3UGQA 2BGKA 5CDSA 4FR0A 5FV7A 4L78A 3OIYA 5DN6A 4E2XA 3K70D 4Y2JA 3U17A 4PLGA 3MJRA 1L7AA 1ZRSA 4CEIA 3K1JA 3O9ZA 4M1SA 1ZKMA 3MIZA 4YQFA 2BGNA 4HTFA 4I99A 4MYRA 1IBKB 2IYFA 2WP0A 4EKYA 2XQFA 4OHMA 2AUNA 5GZ3A 2IOFA 5CNIA 5FQNA 1RU3A 2HD4A 1EVZA 5AO9A 3ZGNA 4X41A 3ROZA 5I7SA 3VDNB 1CB7A 3TR0A 4A0QA 3TO5A 2CD7A 3P7MA 4CQMD 2NTJA 3TW0A 1OQAA 4X1YA 2JFZA 4BMNA 1N6NA 4DV3B 1UJMA 4H3KB 4LAFA 4X97A 5EKSA 4CN8A 2JFPA 3FHCB 1HDYA 4AYWA 3TNDA 4X91A 2AKYA 3LGSA 1SVUA 1V3QE 4I66A 1YE5A 2OBBA 4RK6A 5ENDA 4GD3Q 4IXWA 3L4JA 4LMBA 3A3OA 3P32A 3AIKA 5TMEA 1S3SA 3RTAA 2BI8A 2DC1A 3MT7A 2J7PD 4WN9A 4INJA 5K3OA 3BBLA 1XUOA 3C70A 1ZFNA 4EA7A 1PS0A 1TJ3A 3T9EA 2EBFX 2BYTA 2XE7A 3GLIE 2PS0A 1VSBA 2HKIA 5BW8A 5E95A 1YMUA 2YMLA 4ZQBA 1LZLA 1SKYB 1CUUA 3N87A 4BKQA 1OBHA 1COWD 2YCLA 4JQZA 3VU1A 4DQKA 1E3WA 1T2EA 1V1MB 1D1PA 1QGDA 1VBKA 3OJCA 2VQEB 4X3OA 2R60A 1JEQA 3AEXA 1GPYA 2J9ZB 2RB4A 2EFEB 2C99A 1NULA 1QBGA 1C9YA 4UNIA 1V6CA 2FH5B 1SBIA 3DBRA 3HDJA 4ILKA 2NV0A 3VI4B 4AG6A 2OMEA 2B5WA 2BW0A 5IUJC 2JGRA 1ULUA 1HYEA 3DMYA 4JFAA 2PRJA 2Z5LA 3PNKA 4ZC1A 2FDCA 4RFLA 3IUPA 2YQ5A 3JAWA 4K86A 5HEKA 4P1ZA 4WADA 4BNFA 2QMOA 5KPJA 1GAXA 1Q1NA 3OQ1A 4GOND 2CHFA 4X1IB 3EMDA 1PQYA 3L77A 1ISMA 4I4NA 4Q0MA 4A0FA 4XGRA 4ZOQI 2BFEB 4W5JA 5A9RA 1NLMA 3T7TA 1ZW1A 4AKHA 2OXRA 3WAGA 1E69A 3KB1A 3D54D 1OLXB 3D9QX 3PDUA 3KR1A 2XQIA 4WINA 3TCNA 4CKEB 2HLDD 1QAQA 4LHYA 3K94A 1DWPA 1FYFA 3BAZA 1G7SA 2W37A 4ND3A 2ASEA 2EBUA 2C04A 3DKPA 4RDCA 3NTRA 4AG5A 2EKLA 1NOKA 4J7AA 3RYIB 3PCRB 1RHKA 4Y2SA 3IHLA 3E9NA 1LSUA 4OU5A 1ZR4A 2X7HA 3ACDA 2ZJ8A 3LHDA 5K05A 4V24A 1QTIA 4P4UA 4R1OA 3ZU2A 2BI4A 5K0BA 2YMMA 1PI3A 1PZXA 1XMSA 2REQA 2SKEA 4WCFC 5FX2A 3TQHA 2OHVA 1G66A 2HJWA 3FYSA 2YY5A 4FZJA 5BR4A 3OM0A 3DLBA 1HR0B 1ZU4A 1D6NA 4G24A 4HQ6A 3O2SB 1GNVA 3LY8A 4E4YA 3QYAA 4G5SA 2FN3A 4JN6B 1KJJA 5D3ZA 4DCTA 2G36A 3R3UA 4LOHA 4CDGA 1PNOA 2QD2A 5B2ZA 4Y2XA 1GFZA 3AI3A 1EH5A 1JB1A 3FVVA 5C51B 1NE2A 2OGSA 5JRZA 1MH1A 3OTOB 1E6WA 4FSDA 4G1MB 3NYWA 4OAOA 4DB2A 1X1DA 3ECAA 1JU4A 3ZK8A 4LC0A 2NGRA 4MWOA 5JPCA 4NDNE 1Q83A 1ACJA 3TNJA 2CD9A 4NRDA 2DPGA 3WLKX 1ZJJA 4C7JA 2X8LA 3TZ6A 1Z56C 1YIDA 5CXXA 5EWJB 1WMAA 2I0FA 3ZZTA 2NNLD 1UKBA 2ATEA 2E4WA 5IAOA 3WX0A 1L7QA 4K26A 3K8ZA 1BX0A 1Z0SA 1WKCA 1ZL0A 5ALKA 1DOZA 2GLUA 3UJBA 5HVNA 4DMCA 2BTQB 3KAPA 2XCOA 2ZT8A 4MPTA 3KQTA 1M7GA 2X76A 3DZ8A 1QTNA 5B55A 5IKMA 1FLNA 1PQUA 3UCFA 1NVDA 1UXHA 2OORA 4RVOA 3HC7A 4HDMB 4BX3A 3VVLA 4C21A 1TT5B 4P5PA 4P4NA 5AK4A 4B45A 4F5WA 4J2TA 4E03A 2HA0A 1GZ5A 3H11B 4N5MA 2H07A 4GKBA 5G53C 4ILEA 2EG5A 5CA0B 4NEGA 5MN6A 2OG2A 2R96A 1XWIA 3LWNA 4WXHA 4KRXA 3X2EA 4YMWA 3WICA 4BIIA 5BPFA 5MDHA 2WSYB 4YMLA 3SSNA 1K8YB 2RJNA 3P1JA 1GSOA 1VIDA 4MWGA 4F86A 4UULA 3DKVA 1QOQB 2AK2A 2YWHA 4BLRA 2E5FA 3GD7A 1X13A 5FA5A 3FYHA 3KAKA 4NHOA 4BECA 2WYOA 3HDYA 3VYVA 5LQKA 2DBRA 1G98A 2XUKA 3OEHD 1RKXA 2X19A 2ZI4A 1ZICA 1YR6A 1TX4B 2N42A 2VAWA 4KR0A 4BO3A 3EGWA 4CKXA 3UK6A 1XWWA 2XB8A 1V26A 5DXAA 2IHVA 3AR2A 4E15A 2L17A 2H1FA 3AESB 3OQ6A 1JZQA 5IDXA 3PPIA 1NPYA 3GV0A 3CQFA 1UPFA 2OV3A 2OV4A 1O89A 2Q1YA 3B6IA 3Q2IA 4YJ2A 1EM8A 2BJHA 2PXCA 3Q7TA 1V11B 5IJ9A 3E1GA 1I7SB 2IHYA 3BD9A 3EZNA 5GGXA 2B3TA 2G5PA 3DDCA 3EZYA 3IVGA 5JWOA 4BS9A 3K8QA 1KP2A 4NBUA 4CEJA 4AMUA 3N74A 4UDXX 3PQEA 5HF8A 3OOWA 1QOPB 3EQ8A 4OK3A 1JW9B 1VSQA 4HSGA 3R41A 1ABEA 1W4AA 3V4SA 2QX7A 1EZ1A 8ABPA 1ECGA 3LFTA 1SUIA 1WVGA 3K5IA 1J24A 2CEAA 1TM1E 4WZ6A 2JFUA 1U65A 2V8OA 1BVRA 2WVGA 3DLCA 5ECDA 3SBOA 1W47A 5CFLA 3NP9A 4YUZA 4C2UA 4MRSA 5THQA 1E94E 2WNHA 3PD0A 5BN3B 2XUQA 3QVGA 1D8AA 4AVYA 1J0XO 2J4DA 3OUZA 1XMVA 3KPVA 4MUEA 4BWGA 4LJRA 3TOSA 3RVPA 4DEVA 5BSEA 1RAGA 3EGDA 5FWYA 2CMGA 1XDWA 2GA8A 4O0LA 4OTZA 2AOUB 2O05A 1KGDA 4V0ME 4X6UA 3UW1A 3KLMX 4MWZA 3F4KA 4NBVA 4D4KA 3GDOA 1H6CA 4LJLA 4YYEA 1XKXA 4MW2A 1P45A 1RLUA 1OA0A 1CQZA 1GPH1 2I55A 1E0KA 1J8VA 2X0IA 2ERXA 5J5AA 3T3DA 1MIHA 1GNTA 3BXXA 2GZMA 4OAPA 1ZCFA 1E2UA 4TMXA 4E11A 3TRDA 5LKRA 4ITUA 2PMKA 5DE3A 3L7AA 1LJLA 1KQGA 3ZY4A 4BVLA 4I1RA 4KQEA 3NIGB 4LOLA 4DMMA 2PKWA 3TZEA 5IJ0A 3AEQB 4YCLA 2W4MA 3REOA 2CXXA 2ZYGA 3L3BA 3W7BA 3ZCRA 3C3KA 4CM8B 1BCRB 4DM7A 1WU7A 5I48A 1F17A 1EWQA 2QTLA 3N70A 2AYXA 4YJFB 4JJZA 4OHKA 1RIIA 1N4AA 3WTBA 2AG5A 4IFBA 4LHVA 1GEGA 2YIJA 4QL3A 4N3BA 3ZOKA 1FFSA 1WABA 2C4KA 2WF6A 5K8TA 1PW7A 2I22A 3COVA 4C6TA 3HBFA 1ZOSA 3WIBA 4D8VA 2O23A 5CFMA 2H6EA 3RVNA 4KUEA 4AC9A 4IIEA 1EDDA 1E9VA 5AUNB 4PCVA 1TJ4A 3DHEA 3VFDA 1OI3A 3NBFA 5E6UB 4F4FA 2EW8A 4ND2A 1KYYA 3Q5DA 5CT5A 3QUQA 4YJ2F 2VDRB 2D7DA 4EYGA 1UDCA 2FUCA 4BXOA 3R20A 1A7KA 2VYCA 4F4IA 2F7SA 4EYSA 2R85A 3I30X 2AOUA 3HZOA 1P7PA 3IUJA 3PL5A 4GX0A 5FWYB 1M6YA 3A9UA 3DE2X 4HQ0A 1UJBA 4LJKA 1PYDA 1V8BA 4MKGA 1JG2A 2B83A 3S2IA 3TZKA 3I32A 4MW4A 3U3OA 5LD2C 4MKFA 1U7WA 3WHIA 3R6GA 2C98A 1MQ9A 3HB5X 1UZUA 4JGIA 4CKCA 3TQSA 2AUTA 3PWZA 5FOSA 4LY0A 2CNBA 2GJSA 1R0WA 2DUMA 2RIPA 3HYTA 3HWX1 1PVVA 4PX3A 5ESWA 5EYPA 4ZOEA 2C8VA 2G7ZA 5AVOA 4DUGD 1J0CA 5LDHA 1YULA 1V37A 1JDPA 4M83A 5A06A 2NO5A 2EYUA 2WT8A 1AKMA 3FJ1A 1OI7A 4GI5A 5B4UA 3PR3A 4ITRC 4AMZA 4P38A 1T3LA 4A5OA 1GR0A 5FO0A 3Q7QA 2AZ4A 2COKA 4S35A 4EO9A 3DL0A 1IWOA 3KEMA 3EZFA 4WZAA 3RLIA 1P44A 2QTHA 4L76A 4CQLA 1ORVA 5IULC 4MHTA 2PE5A 1JKJB 1U2SA 2IJGX 2EGHA 3QHQA 4IUBS 3FNFA 4PZYA 2ZJZA 2WM8A 2QPAA 1KA9H 4J43A 3STTA 2IS1A 2WDPA 4GOJA 5BQPA 3NAZA 1ODTC 3R3YA 1BNCA 2HH9A 5AH0A 1NN0A 2G6TA 3B6KA 5GJBA 1J00A 3HNOA 2ZRDA 4CLEA 3N6VA 3ADBA 3FMPB 3B82A 2FSUA 3RFCA 3OQIA 4NENA 1ML4A 1YHZA 4A82A 4B75A 4Q9IA 1USWA 3S1SA 1V1RB 1VL8A 1KMHA 2QX4A 5EJAA 1SQGA 2DCUA 3BT7A 4RV5A 1KJNA 2LR0A 2YWDA 1UMCA 4RZUA 3I58A 2AF4C 2ZSFA 2JJYA 3S1LA 2PV7A 4FQ8A 3EIWA 4JI5B 3VVMA 3UJ6A 4XWOA 1GUZA 3MVEA 3S55A 1IBCA 4WY8A 4EMSA 3FWPA 4TXLA 3ZY6A 4D1YA 3A6PC 3V3TA 4HB4A 3VTKA 3RVDA 1EX9A 3CPHA 1J4AA 2GF9A 2ECOA 1G1AA 2DYKA 1YRLA 3AVYA 4DNFA 2Z9DA 3RVOA 4K6GA 1MU0A 1IDN1 1VMEA 4CFZA 1GQYA 2HJHA 3EGXB 4W5RA 3ONWA 3NVMB 4P35A 4XYEA 1IZ8A 2NNWB 3BM5A 1Z8DA 3ETEA 4L4RA 5EIBD 3W5BA 4ZAYA 4RM2A 2CLCX 3PHJA 4OI4A 3IDZA 3SBDA 3FWKA 4PS0A 3U37A 4F04A 1YRAA 4MUBA 3IE1A 2AQHA 5A4JA 3GJ7A 1W30A 4DLBA 4F4CA 1PNVA 2ACKA 4Q4DA 2B0CA 3ZE0B 1CS0A 5K0EA 4FHGA 1QIHA 4WGFA 2I3AA 3WKBA 3GVPA 3EDOA 3GWZA 3IDAA 4LJ4A 4CG2A 5M04A 5EUBA 4GGOA 4MUMA 4WZBA 3W6UA 3R7LA 1Z7YA 4MV1A 3CVVA 1N5KA 5CIWA 3QEBZ 3A2MA 1BJRE 3V8NA 1NSTA 1TA9A 5AWFC 1M1UA 2VH2A 1N2GA 5FOVA 4H60A 4AJHA 3TUIC 2Z56A 4AROA 4UHCA 1P4RA 1CJMA 5BNTA 3NTLA 2PFSA 2PO5A 2W43A 3V1TC 3X43A 4UPVA 1UBUS 1R9JA 4HDNA 4RAQA 3NHRA 2VZ9A 1RAEA 1SFRA 2KJQA 2VF7A 1YR2A 4WDRA 5J59A 4QLAA 2P27A 2QRNA 3DOFA 2QKYA 4KR3A 2GJKA 2XMDA 1M2HA 3EZ7A 1O9HA 1O96B 2YJ5A 3DUFB 1JR3A 1K7YA 3LBYA 3L7YA 3BA1A 1KZ4A 2EEPA 3T0FA 4EGFA 3FBWA 4YCCA 5KYUB 4TYWA 4CF6A 3ZWOA 4PNPA 4ENRA 3OJXA 2XJ9A 3HDTA 4YRRA 1XPJA 2BE7A 5F1OA 1U1GA 3EHEA 3Q40A 2FQYA 1IPFA 4XEHA 3F3SA 1Y8ZA 4G5XA 4MV4A 1UZMA 2CV2A 3LL4A 4G85A 2O7RA 4NFSA 3NYRA 1SVIA 2BTEA 5DCWA 1P17A 1Z74A 1DVRA 2FPSA 2VK8A 3L1UA 4BVEA 4BZWA 2QRVB 3UMGA 1B6TA 4MI3A 5TT0A 1Z68A 4UCXA 4R9UC 2MIIA 3ODPA 3OZGA 1NVVQ 2VYVA 1IDOA 4HJRA 1AMOA 5F51A 1VHLA 3GH1A 4PG6A 3BEOA 4QEZA 4UMVA 2IY8A 4G0WA 1H85A 4D0RA 5DNCA 3ZHXA 1C80A 1MJHA 3AY3A 4BKPA 3F5SA 3RO7A 2HHLA 5AI5A 2WR8A 1CQPA 4KLRA 4MGEA 1H8ED 3LLSA 3W2TA 1JH9A 3BSYA 5FI5A 2DP4E 3S29A 2PO7A 3AQ4A 2E4YA 4CIDA 4Y2RA 5AVRA 4FYXA 5EI5A 4BO6A 1U7TA 5TC4A 1GTZA 4DR4B 3WB9A 1F0YA 2V98A 3IPRA 3BWMA 4P0TA 4UHHA 4W7SA 4B7UA 1CPYA 2QA5A 3O1IC 4L0MA 5HRCA 1K4MA 3B3QA 4K9OA 4Q02A 4U7TB 5DMXA 3ZZ0A 4BC1A 2P90A 2XUZA 2GHTA 1C41A 1XK7A 2AFVA 1MC8A 4LWZA 4ME6A 2ADMA 2HA4A 5JYDA 4XX0A 4RESA 2XNHA 2B1QA 5JIBA 1GKYA 3RYFB 1Y4UA 2GOYA 3A37A 3ILHA 5H16A 1HLDA 2BM0A 1AF7A 3FKSA 3N07A 4HP8A 3W8FA 3CZ9A 4JFRA 4D42A 1QS0B 2IQ5A 4QBKA 4BLQA 2JDID 2G76A 3BGWA 2RH5A 1VHTA 3OQJA 3SIPA 4BFSA 4BVAA 4PICA 5CEEA 1J0EA 1T4CB 4KXUA 5A62A 5LDDC 5IBPA 4A0SA 2Q8NA 4X8OA 1KDOA 1ADBA 2P0EA 4EO4A 3CZMA 1NVMB 3H5TA 3WQHA 1Q74A 4P31A 3K70C 1R5JA 2CZCA 3GNQA 4H9GA 4UM7A 2HLPA 4BNGA 5C7YA 3KLOA 1IN5A 4P3PA 2W2XA 4FYPA 2D0IA 1CUWA 3IFSA 2ZEJA 3R5FA 4EBFA 3RFFA 3OZBA 5FIUA 2IGBA 3WSVA 4Y2TA 1U0OC 1KPIA 5LP1A 2BD0A 2DWQA 1C3JA 1D5WA 5J63A 4UMDA 2ZUFA 1IBMB 1HL7A 1HSZA 1NGSA 2HB6A 1T2FA 4XLTA 4YUWA 2J45A 3EZLA 4G37A 4Y7DA 1ECFA 1VB3A 1L5HB 1NF8A 1QV9A 1SA0A 1ZN7A 1V2HE 3JQ7B 2GBLC 1FW8A 3STUA 3NWOA 4OF4A 4AZ0B 1H4QA 2A9FA 3IUQA 4O29A 3TMAA 5B7NA 2NYUA 3E61A 3SF0A 3TLZA 3UOGA 4ZQEA 4RL4A 3TUZC 1P2VA 2XMRA 4OQ4A 5LLDA 4Z7JA 1FMJA 2PAAA 3PKJA 4H7KA 3VH3A 2RK4A 1MENA 4CQNA 3DGEC 5A5VA 4DIBA 1GQ2A 4Q9NA 4FFMA 5IC4A 1U8ZA 1GILA 4QVKA 4A36A 1TQ8A 3K0HA 4ARSA 2JIZD 1HT0A 3CYFA 2DJIA 5G3ZA 3VU0A 1JQEA 1PGNA 2FPMA 1YJ8A 1QLWA 3HSYA 4PC2A 5B1EA 3FDXA 1OPXA 2EC5A 5TGTA 1PL6A 2XF8A 2XGSA 3BFVA 1F6BA 2PQ2A 1V8PA 1O6FA 3AW8A 4CWAA 1DIHA 2XXAB 2JKVA 2W00A 5MFZA 3HVHA 2RI0A 3E22A 3IEVA 3IAUA 2P2CA 2XUIA 1R0YA 3OZAA 1GM5A 3TLYA 1PSWA 2ZIFA 2EHJA 2HIMA 2JKZA 2V5VA 3AOEC 4KDFA 4EHLA 2C3PA 2QE7D 2ZRQA 3T5BA 2H4WA 5A6SA