3G2YA

Ctx-m-9 class a beta-lactamase complexed with compound 1 (gf4)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
b'ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g2yA00
4UA6A 3FKVA 1FSWA 2XD5A 1TDLA 3WRTA 5DVAA 4QHCA 4E3IA 1MY8A 3A3EA 4IBXA 1XPBA 1LI9A 2JCHA 2WGWB 3N8SA 4R3JA 4WM9A 5FAOA 1Q2PA 5FATA 1G68A 3W4PA 2PU2A 1NYMA 4E6WA 3C5AA 2JE5A 3BRMA 4S2LA 4LV2A 1PWGA 3JYIA 5HAIA 3DW0A 4X6TA 2IWDA 3E2KA 2ZM8A 4FD8A 4S2NA 1ES4A 3HREA 3N7WA 4KG2A 4WZ5C 3HUMA 5M1AA 4XUZA 1GA9A 1BLCA 1SDNA 4X69A 1KVMA 1K54C 4UHUA 5FI6A 5FI2A 2G2UA 4BLMA 3IXGA 1BSGA 1KDWA 2ZQ8A 2WUQA 4GN2A 4R4SA 1ERMA 2Y2OA 4A5RA 1BLHA 1AXBA 1XGJA 5F83A 3UDFA 4HBTA 3HBRA 5FAQA 5HAQA 2WZZA 1S6RA 1XA1A 1M6KA 1TEMA 4OLGA 2EFUA 3IHAA 4ZBEA 3ZNTA 1PZOA 2J7VA 1EWZA 3EQUA 1EROA 4X55A 3NC8A 1K55C 4JXSA 5GLBA 1I5QA 3VSLA 3UPPA 5HW3A 1RGZA 2EX9A 3G32A 3IQAA 3VP0A 5FSRA 4U3TA 1SCWA 1MXOA 2PU4A 5AQ7A 5DTSA 1IYSA 5DTTA 4WELA 4Y7PA 4MNRA 2Y4AA 4U0XA 3WRZA 1K25A 4E3OA 3GR2A 2Q9MA 5TFQA 5A93A 4WMCD 4Y0OA 3EQVA 4OH0A 3V3RA 3OCNA 1WYCA 2JBFA 2XQZA 1YLZA 2CC1A 4PM6A 5E2FA 3G31A 4S2OA 5HX9A 1RCJA 4YFMA 4GKUA 4DKIA 1K6SA 4BL2A 2Y59A 4GDBA 3RJUA 4RVAA 3DTMA 3SH7A 4DDYA 3Q7VA 2Y2IA 2VGKA 1FOFA 3HUNA 2DCFA 4OP5A 3HLEA 1HZOA 3CJMA 4OOYA 3S4XA 3SH8A 4RX2A 5JYOA 1JTGA 1ESIA 5JYPA 4KZ6A 2XR0A 4ZJ3A 2RCXA 3PBQA 1CEGA 3G34A 4RA7A 3UE3A 3P09A 3G30A 1YMXA 3C7UA 4OP8A 3P98A 4QY5A 1H8ZA 4XXRA 1BZAA 4ZAMA 1TVFA 3A3IA 4N1XA 4FSFA 2HP9A 2V20A 2BLSA 4KQOA 4K91A 4X68A 5F82A 4C3QA 4C6YA 2OV5A 4H8RA 5E43A 1YQSA 3TG9A 4Z9QA 3PAGA 3PBSA 4DDSA 4EBPA 1K55A 3WS2A 5E2GA 2HDRA 3A3JA 3BLSA 3PBNA 4KG5A 4OKPA 2A3UA 5EVIC 1EI5A 2H5SA 4EWFA 5GLDA 1K4FA 3BECA 3N8LA 5CTNA 4FH2A 4KZ7A 3GMWA 3O87A 3BM6A 3VFHA 2X71A 4KZAA 5GLAA 4U0TA 1JTDA 2ZC7A 4UA7A 1MBLA 3VP1A 1H8YA 2WAFA 3LO7A 1PZPA 2ZQDA 1H5XA 1K57C 1L0EA 3FWLA 2C5WB 5FQIA 4LCMA 2UWXA 4GD8A 2XDMA 3M2JA 2J8YA 3DWKA 3QNBA 1XKZA 5CHUA 4LV3A 4N92A 2H0TA 4R4RA 3O3VA 1ES2A 4LV1A 5CGWA 2P74A 5FI7A 3S22A 2P9VA 3OPHA 5A90A 3LY3A 2X01A 2XLNA 1N9BA 5HL1A 3WS4A 2OLVA 1KGFA 2HDSA 2RL3A 3D4FA 1PI4A 4KZ9A 4P87A 1BT5A 4BD1A 1PW8A 2HPBA 2WAEA 2Y55A 3BFFA 2Y2NA 4N9LA 5EECA 2FFFB 2XF3A 3MZDA 3ZVWA 3AGFA 3BFDA 3IH8A 5DF8A 4EBLA 4KZ3A 5HAPA 1W8QA 4HBUA 4MLLA 4OOLA 4R0QA 1FSYA 2ZQ7A 4GOGA 1W8YA 5L2FA 1W79A 4KENB 3V50A 3M6HA 4WEJA 1O7EA 1BLPA 4OLDA 3ISGA 1KVLA 5EVIA 5F1GA 5CEDA 3ZG5A 1ZC2A 4R23A 2Q9NA 2DNSA 1IKGA 1L0FA 3MXRA 4B88A 5CEBA 1MWRA 1K38A 4PPRA 3UDIA 4JXVA 3UE0A 1KGGA 2B5RA 1CK3A 4JF4A 3IXHA 1YLWA 2PBYA 3FV7A 3IF5A 3G2YA 4N1HA 4DE3A 1IELA 1Q2QA 1E3UD 1K57A 2EX2A 4JBFA 4WEKA 5A91A 5HFOA 4BENA 5CRFA 1OMEA 1GHPA 2Y2KA 1YM1A 1Y54A 3CMZA 3FKWA 5IHVA 4JKTA 5TR7A 3C4PA 5DF7A 3UNWA 3ZDJA 3G35A 4P85A 4S2IA 3RXXA 1JWVA 4Y0UA 1E25A 3S1YA 3ZG8B 3B3XA 3PAEA 5AQBA 2BG1A 2EFXA 3Q07A 5AQ9A 4JPMA 3W4OA 1XGIA 5FQ9A 3IF6C 2OLUA 3SS5A 1ZKJA 3MKEA 1IYQA 1YT4A 3IWIA 4DXCA 4L0LA 4IBRA 1LI0A 1DJAA 1KE3A 1K56D 3NDEA 5FQQA 2ZQAA 5CGSA 4QB8A 3ITBA 5GHZA 1NY0A 2Y91A 5CTMA 2I72A 3LEZA 3HLCA 3ZG7B 2ZLYA 3GSGA 4BL3A 1YLTA 1W5DA 5GHYA 3OPLA 2VGJA 3CG5A 5CHMA 3UY6A 2WGIA 2ZC4B 5E2EA 3WWXA 5HARA 4BQMA 2EX8A 3BYDA 3NIAA 4WZ5A 3N6IA 1ESUA 1DJCA 2XEPA 1K54A 3IWOA 3V3SA 3OZHA 1ZG6A 2ZQ9A 1KE4A 2ZQCA 1IYOA 3GQZA 4GD6A 3NBLA 5G18A 3LCEA 4KG6A 2ZC3B 1LL9A 1HVBA 2XGNA 5KSHA 2XH9A 1PWDA 4GDNA 5GL9A 2ZM0A 5AQAA 1I2WA 4KZ4A 4M3KA 5EPHA 5KSCA 3A3DA 1FCOA 2ZC6B 3ZHHA 3WS1A 3UPNA 4C75A 3AGDA 3VOZA 2Y2PA 4CJNA 4OPYA 3QHYA 1WE4A 3OPRA 3SS3A 3A3FA 3IWQA 2Y2HA 1IKIA 4IVKA 3OC2A 3TSGA 4DE2A 1NZOA 3N8RA 4GB7A 1HD8A 2G2WA 1FQGA 2WK0A 5FA7A 1PWCA 3ITAA 3VP4A 3OCLA 4E3JA 1GA0A 1FR1A 1XA7A 5M19A 1KDSA 4PM7A 3G4PA 3PTEA 5EOEA 1NXYA 2ZM2A 4JF5A 4PM9A 1BUEA 2WGVA 3NI9A 4E3KA 3Q7VB 3PBRA 4PM5A 2WGWA 1U60A 3MFDA 2EXBA 5A92A 1XX2A 2HDUA 3DWZA 3IH9A 1G6AA 1SKFA 2OSUA 4LV0A 3MZEA 2R9WA 5GLCA 2H10A 4S2NC 3Q81A 3GVBA 3RXWA 2XFSA 4WMCA 5KMWA 4LCLA 4OPQA 4O7DA 1W7FA 4PMAA 4CPKA 5CHJA 2Y2QA 5M18A 3PBOA 3E2LA 2H0YA 4MBHA 1MPLA 5KZHA 5GHXA 5I94A 3TOIA 2C6WB 3SS4A 3ZFZA 1DJBA 1ES3A 3HVFA 4WBGA 3HLBA 4JXWA 4BD0A 1ERQA 3MBZA 3BFEA 4B4ZA 4R3BA 4KZ5A 3UPOA 4IVIA 5CECA 4DE0A 5TGFA 3UO9A 4JXGA 5BOHA 3IHBA 2XK1A 4KZBA 4PM8A 2XFTA 4OOMA 4YINA 2Y2MA 1JWPA 3UDXA 1RGYA 1S0WA 4E3MA 1I2SA 3Q82A 1ONGA 3OPPA 4EBNA 3W4QA 4OQ0A 4X56A 3FYZA 4OVDA 4BJPA 4KQQA 2DRWA 1E4DA 4N9KA 2P9VB 5U47A 1L2SA 1PW1A 5FQKA 1MWSA 3VOYA 4DRTA 3N4IA 4E3NA 3NDGA 3WS0A 3MKFA 1M40A 3V39A 2XD1A 3BEBA 3HLFA 4B4XA 1MWUA 3ZCZA 2EXAA 3LY4A 3NCKA 1LHYA 4OQGA 2ZMAA 1LL5A 1IYPA 3HLGA 1NZUA 4GNUA 4UA9A 3VSKA 1PYYA 1ONHA 3GV9A 4K0XA 4Y0TA 4MBFA 2FFYA 5EVLA 2X02A 3NY4A 2QMIA 3HUOA 1RP5A 1YLYA 1DY6A 2QZ6A 3V5MA 4NETA 4ZTKA 1MWTA 4P6BA 3HL9A 4OQHA 1VQQA 5EVIB 1L0GA 2WKEA 3CZDA 4IEDA 4XUXA 1LLBA 5CGXA 3ZG0A 1KGEA 2WKIA 2Z2LB 2HP5A 2HP6A 3W8KA 1FCNA 3HLDA 3BFGA 4QY6A 2WZXA 3Q7ZA 4WZ4A 1WYBA 4E3LA 1NYYA 1QMFA 1VM1A 4JLFA 1NJ4A 1CEFA 3O88A 3IT9A 1ES5A 5DTKA 4MBKA 3VMAA 1C3BA 2ZJ9A 4K0WA 1NRFA 2J9OA 4EV4A 4S2MA 5DF9A 2Y2GA 4KZ8A 4F94A 1QMEA 1MKIA 1GCEA 4S2KA 5J8XA 4FH4A 5EUAA 1L0DA 1XXMA 2ZD8A 1TDGA 4HESA 2V1ZA 3FZCA 1Z6FA 3C4OA 3IF6A 4NK3A 4OONA 3IXDA 1E3UA 1CI9A 4X53A 2JC7A 4ZJ1A 5E2HA 4DF6A 3ZNYA 3MXSA 1XP4A 3GRJA 3PBTA 4MEZA 4RYEA 1YLPA 3I7JA 3IXBA 1IEMA 1K6RA 5EVID 2WKHA 3M6BA 4KQRA 3BLMA 1J9MA 2EX6A 4GZBA 4Q8IA 2QPNA 4OPRA 5CERA 1KE0A 3VP3A 3GTCA 4QJGA 4UAAA 4E6XA 3VP2A 2Y2LA 3QNCA 4S2PA 4D2OA 2ZC5B 1GHMA 5EE8A 3BFCA 1YMSA 2E8IA 5F1FA 1K56A 2J9PA 2V2FF 3M2KA 1BTLA 5FASA 1HTZA 3ZVTA 2HDQA 4S2JA 4DE1A 4QD4A 4R1GA 5CXWA 3UN7A 1SHVA 4EQIA 3HLWA 3VFFA 1SDEA 2WYXA 2R9XA 3WS5A 1K4EA 1ALQA 1JWZA 3G2ZA 2IWBA 1FCMA 2A49A 2WADA 2IWCA 4FCFA 4OPZA 5FDHA 2Y2JA 4HEFA 1BULA 1JVJA 1ZG4A 1PI5A 4ID4A 5FQJA 3O86A 3Q1FA 4LENA 1PIOA 4ZJ2A 3IF6B 3ZG9B 3AGEA 1FR6A 4QU3A 1O07A 4EUZA 1BLSA 2GDNA 3ZGAB 4OQIA 3UE1A 4DXBA 4JF6A 1N4OA 2Z2MB 1GHIA 4WYYA 5D3OA 4ZDXA 4P0MA 3SOIA 4RX3A 5FQMA 5EOOA 5FAPA 3MZFA 1YLJA 3SH9A 3C7VA 1CI8A
chains in the Genus database with same CATH superfamily
3EEAA 4UA6A 3L7HA 3WRTA 4R3JA 5FAOA 5FATA 2W3GA 1Q2PA 1G68A 1NYMA 1P9WA 2OAQ1 5L07A 4JGRA 4YNRA 3KYQA 4CQHA 5L8MA 3UE6A 3N7WA 4KG2A 3HUMA 3KSFA 4FOFA 1SDNA 4BMWA 4GS9B 2G2UA 3IXGA 4A5RA 1AXBA 3EGDC 4HBTA 3HBRA 1S1YA 1S6RA 1XA1A 4OLGA 1TEMA 3IHAA 3ZNTA 2Z6DA 3EQUA 2V1BA 4JXSA 5HW3A 2EX9A 3G32A 4U3TA 2PU4A 4WELA 4E3OA 3GR2A 3NHQA 3V3RA 1WYCA 4ME4A 4EETB 4Q0HA 5HX9A 4LFUA 4BL2A 2Y59A 1V9YA 5HSQA 1NRJA 1FOFA 3HUNA 2DCFA 5JYOA 1ESIA 2XR0A 4ZJ3A 2RCXA 1CEGA 4D60A 3G34A 1AWIA 4RA7A 3MQOA 4QY5A 1H8ZA 5HWTA 4N1XA 2V20A 4C6YA 3R7WB 2PRFA 4H6JA 4H8RA 5E43A 4Z9QA 4EBPA 2W3FA 3HCYA 4NXFA 2HDRA 4EQ1A 1K4FA 4KZ7A 3BM6A 1MC0A 3CI6A 1H8YA 4B93A 2PBDP 2ZQDA 1H5XA 4CLCE 1W63Q 2VJWA 2J8YA 1XKZA 3O3VA 5CGWA 1MZUA 2X01A 2XLNA 2ACGA 1VHMA 3HJKA 2JHEA 2V9AA 4P87A 2J80A 4BD1A 1PW8A 2WAEA 2LB5A 2Y55A 4G3KA 2Y2NA 2VV6A 2FFFB 2XF3A 5DF8A 4IHQA 3T4TA 4KZ3A 4HBUA 4OOLA 1FSYA 2O9CA 1O7EA 4OLDA 5EVIA 1ZC2A 5TBMB 2DNSA 5HD5A 1K38A 4HJ3A 3UE0A 1CK3A 4JF4A 1YLWA 2PBYA 1GSVA 1DP6A 3CITA 1Q2QA 4BENA 1UWPX 5A91A 5HFOA 1GSXA 5CRFA 1GHPA 4Y3IA 5IHVA 5DF7A 4YWZA 2M7VA 3ZG8B 4EXOA 2LB9A 5AQ9A 3EOIA 2JKGA 1ZKJA 1YT4A 4L0LA 1LSVA 4IBRA 1LI0A 4PAUA 4ARZB 5IT5A 1WA9A 1DJAA 1STZA 3LEZA 2V1AA 4BL3A 4EU0A 5GHYA 1D06A 3BQ8A 2VGJA 5CHMA 2IA2A 2ZC4B 5E2EA 3WWXA 5HARA 2EX8A 3NIAA 4WZ5A 3N6IA 1DJCA 2HF6A 2XEPA 1ZG6A 1T18A 1HVBA 2XGNA 5KSHA 1PWDA 3DAVA 4M3KA 5KSCA 1FILA 3ZHHA 3A0VA 3WS1A 3VOZA 1XFQA 2EWVA 2Y2PA 1VETB 4CJNA 3T1SA 1WE4A 3A3FA 4IVKA 3TSGA 3N8RA 1HD8A 2G2WA 4KQDA 5EM0A 1GA0A 1FR1A 1XA7A 2O99A 4PM7A 2VGLM 5HDDA 1H0MA 4E3KA 2W3EA 4PM5A 1XX2A 2HDUA 3DWZA 3IH9A 1G6AA 1SKFA 2OSUA 3LR5A 2YKHA 3BQAA 2H10A 4GLQA 3TW8A 4CPKA 2Y2QA 5M18A 3PBOA 1XJ6A 4MBHA 3ZFZA 2B95A 5CX7A 4B4ZA 1T19A 3UPOA 1N9NA 4WL9A 3RFBA 4DE0A 3UO9A 4JXGA 3DTIA 1CJFA 4PM8A 1G5UA 1K0KA 4OOMA 4GW9A 3OPPA 3FYZA 2ZOHA 1E4DA 2P9VB 4HP9A 4DRTA 3N4IA 4NKPA 3NDGA 4E3NA 3H82A 4RQ9A 3IBRA 2EXAA 4AFIA 4MN5A 1IYPA 3HLGA 3ZQ5A 3VSKA 1PYYA 4K0XA 2FFYA 3NY4A 5AJGA 3HUOA 4P6ZS 3NOTC 4ZTKA 1MWTA 4IEDA 1LLBA 5CGXA 3ZG0A 1KGEA 3W8KA 2Z2LB 4QY6A 3Q7ZA 1WYBA 1NYYA 4JLFA 1NJ4A 3O88A 3FPWA 2J9OA 4EV4A 3ULFA 5DF9A 2Y2GA 4MN7A 4UEYA 4R3AA 5EUAA 2V1ZA 3C4OA 2WKQA 3IXDA 4Q0JA 3O5YA 4DF6A 3T4QA 4RYEA 3F1NB 2VV8A 2WKHA 4QPRA 5G4ZA 4KQRA 2ZL1A 4KUKA 1J9MA 1OTDA 4GZBA 3QP8A 2QPNA 2W27A 3VP3A 1KE0A 2GZAA 1SKOB 3MF0A 3LEQA 3K3DA 1T1CA 4K08A 1OJ5A 3UB7A 3BFCA 1YMSA 2E8IA 3D3OA 2J9PA 3M2KA 1BTLA 3ZVTA 4DE1A 2GX5A 5CXWA 3UN7A 1SHVA 1SDEA 2R9XA 4CLCA 2P04A 1FCMA 5FDHA 3TE8A 1BULA 4EUVA 1JVJA 1PI5A 1YAXA 5FQJA 3O86A 1PIOA 2ZBBA 3IF6B 4QU3A 2VX8A 4NXEA 1O07A 4YOFA 4LRYC 1N4OA 4WYYA 1OTEA 3SOIA 5FQMA 3T4KA 4HIAA 3IX4A 3VOLA 1TDLA 5DVAA 4E3IA 1OPXA 1HLUP 4IBXA 2JCHA 3FG8A 4EW7A 3W4PA 2PU2A 3BY9A 2JE5A 3BRMA 1PWGA 1P97A 3DW0A 4BBUA 2IWDA 4FD8A 4S2NA 3HREA 1BYWA 4LPZA 4XUZA 1Y4OA 1KVMA 1K54C 2VZWA 5FI6A 2W1TA 3LIEA 3E4OA 1BSGA 2ZQ8A 4R4SA 1ERMA 2Y2OA 2VLGA 2FZ0A 1XGJA 5F83A 5HAQA 4WLAA 4ZBEA 1EWZA 3NC8A 3MQ0A 3VSLA 1CF0A 1S67L 5DFYA 1MXOA 5DTSA 4Y7PA 2XA7M 4MNRA 2Y4AA 4U0XA 5EVEA 4Y0OA 4HJ4A 3LI9A 4OH0A 2JBFA 4DJ2A 4LRXC 2XQZA 1YLZA 2VV7A 4PM6A 5E2FA 4S2OA 3S7NA 1RCJA 1F2KA 4GKUA 4DKIA 1K6SA 3QP2A 4GDBA 2P08A 3Q7VA 2Y2IA 4OP5A 4MMNA 3HLEA 4LRZE 2H28A 2K7SA 3LUQA 4HH3A 3C7UA 4ZAMA 1TVFA 5F82A 4X68A 4C3QA 2VK3A 3TG9A 1YQSA 3C30A 3PBSA 4DDSA 3IS2A 4Q0IA 3WS2A 5E2GA 3A3JA 3PBNA 2QHKA 1EI5A 4EWFA 5CTNA 3VP1A 2ZC7A 1MBLA 2WAFA 3LO7A 1PZPA 4IUKA 1K57C 1L0EA 4LCMA 2UWXA 2G7UA 3M2JA 4N92A 2H0TA 1P0ZA 4LV1A 2Z6CA 1LL8A 3S22A 3QP1A 3LI8A 5HL1A 2HDSA 3F1OA 2CMNA 4ETZA 4KZ9A 1BT5A 4ZRRA 3T1XA 4G3VA 5EECA 5FDSA 3T4LA 4E04A 3BFDA 3IH8A 1ODVA 3KYZA 5HAPA 4JGOA 4MLLA 1NWZA 2INWA 4KENB 1BLPA 5F1GA 4R23A 2Q9NA 4FTXA 5CEBA 3UDIA 4JXVA 2L1MA 2B5RA 4EBLA 1IELA 4JBFA 4WEKA 5DKKA 3H7WA 2Y2KA 1Y54A 3UNWA 5TR7A 3ZDJA 4P85A 1FIKA 3RXXA 1JWVA 4Y0UA 1E25A 2XSSA 3S1YA 3MXQA 5AQBA 3OOVA 2VGLS 5FQ9A 3IF6C 2OLUA 3MKEA 2XRNA 3CAXA 3IWIA 5IS1A 3NECA 1K56D 2WKRA 2HV1A 5CGSA 2A24A 5HPFA 1NY0A 4I3JA 3HLCA 3CUEC 2ZLYA 1TF1A 1YLTA 3FC7A 4HHDA 1W5DA 2UV0E 4ESPA 2WGIA 3BYDA 5FL3A 3V3SA 2ZMVA 2ZQ9A 5G18A 2BTFP 3LIDA 3P01A 4BBTA 3QP4A 4GDNA 5GL9A 4KZ4A 5EPHA 2HGVA 2QKPA 3UPNA 3AGDA 4PKYA 2M7UA 1X0OA 3SS3A 3IWQA 1IKIA 1VEUA 4DE2A 1FQGA 5FA7A 1PWCA 3ITAA 4E3JA 4X1LA 1S66L 3PTEA 5EOEA 2ZM2A 4PM9A 5KIZA 1YPRA 3CWFA 4R6LA 4B9OA 5EM1A 3IBJA 1OJGA 2EXBA 5GLCA 5LBRA 2XFSA 4OPQA 4O7DA 5CHJA 3EEHA 1A0KA 2H0YA 5KZHA 3T12B 3TOIA 4WBGA 4GS9A 1ERQA 4PKYG 4R3BA 1NLZA 3KX0X 3T1QB 5FEFA 2KOIA 1S4RA 5BOHA 3OLOA 1VB6A 4XT2A 2ZOIA 3Q82A 2YKFA 3W4QA 4OQ0A 5U47A 1MWSA 3MKFA 1M40A 3R4KA 2XD1A 3BEBA 3HLFA 1OT9A 3TJZC 3LY4A 2FH5A 2ZMAA 4GNUA 5I5LA 3GV9A 4Y0TA 4MBFA 2QMIA 1RP5A 1YLYA 2QZ6A 4NETA 4HI4A 4P6BA 3HL9A 5DFXA 2WKEA 3CZDA 2GNXA 2HP5A 1FCNA 2B18A 3HLDA 4I39A 1XJ2A 2J3TC 2WZXA 4WZ4A 3T50A 5F5YA 1QMFA 2M1CA 1TS7A 3D72A 3VMAA 4NXGA 5J4EA 1C3BA 2PYPA 2K2NA 3CHWP 4KZ8A 1QMEA 1MKIA 2PYRA 4O8GA 5F69A 5J7EA 4HP4A 3CPTB 4FH4A 2ZD8A 1XXMA 5HDCA 1CI9A 2W3DA 4X53A 4ZJ1A 3MXSA 1XP4A 3PBTA 3I7JA 3M6BA 2JKFA 3UMDA 4Q8IA 5CERA 3GTCA 3S7PA 4KUOA 1YSPA 2Y2LA 1GHMA 4HY8A 5EE8A 1HTZA 4LLOB 2HDQA 5G4YA 4NXBA 1P9RA 2WYXA 3RH8B 5TBMA 4OPZA 1ZG4A 3KSHA 3QP5A 4ID4A 2JN7A 3Q1FA 4LENA 2NUTC 1DP9A 1BLSA 3IX8A 2XA7S 3BJNA 1TS8A 2OWJA 4RX3A 5EOOA 5FAPA 4L9GA 3FKVA 1FSWA 3UB5P 4UQIM 2WGWB 4WM9A 4ARZA 4GHIA 1N9OA 4MDZA 3L9KA 4E6WA 4O0PA 4F3LB 5HAIA 4X6TA 3TRCA 3UB8A 1ES4A 2PAVP 4WZ5C 3SZTA 3F1PB 5M1AA 1BLCA 4X69A 4UHUA 2PR6A 3W2ZA 1KDWA 1BLHA 4IJGA 5TJJA 3UDFA 3BY8A 5FAQA 3ZYTA 2WZZA 1M6KA 2J7VA 4JGQA 4X55A 1F9IA 1K55C 5GLBA 1I5QA 1RGZA 3IQAA 1VETA 2JKRM 5AQ7A 1IYSA 5DTTA 3PXPA 4BWIA 3WRZA 1K25A 2Q9MA 5TFQA 5A93A 4WMCD 2QJ5A 2CC1A 3G31A 4YFMA 3RJUA 4RVAA 3DTMA 3SH7A 3MS6A 2VGKA 3CJMA 3LFVA 4KZ6A 2OWHA 3UE3A 3P09A 3G30A 4OP8A 4XXRA 1BZAA 4FSFA 4KQOA 4K91A 3LGOA 2W0NA 3DTKA 2OV5A 4OKPA 3BLSA 2A3UA 2H5SA 3LIBA 3BECA 3LIFA 3N8LA 4FH2A 3O87A 3VFHA 5HPIA 4KZAA 5GLAA 4UA7A 3BW6A 2Q0OA 4GD8A 2XDMA 5CHUA 3DWKA 4LV3A 4BBVA 4R4RA 3FPVA 5FI7A 3U4LP 2P9VA 4L9EA 1N9BA 2OLVA 1KGFA 2RL3A 3D4FA 1PI4A 4FUWA 3B33A 2HPBA 3BFFA 2HJ9C 5DKLA 1OT6A 3AGFA 3JVVA 3JPUA 1W8QA 4R0QA 1J3WA 2ZQ7A 1W8YA 5L2FA 1W79A 2NUPC 3M6HA 3V67A 3ISGA 1KVLA 3JVUA 5CEDA 3MMHA 3ZG5A 4PPRA 2GJ3A 3FV7A 2Y79A 3IF5A 4N1HA 2EX2A 1E3UD 1K57A 3LIAA 3HJIA 4I3AA 3CMZA 1YM1A 3FKWA 4JKTA 3C4PA 3G35A 4S2IA 5C5KA 2MJ6A 3B3XA 3PAEA 2BG1A 4JPMA 3W4OA 3SS5A 4Y13A 4DXCA 3KO6A 1KE3A 3NDEA 5FQQA 2ZQAA 4DN0A 3ITBA 3F1NA 5CTMA 2KX6A 3ZG7B 2PHYA 3MSHA 4I5SA 1IOUA 3OPLA 1SKOA 4HQAA 5F6AA 2QJ7A 1ESUA 1W63M 4O01A 3IWOA 4CLCC 1KE4A 2ZQCA 1IYOA 3GQZA 3NBLA 3SW1A 2ZC3B 1N9LA 4NG2A 2ZM0A 3B47A 3A3DA 2V0WA 1T1AA 3C8CA 2JKTI 3QHYA 1ZTUA 3OC2A 1NLYA 1F98A 3KYEA 2WK0A 3OCLA 5M19A 1KDSA 2R78A 3CUEA 3G4PA 1NXYA 5EFWA 1BUEA 1H3QA 1SZVA 2P7JA 3LICA 3PBRA 1U60A 4LV0A 4S2NC 3GVBA 3RXWA 5J3WA 1IFQA 4LCLA 1W7FA 4PMAA 1OTBA 2O9BA 3E2LA 2V8CA 4H6JB 4M4XA 5GHXA 3G6OA 3SS4A 1DJBA 3HVFA 3HLBA 1XJ3A 3OBFA 4IVIA 5CECA 3C38A 3EWKA 3IHBA 4KZBA 1OTIA 2HJEA 4YINA 2Y2MA 1JWPA 3UDXA 1RGYA 1S0WA 4E3MA 1I2SA 4EBNA 4X56A 4OVDA 3T4OA 2DRWA 2J3WA 2K31A 3VOYA 1XJ4A 1TS6A 1ZHHB 5IU1A 1S1ZA 5DJTA 3ZCZA 3NCKA 4OQGA 2VA0A 1LL5A 2J3TD 1NZUA 5EVLA 2X02A 1PNEA 3LR4A 3V5MA 3DTEA 1VQQA 5EVIB 1L0GA 4XUXA 1YSQA 3MQQA 4XT2B 4E3LA 4II7A 3GECA 1CEFA 3IT9A 4MBKA 4EEUA 2ZJ9A 4K0WA 1UGUA 4S2MA 4Y5FA 4F94A 3H9WA 2DMWA 2KDKA 4S2KA 1D1JA 2V0UA 1L0DA 4UQIS 1TDGA 4HESA 1Z6FA 4OONA 2JC7A 2A2LA 4HJ6A 3GRJA 4MEZA 1YLPA 3IXBA 1IEMA 1K6RA 3A0RA 5EVID 2D01A 2EX6A 4UAAA 3VP2A 3VE4A 2ZC5B 4L9FA 3MR0A 5F1FA 1EW0A 1K56A 3CLOA 3EGXC 4QD4A 1XFNA 3HLWA 3VFFA 2V8FA 1K4EA 5HL6A 1ALQA 2IWBA 2A49A 2IWCA 4FCFA 1DP8A 2Y2JA 3T1RA 3ZG9B 4JGPA 4I3IA 3UB6A 3PHYA 2GDNA 3ZGAB 4OQIA 3UE1A 4JF6A 5D3OA 4P0MA 1YLJA 3C7VA 1CI8A 1GCEA 2XD5A 4QHCA 1MY8A 3A3EA 1XPBA 1LI9A 3N8SA 2ZMFA 5HWWA 3GDIA 3C5AA 4S2LA 4LV2A 4Y2FA 3JYIA 4Y15A 3E2KA 2ZM8A 5L10A 3K2NA 1Z09A 1GA9A 4LGWA 5FI2A 2WUQA 4GN2A 2EFUA 1PZOA 3PYPA 3ICYA 1EROA 3NOUC 3R7WA 3UPPA 4GHIB 4HNBA 3VP0A 2D02A 5FSRA 1SCWA 3RTYA 4GJ4A 2I9VA 3H82B 4GCZA 3EQVA 3OCNA 2W3HA 1OTAA 2OAP1 4DDYA 4OOYA 1HZOA 3S4XA 3SH8A 4RX2A 5JYPA 1JTGA 3BWLA 3PBQA 1TD5A 3E0YA 4WN5A 1YMXA 3P7NA 3P98A 3A3IA 2HP9A 2BLSA 3E4QA 3KSIA 3UB9A 3KSGA 3PAGA 4DMZA 1K55A 4KG5A 1LSXA 5EVIC 4X1MA 5GLDA 2PR5A 4EEPA 3GMWA 2X71A 4U0TA 1JTDA 2BASA 3T4JA 3FWLA 2C5WB 5FQIA 4WUJA 2L0WA 2B02A 3QNBA 1ES2A 2VKSA 2P74A 3D9YA 3OPHA 5A90A 3LY3A 3WS4A 1L3LA 2ZL1B 3VV4A 2AVXA 2O0YA 3S7QA 4N9LA 3MZDA 3ZVWA 1TS0A 3E4PA 5HDSA 4GOGA 3V50A 4WEJA 5K5BA 4CLCB 3MJQA 1IKGA 1L0FA 3MXRA 4B88A 5A8BA 1MWRA 1KGGA 5DJUA 3IXHA 1DRMA 4DJ3A 3G2YA 4DE3A 4I38A 1OMEA 4BLMA 5L09A 2E8JA 3DBAA 1CQAA 4Y17A 4MN6A 2EFXA 3Q07A 1XGIA 3CPTA 2QYBA 4HOIA 1IYQA 4MCWA 1G6OA 4QB8A 5GHZA 2Y91A 3C2WA 2I72A 4CLCD 3GSGA 4IUHA 3CG5A 3UY6A 1F5MA 1LSWA 2W1TB 4BQMA 1PFLA 3B42A 3LR0A 1K54A 3OZHA 4GD6A 3NOPC 3LCEA 4KG6A 2PT7A 1LL9A 2XH9A 5AQAA 1I2WA 1FCOA 5AVFA 2ZC6B 2JKRI 4C75A 2L4RA 4OPYA 3OPRA 5HZHA 2Y2HA 4GB7A 1NZOA 3PR6A 3VP4A 5EV0A 4G3WA 2EA9A 4JF5A 4WF0A 2WGVA 3NI9A 3Q7VB 2WGWA 3MFDA 1D7EA 5A92A 5FEGA 1Y28A 3MZEA 2R9WA 4R70A 3Q81A 1G28A 5AVEA 4F3LA 4WMCA 2OOLA 2VEAA 5KMWA 1YKDA 1MPLA 3F1PA 5I94A 2C6WB 3QP6A 3IS2B 1ES3A 4R38A 4JXWA 2WKPA 4BD0A 3MBZA 3BFEA 4KZ5A 1PRQA 1S4SA 5TGFA 1T1BA 2XK1A 2XFTA 5MC7A 1ONGA 4BJPA 4KQQA 4N9KA 1L2SA 2Y8HA 1PW1A 5FQKA 3WS0A 3F1OB 2EWWA 3V39A 4NEED 4B4XA 1MWUA 2XROA 1LHYA 4UA9A 1V9ZA 4QWOA 1ONHA 3UMEA 1DY6A 3U2AA 4PHTA 4OQHA 3E98A 2WKIA 2PD8A 2HP6A 2KLIA 3BFGA 3A0SA 1ACFA 2HZ5A 3LR3A 1VM1A 3H7WB 3T4SA 1ES5A 5DTKA 5HD3A 1NRFA 2JKTM 5J8XA 4EERA 1JNUA 3FZCA 4NK3A 3IF6A 3VE3A 1E3UA 5E2HA 3NULA 2A24B 3ZNYA 1MKMA 3BLMA 4X25A 5HWVA 4OPRA 3K3CA 4QJGA 3S7OA 4E6XA 2O9AA 3LYXA 3QNCA 1LT0A 4S2PA 4D2OA 4EESA 4Z1WA 1GSWA 5F68A 2PD7A 2V2FF 5FASA 4S2JA 4P6ZM 4R1GA 4EQIA 1KOUA 2PDRA 3WS5A 1JWZA 4ETXA 3G2ZA 2WADA 3IX3A 4HEFA 1H8MA 4ZJ2A 4HH2A 3AGEA 1UWNX 1FR6A 4EUZA 2QWSA 4DXBA 2W1RA 1VEUB 3MFXA 2Z2MB 1GHIA 4ZDXA 3NJAA 3MZFA 3SH9A
chains in the Genus database with same CATH topology
4UA6A 3FKVA 1FSWA 2XD5A 1TDLA 3WRTA 5DVAA 4QHCA 4E3IA 1MY8A 3A3EA 4IBXA 1XPBA 1LI9A 2JCHA 2WGWB 3N8SA 4R3JA 4WM9A 5FAOA 1Q2PA 5FATA 1G68A 3W4PA 2PU2A 1NYMA 4E6WA 3C5AA 2JE5A 3BRMA 4S2LA 4LV2A 1PWGA 3JYIA 5HAIA 3DW0A 4X6TA 2IWDA 3E2KA 2ZM8A 4FD8A 4S2NA 1ES4A 3HREA 3N7WA 4KG2A 4WZ5C 3HUMA 5M1AA 4XUZA 1GA9A 1BLCA 1SDNA 4X69A 1KVMA 1K54C 4UHUA 5FI6A 5FI2A 2G2UA 4BLMA 3IXGA 1BSGA 1KDWA 2ZQ8A 2WUQA 4GN2A 4R4SA 1ERMA 2Y2OA 4A5RA 1BLHA 1AXBA 1XGJA 5F83A 3UDFA 4HBTA 3HBRA 5FAQA 5HAQA 2WZZA 1S6RA 1XA1A 1M6KA 1TEMA 4OLGA 2EFUA 3IHAA 4ZBEA 3ZNTA 1PZOA 2J7VA 1EWZA 3EQUA 1EROA 4X55A 3NC8A 1K55C 4JXSA 5GLBA 1I5QA 3VSLA 3UPPA 5HW3A 1RGZA 2EX9A 3G32A 3IQAA 3VP0A 5FSRA 4U3TA 1SCWA 1MXOA 2PU4A 5AQ7A 5DTSA 1IYSA 5DTTA 4WELA 4Y7PA 4MNRA 2Y4AA 4U0XA 3WRZA 1K25A 4E3OA 3GR2A 2Q9MA 5TFQA 5A93A 4WMCD 4Y0OA 3EQVA 4OH0A 3V3RA 3OCNA 1WYCA 2JBFA 2XQZA 1YLZA 2CC1A 4PM6A 5E2FA 3G31A 4S2OA 5HX9A 1RCJA 4YFMA 4GKUA 4DKIA 1K6SA 4BL2A 2Y59A 4GDBA 3RJUA 4RVAA 3DTMA 3SH7A 4DDYA 3Q7VA 2Y2IA 2VGKA 1FOFA 3HUNA 2DCFA 4OP5A 3HLEA 1HZOA 3CJMA 4OOYA 3S4XA 3SH8A 4RX2A 5JYOA 1JTGA 1ESIA 5JYPA 4KZ6A 2XR0A 4ZJ3A 2RCXA 3PBQA 1CEGA 3G34A 4RA7A 3UE3A 3P09A 3G30A 1YMXA 3C7UA 4OP8A 3P98A 4QY5A 1H8ZA 4XXRA 1BZAA 4ZAMA 1TVFA 3A3IA 4N1XA 4FSFA 2HP9A 2V20A 2BLSA 4KQOA 4K91A 4X68A 5F82A 4C3QA 4C6YA 2OV5A 4H8RA 5E43A 1YQSA 3TG9A 4Z9QA 3PAGA 3PBSA 4DDSA 4EBPA 1K55A 3WS2A 5E2GA 2HDRA 3A3JA 3BLSA 3PBNA 4KG5A 4OKPA 2A3UA 5EVIC 1EI5A 2H5SA 4EWFA 5GLDA 1K4FA 3BECA 3N8LA 5CTNA 4FH2A 4KZ7A 3GMWA 3O87A 3BM6A 3VFHA 2X71A 4KZAA 5GLAA 4U0TA 1JTDA 2ZC7A 4UA7A 1MBLA 3VP1A 1H8YA 2WAFA 3LO7A 1PZPA 2ZQDA 1H5XA 1K57C 1L0EA 3FWLA 2C5WB 5FQIA 4LCMA 2UWXA 4GD8A 2XDMA 3M2JA 2J8YA 3DWKA 3QNBA 1XKZA 5CHUA 4LV3A 4N92A 2H0TA 4R4RA 3O3VA 1ES2A 4LV1A 5CGWA 2P74A 5FI7A 3S22A 2P9VA 3OPHA 5A90A 3LY3A 2X01A 2XLNA 1N9BA 5HL1A 3WS4A 2OLVA 1KGFA 2HDSA 2RL3A 3D4FA 1PI4A 4KZ9A 4P87A 1BT5A 4BD1A 1PW8A 2HPBA 2WAEA 2Y55A 3BFFA 2Y2NA 4N9LA 5EECA 2FFFB 2XF3A 3MZDA 3ZVWA 3AGFA 3BFDA 3IH8A 5DF8A 4EBLA 4KZ3A 5HAPA 1W8QA 4HBUA 4MLLA 4OOLA 4R0QA 1FSYA 2ZQ7A 4GOGA 1W8YA 5L2FA 1W79A 4KENB 3V50A 3M6HA 4WEJA 1O7EA 1BLPA 4OLDA 3ISGA 1KVLA 5EVIA 5F1GA 5CEDA 3ZG5A 1ZC2A 4R23A 2Q9NA 2DNSA 1IKGA 1L0FA 3MXRA 4B88A 5CEBA 1MWRA 1K38A 4PPRA 3UDIA 4JXVA 3UE0A 1KGGA 2B5RA 1CK3A 4JF4A 3IXHA 1YLWA 2PBYA 3FV7A 3IF5A 3G2YA 4N1HA 4DE3A 1IELA 1Q2QA 1E3UD 1K57A 2EX2A 4JBFA 4WEKA 5A91A 5HFOA 4BENA 5CRFA 1OMEA 1GHPA 2Y2KA 1YM1A 1Y54A 3CMZA 3FKWA 5IHVA 4JKTA 5TR7A 3C4PA 5DF7A 3UNWA 3ZDJA 3G35A 4P85A 4S2IA 3RXXA 1JWVA 4Y0UA 1E25A 3S1YA 3ZG8B 3B3XA 3PAEA 5AQBA 2BG1A 2EFXA 3Q07A 5AQ9A 4JPMA 3W4OA 1XGIA 5FQ9A 3IF6C 2OLUA 3SS5A 1ZKJA 3MKEA 1IYQA 1YT4A 3IWIA 4DXCA 4L0LA 4IBRA 1LI0A 1DJAA 1KE3A 1K56D 3NDEA 5FQQA 2ZQAA 5CGSA 4QB8A 3ITBA 5GHZA 1NY0A 2Y91A 5CTMA 2I72A 3LEZA 3HLCA 3ZG7B 2ZLYA 3GSGA 4BL3A 1YLTA 1W5DA 5GHYA 3OPLA 2VGJA 3CG5A 5CHMA 3UY6A 2WGIA 2ZC4B 5E2EA 3WWXA 5HARA 4BQMA 2EX8A 3BYDA 3NIAA 4WZ5A 3N6IA 1ESUA 1DJCA 2XEPA 1K54A 3IWOA 3V3SA 3OZHA 1ZG6A 2ZQ9A 1KE4A 2ZQCA 1IYOA 3GQZA 4GD6A 3NBLA 5G18A 3LCEA 4KG6A 2ZC3B 1LL9A 1HVBA 2XGNA 5KSHA 2XH9A 1PWDA 4GDNA 5GL9A 2ZM0A 5AQAA 1I2WA 4KZ4A 4M3KA 5EPHA 5KSCA 3A3DA 1FCOA 2ZC6B 3ZHHA 3WS1A 3UPNA 4C75A 3AGDA 3VOZA 2Y2PA 4CJNA 4OPYA 3QHYA 1WE4A 3OPRA 3SS3A 3A3FA 3IWQA 2Y2HA 1IKIA 4IVKA 3OC2A 3TSGA 4DE2A 1NZOA 3N8RA 4GB7A 1HD8A 2G2WA 1FQGA 2WK0A 5FA7A 1PWCA 3ITAA 3VP4A 3OCLA 4E3JA 1GA0A 1FR1A 1XA7A 5M19A 1KDSA 4PM7A 3G4PA 3PTEA 5EOEA 1NXYA 2ZM2A 4JF5A 4PM9A 1BUEA 2WGVA 3NI9A 4E3KA 3Q7VB 3PBRA 4PM5A 2WGWA 1U60A 3MFDA 2EXBA 5A92A 1XX2A 2HDUA 3DWZA 3IH9A 1G6AA 1SKFA 2OSUA 4LV0A 3MZEA 2R9WA 5GLCA 2H10A 4S2NC 3Q81A 3GVBA 3RXWA 2XFSA 4WMCA 5KMWA 4LCLA 4OPQA 4O7DA 1W7FA 4PMAA 4CPKA 5CHJA 2Y2QA 5M18A 3PBOA 3E2LA 2H0YA 4MBHA 1MPLA 5KZHA 5GHXA 5I94A 3TOIA 2C6WB 3SS4A 3ZFZA 1DJBA 1ES3A 3HVFA 4WBGA 3HLBA 4JXWA 4BD0A 1ERQA 3MBZA 3BFEA 4B4ZA 4R3BA 4KZ5A 3UPOA 4IVIA 5CECA 4DE0A 5TGFA 3UO9A 4JXGA 5BOHA 3IHBA 2XK1A 4KZBA 4PM8A 2XFTA 4OOMA 4YINA 2Y2MA 1JWPA 3UDXA 1RGYA 1S0WA 4E3MA 1I2SA 3Q82A 1ONGA 3OPPA 4EBNA 3W4QA 4OQ0A 4X56A 3FYZA 4OVDA 4BJPA 4KQQA 2DRWA 1E4DA 4N9KA 2P9VB 5U47A 1L2SA 1PW1A 5FQKA 1MWSA 3VOYA 4DRTA 3N4IA 4E3NA 3NDGA 3WS0A 3MKFA 1M40A 3V39A 2XD1A 3BEBA 3HLFA 4B4XA 1MWUA 3ZCZA 2EXAA 3LY4A 3NCKA 1LHYA 4OQGA 2ZMAA 1LL5A 1IYPA 3HLGA 1NZUA 4GNUA 4UA9A 3VSKA 1PYYA 1ONHA 3GV9A 4K0XA 4Y0TA 4MBFA 2FFYA 5EVLA 2X02A 3NY4A 2QMIA 3HUOA 1RP5A 1YLYA 1DY6A 2QZ6A 3V5MA 4NETA 4ZTKA 1MWTA 4P6BA 3HL9A 4OQHA 1VQQA 5EVIB 1L0GA 2WKEA 3CZDA 4IEDA 4XUXA 1LLBA 5CGXA 3ZG0A 1KGEA 2WKIA 2Z2LB 2HP5A 2HP6A 3W8KA 1FCNA 3HLDA 3BFGA 4QY6A 2WZXA 3Q7ZA 4WZ4A 1WYBA 4E3LA 1NYYA 1QMFA 1VM1A 4JLFA 1NJ4A 1CEFA 3O88A 3IT9A 1ES5A 5DTKA 4MBKA 3VMAA 1C3BA 2ZJ9A 4K0WA 1NRFA 2J9OA 4EV4A 4S2MA 5DF9A 2Y2GA 4KZ8A 4F94A 1QMEA 1MKIA 1GCEA 4S2KA 5J8XA 4FH4A 5EUAA 1L0DA 1XXMA 2ZD8A 1TDGA 4HESA 2V1ZA 3FZCA 1Z6FA 3C4OA 3IF6A 4NK3A 4OONA 3IXDA 1E3UA 1CI9A 4X53A 2JC7A 4ZJ1A 5E2HA 4DF6A 3ZNYA 3MXSA 1XP4A 3GRJA 3PBTA 4MEZA 4RYEA 1YLPA 3I7JA 3IXBA 1IEMA 1K6RA 5EVID 2WKHA 3M6BA 4KQRA 3BLMA 1J9MA 2EX6A 4GZBA 4Q8IA 2QPNA 4OPRA 5CERA 1KE0A 3VP3A 3GTCA 4QJGA 4UAAA 4E6XA 3VP2A 2Y2LA 3QNCA 4S2PA 4D2OA 2ZC5B 1GHMA 5EE8A 3BFCA 1YMSA 2E8IA 5F1FA 1K56A 2J9PA 2V2FF 3M2KA 1BTLA 5FASA 1HTZA 3ZVTA 2HDQA 4S2JA 4DE1A 4QD4A 4R1GA 5CXWA 3UN7A 1SHVA 4EQIA 3HLWA 3VFFA 1SDEA 2WYXA 2R9XA 3WS5A 1K4EA 1ALQA 1JWZA 3G2ZA 2IWBA 1FCMA 2A49A 2WADA 2IWCA 4FCFA 4OPZA 5FDHA 2Y2JA 4HEFA 1BULA 1JVJA 1ZG4A 1PI5A 4ID4A 5FQJA 3O86A 3Q1FA 4LENA 1PIOA 4ZJ2A 3IF6B 3ZG9B 3AGEA 1FR6A 4QU3A 1O07A 4EUZA 1BLSA 2GDNA 3ZGAB 4OQIA 3UE1A 4DXBA 4JF6A 1N4OA 2Z2MB 1GHIA 4WYYA 5D3OA 4ZDXA 4P0MA 3SOIA 4RX3A 5FQMA 5EOOA 5FAPA 3MZFA 1YLJA 3SH9A 3C7VA 1CI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UA6 A;  3FKV A;  1FSW A;  2XD5 A;  1TDL A;  3WRT A;  5DVA A;  4QHC A;  4E3I A;  1MY8 A;  3A3E A;  4IBX A;  1XPB A;  1LI9 A;  2JCH A;  2WGW B;  3N8S A;  4R3J A;  4WM9 A;  5FAO A;  1Q2P A;  5FAT A;  1G68 A;  3W4P A;  2PU2 A;  1NYM A;  4E6W A;  3C5A A;  2JE5 A;  3BRM A;  4S2L A;  4LV2 A;  1PWG A;  3JYI A;  5HAI A;  3DW0 A;  4X6T A;  2IWD A;  3E2K A;  2ZM8 A;  4FD8 A;  4S2N A;  1ES4 A;  3HRE A;  3N7W A;  4KG2 A;  4WZ5 C;  3HUM A;  5M1A A;  4XUZ A;  1GA9 A;  1BLC A;  1SDN A;  4X69 A;  1KVM A;  1K54 C;  4UHU A;  5FI6 A;  5FI2 A;  2G2U A;  4BLM A;  3IXG A;  1BSG A;  1KDW A;  2ZQ8 A;  2WUQ A;  4GN2 A;  4R4S A;  1ERM A;  2Y2O A;  4A5R A;  1BLH A;  1AXB A;  1XGJ A;  5F83 A;  3UDF A;  4HBT A;  3HBR A;  5FAQ A;  5HAQ A;  2WZZ A;  1S6R A;  1XA1 A;  1M6K A;  1TEM A;  4OLG A;  2EFU A;  3IHA A;  4ZBE A;  3ZNT A;  1PZO A;  2J7V A;  1EWZ A;  3EQU A;  1ERO A;  4X55 A;  3NC8 A;  1K55 C;  4JXS A;  5GLB A;  1I5Q A;  3VSL A;  3UPP A;  5HW3 A;  1RGZ A;  2EX9 A;  3G32 A;  3IQA A;  3VP0 A;  5FSR A;  4U3T A;  1SCW A;  1MXO A;  2PU4 A;  5AQ7 A;  5DTS A;  1IYS A;  5DTT A;  4WEL A;  4Y7P A;  4MNR A;  2Y4A A;  4U0X A;  3WRZ A;  1K25 A;  4E3O A;  3GR2 A;  2Q9M A;  5TFQ A;  5A93 A;  4WMC D;  4Y0O A;  3EQV A;  4OH0 A;  3V3R A;  3OCN A;  1WYC A;  2JBF A;  2XQZ A;  1YLZ A;  2CC1 A;  4PM6 A;  5E2F A;  3G31 A;  4S2O A;  5HX9 A;  1RCJ A;  4YFM A;  4GKU A;  4DKI A;  1K6S A;  4BL2 A;  2Y59 A;  4GDB A;  3RJU A;  4RVA A;  3DTM A;  3SH7 A;  4DDY A;  3Q7V A;  2Y2I A;  2VGK A;  1FOF A;  3HUN A;  2DCF A;  4OP5 A;  3HLE A;  1HZO A;  3CJM A;  4OOY A;  3S4X A;  3SH8 A;  4RX2 A;  5JYO A;  1JTG A;  1ESI A;  5JYP A;  4KZ6 A;  2XR0 A;  4ZJ3 A;  2RCX A;  3PBQ A;  1CEG A;  3G34 A;  4RA7 A;  3UE3 A;  3P09 A;  3G30 A;  1YMX A;  3C7U A;  4OP8 A;  3P98 A;  4QY5 A;  1H8Z A;  4XXR A;  1BZA A;  4ZAM A;  1TVF A;  3A3I A;  4N1X A;  4FSF A;  2HP9 A;  2V20 A;  2BLS A;  4KQO A;  4K91 A;  4X68 A;  5F82 A;  4C3Q A;  4C6Y A;  2OV5 A;  4H8R A;  5E43 A;  1YQS A;  3TG9 A;  4Z9Q A;  3PAG A;  3PBS A;  4DDS A;  4EBP A;  1K55 A;  3WS2 A;  5E2G A;  2HDR A;  3A3J A;  3BLS A;  3PBN A;  4KG5 A;  4OKP A;  2A3U A;  5EVI C;  1EI5 A;  2H5S A;  4EWF A;  5GLD A;  1K4F A;  3BEC A;  3N8L A;  5CTN A;  4FH2 A;  4KZ7 A;  3GMW A;  3O87 A;  3BM6 A;  3VFH A;  2X71 A;  4KZA A;  5GLA A;  4U0T A;  1JTD A;  2ZC7 A;  4UA7 A;  1MBL A;  3VP1 A;  1H8Y A;  2WAF A;  3LO7 A;  1PZP A;  2ZQD A;  1H5X A;  1K57 C;  1L0E A;  3FWL A;  2C5W B;  5FQI A;  4LCM A;  2UWX A;  4GD8 A;  2XDM A;  3M2J A;  2J8Y A;  3DWK A;  3QNB A;  1XKZ A;  5CHU A;  4LV3 A;  4N92 A;  2H0T A;  4R4R A;  3O3V A;  1ES2 A;  4LV1 A;  5CGW A;  2P74 A;  5FI7 A;  3S22 A;  2P9V A;  3OPH A;  5A90 A;  3LY3 A;  2X01 A;  2XLN A;  1N9B A;  5HL1 A;  3WS4 A;  2OLV A;  1KGF A;  2HDS A;  2RL3 A;  3D4F A;  1PI4 A;  4KZ9 A;  4P87 A;  1BT5 A;  4BD1 A;  1PW8 A;  2HPB A;  2WAE A;  2Y55 A;  3BFF A;  2Y2N A;  4N9L A;  5EEC A;  2FFF B;  2XF3 A;  3MZD A;  3ZVW A;  3AGF A;  3BFD A;  3IH8 A;  5DF8 A;  4EBL A;  4KZ3 A;  5HAP A;  1W8Q A;  4HBU A;  4MLL A;  4OOL A;  4R0Q A;  1FSY A;  2ZQ7 A;  4GOG A;  1W8Y A;  5L2F A;  1W79 A;  4KEN B;  3V50 A;  3M6H A;  4WEJ A;  1O7E A;  1BLP A;  4OLD A;  3ISG A;  1KVL A;  5EVI A;  5F1G A;  5CED A;  3ZG5 A;  1ZC2 A;  4R23 A;  2Q9N A;  2DNS A;  1IKG A;  1L0F A;  3MXR A;  4B88 A;  5CEB A;  1MWR A;  1K38 A;  4PPR A;  3UDI A;  4JXV A;  3UE0 A;  1KGG A;  2B5R A;  1CK3 A;  4JF4 A;  3IXH A;  1YLW A;  2PBY A;  3FV7 A;  3IF5 A;  3G2Y A;  4N1H A;  4DE3 A;  1IEL A;  1Q2Q A;  1E3U D;  1K57 A;  2EX2 A;  4JBF A;  4WEK A;  5A91 A;  5HFO A;  4BEN A;  5CRF A;  1OME A;  1GHP A;  2Y2K A;  1YM1 A;  1Y54 A;  3CMZ A;  3FKW A;  5IHV A;  4JKT A;  5TR7 A;  3C4P A;  5DF7 A;  3UNW A;  3ZDJ A;  3G35 A;  4P85 A;  4S2I A;  3RXX A;  1JWV A;  4Y0U A;  1E25 A;  3S1Y A;  3ZG8 B;  3B3X A;  3PAE A;  5AQB A;  2BG1 A;  2EFX A;  3Q07 A;  5AQ9 A;  4JPM A;  3W4O A;  1XGI A;  5FQ9 A;  3IF6 C;  2OLU A;  3SS5 A;  1ZKJ A;  3MKE A;  1IYQ A;  1YT4 A;  3IWI A;  4DXC A;  4L0L A;  4IBR A;  1LI0 A;  1DJA A;  1KE3 A;  1K56 D;  3NDE A;  5FQQ A;  2ZQA A;  5CGS A;  4QB8 A;  3ITB A;  5GHZ A;  1NY0 A;  2Y91 A;  5CTM A;  2I72 A;  3LEZ A;  3HLC A;  3ZG7 B;  2ZLY A;  3GSG A;  4BL3 A;  1YLT A;  1W5D A;  5GHY A;  3OPL A;  2VGJ A;  3CG5 A;  5CHM A;  3UY6 A;  2WGI A;  2ZC4 B;  5E2E A;  3WWX A;  5HAR A;  4BQM A;  2EX8 A;  3BYD A;  3NIA A;  4WZ5 A;  3N6I A;  1ESU A;  1DJC A;  2XEP A;  1K54 A;  3IWO A;  3V3S A;  3OZH A;  1ZG6 A;  2ZQ9 A;  1KE4 A;  2ZQC A;  1IYO A;  3GQZ A;  4GD6 A;  3NBL A;  5G18 A;  3LCE A;  4KG6 A;  2ZC3 B;  1LL9 A;  1HVB A;  2XGN A;  5KSH A;  2XH9 A;  1PWD A;  4GDN A;  5GL9 A;  2ZM0 A;  5AQA A;  1I2W A;  4KZ4 A;  4M3K A;  5EPH A;  5KSC A;  3A3D A;  1FCO A;  2ZC6 B;  3ZHH A;  3WS1 A;  3UPN A;  4C75 A;  3AGD A;  3VOZ A;  2Y2P A;  4CJN A;  4OPY A;  3QHY A;  1WE4 A;  3OPR A;  3SS3 A;  3A3F A;  3IWQ A;  2Y2H A;  1IKI A;  4IVK A;  3OC2 A;  3TSG A;  4DE2 A;  1NZO A;  3N8R A;  4GB7 A;  1HD8 A;  2G2W A;  1FQG A;  2WK0 A;  5FA7 A;  1PWC A;  3ITA A;  3VP4 A;  3OCL A;  4E3J A;  1GA0 A;  1FR1 A;  1XA7 A;  5M19 A;  1KDS A;  4PM7 A;  3G4P A;  3PTE A;  5EOE A;  1NXY A;  2ZM2 A;  4JF5 A;  4PM9 A;  1BUE A;  2WGV A;  3NI9 A;  4E3K A;  3Q7V B;  3PBR A;  4PM5 A;  2WGW A;  1U60 A;  3MFD A;  2EXB A;  5A92 A;  1XX2 A;  2HDU A;  3DWZ A;  3IH9 A;  1G6A A;  1SKF A;  2OSU A;  4LV0 A;  3MZE A;  2R9W A;  5GLC A;  2H10 A;  4S2N C;  3Q81 A;  3GVB A;  3RXW A;  2XFS A;  4WMC A;  5KMW A;  4LCL A;  4OPQ A;  4O7D A;  1W7F A;  4PMA A;  4CPK A;  5CHJ A;  2Y2Q A;  5M18 A;  3PBO A;  3E2L A;  2H0Y A;  4MBH A;  1MPL A;  5KZH A;  5GHX A;  5I94 A;  3TOI A;  2C6W B;  3SS4 A;  3ZFZ A;  1DJB A;  1ES3 A;  3HVF A;  4WBG A;  3HLB A;  4JXW A;  4BD0 A;  1ERQ A;  3MBZ A;  3BFE A;  4B4Z A;  4R3B A;  4KZ5 A;  3UPO A;  4IVI A;  5CEC A;  4DE0 A;  5TGF A;  3UO9 A;  4JXG A;  5BOH A;  3IHB A;  2XK1 A;  4KZB A;  4PM8 A;  2XFT A;  4OOM A;  4YIN A;  2Y2M A;  1JWP A;  3UDX A;  1RGY A;  1S0W A;  4E3M A;  1I2S A;  3Q82 A;  1ONG A;  3OPP A;  4EBN A;  3W4Q A;  4OQ0 A;  4X56 A;  3FYZ A;  4OVD A;  4BJP A;  4KQQ A;  2DRW A;  1E4D A;  4N9K A;  2P9V B;  5U47 A;  1L2S A;  1PW1 A;  5FQK A;  1MWS A;  3VOY A;  4DRT A;  3N4I A;  4E3N A;  3NDG A;  3WS0 A;  3MKF A;  1M40 A;  3V39 A;  2XD1 A;  3BEB A;  3HLF A;  4B4X A;  1MWU A;  3ZCZ A;  2EXA A;  3LY4 A;  3NCK A;  1LHY A;  4OQG A;  2ZMA A;  1LL5 A;  1IYP A;  3HLG A;  1NZU A;  4GNU A;  4UA9 A;  3VSK A;  1PYY A;  1ONH A;  3GV9 A;  4K0X A;  4Y0T A;  4MBF A;  2FFY A;  5EVL A;  2X02 A;  3NY4 A;  2QMI A;  3HUO A;  1RP5 A;  1YLY A;  1DY6 A;  2QZ6 A;  3V5M A;  4NET A;  4ZTK A;  1MWT A;  4P6B A;  3HL9 A;  4OQH A;  1VQQ A;  5EVI B;  1L0G A;  2WKE A;  3CZD A;  4IED A;  4XUX A;  1LLB A;  5CGX A;  3ZG0 A;  1KGE A;  2WKI A;  2Z2L B;  2HP5 A;  2HP6 A;  3W8K A;  1FCN A;  3HLD A;  3BFG A;  4QY6 A;  2WZX A;  3Q7Z A;  4WZ4 A;  1WYB A;  4E3L A;  1NYY A;  1QMF A;  1VM1 A;  4JLF A;  1NJ4 A;  1CEF A;  3O88 A;  3IT9 A;  1ES5 A;  5DTK A;  4MBK A;  3VMA A;  1C3B A;  2ZJ9 A;  4K0W A;  1NRF A;  2J9O A;  4EV4 A;  4S2M A;  5DF9 A;  2Y2G A;  4KZ8 A;  4F94 A;  1QME A;  1MKI A;  1GCE A;  4S2K A;  5J8X A;  4FH4 A;  5EUA A;  1L0D A;  1XXM A;  2ZD8 A;  1TDG A;  4HES A;  2V1Z A;  3FZC A;  1Z6F A;  3C4O A;  3IF6 A;  4NK3 A;  4OON A;  3IXD A;  1E3U A;  1CI9 A;  4X53 A;  2JC7 A;  4ZJ1 A;  5E2H A;  4DF6 A;  3ZNY A;  3MXS A;  1XP4 A;  3GRJ A;  3PBT A;  4MEZ A;  4RYE A;  1YLP A;  3I7J A;  3IXB A;  1IEM A;  1K6R A;  5EVI D;  2WKH A;  3M6B A;  4KQR A;  3BLM A;  1J9M A;  2EX6 A;  4GZB A;  4Q8I A;  2QPN A;  4OPR A;  5CER A;  1KE0 A;  3VP3 A;  3GTC A;  4QJG A;  4UAA A;  4E6X A;  3VP2 A;  2Y2L A;  3QNC A;  4S2P A;  4D2O A;  2ZC5 B;  1GHM A;  5EE8 A;  3BFC A;  1YMS A;  2E8I A;  5F1F A;  1K56 A;  2J9P A;  2V2F F;  3M2K A;  1BTL A;  5FAS A;  1HTZ A;  3ZVT A;  2HDQ A;  4S2J A;  4DE1 A;  4QD4 A;  4R1G A;  5CXW A;  3UN7 A;  1SHV A;  4EQI A;  3HLW A;  3VFF A;  1SDE A;  2WYX A;  2R9X A;  3WS5 A;  1K4E A;  1ALQ A;  1JWZ A;  3G2Z A;  2IWB A;  1FCM A;  2A49 A;  2WAD A;  2IWC A;  4FCF A;  4OPZ A;  5FDH A;  2Y2J A;  4HEF A;  1BUL A;  1JVJ A;  1ZG4 A;  1PI5 A;  4ID4 A;  5FQJ A;  3O86 A;  3Q1F A;  4LEN A;  1PIO A;  4ZJ2 A;  3IF6 B;  3ZG9 B;  3AGE A;  1FR6 A;  4QU3 A;  1O07 A;  4EUZ A;  1BLS A;  2GDN A;  3ZGA B;  4OQI A;  3UE1 A;  4DXB A;  4JF6 A;  1N4O A;  2Z2M B;  1GHI A;  4WYY A;  5D3O A;  4ZDX A;  4P0M A;  3SOI A;  4RX3 A;  5FQM A;  5EOO A;  5FAP A;  3MZF A;  1YLJ A;  3SH9 A;  3C7V A;  1CI8 A; 
#chains in the Genus database with same CATH topology
 3EEA A;  4UA6 A;  3L7H A;  3WRT A;  4R3J A;  5FAO A;  5FAT A;  2W3G A;  1Q2P A;  1G68 A;  1NYM A;  1P9W A;  2OAQ 1;  5L07 A;  4JGR A;  4YNR A;  3KYQ A;  4CQH A;  5L8M A;  3UE6 A;  3N7W A;  4KG2 A;  3HUM A;  3KSF A;  4FOF A;  1SDN A;  4BMW A;  4GS9 B;  2G2U A;  3IXG A;  4A5R A;  1AXB A;  3EGD C;  4HBT A;  3HBR A;  1S1Y A;  1S6R A;  1XA1 A;  4OLG A;  1TEM A;  3IHA A;  3ZNT A;  2Z6D A;  3EQU A;  2V1B A;  4JXS A;  5HW3 A;  2EX9 A;  3G32 A;  4U3T A;  2PU4 A;  4WEL A;  4E3O A;  3GR2 A;  3NHQ A;  3V3R A;  1WYC A;  4ME4 A;  4EET B;  4Q0H A;  5HX9 A;  4LFU A;  4BL2 A;  2Y59 A;  1V9Y A;  5HSQ A;  1NRJ A;  1FOF A;  3HUN A;  2DCF A;  5JYO A;  1ESI A;  2XR0 A;  4ZJ3 A;  2RCX A;  1CEG A;  4D60 A;  3G34 A;  1AWI A;  4RA7 A;  3MQO A;  4QY5 A;  1H8Z A;  5HWT A;  4N1X A;  2V20 A;  4C6Y A;  3R7W B;  2PRF A;  4H6J A;  4H8R A;  5E43 A;  4Z9Q A;  4EBP A;  2W3F A;  3HCY A;  4NXF A;  2HDR A;  4EQ1 A;  1K4F A;  4KZ7 A;  3BM6 A;  1MC0 A;  3CI6 A;  1H8Y A;  4B93 A;  2PBD P;  2ZQD A;  1H5X A;  4CLC E;  1W63 Q;  2VJW A;  2J8Y A;  1XKZ A;  3O3V A;  5CGW A;  1MZU A;  2X01 A;  2XLN A;  2ACG A;  1VHM A;  3HJK A;  2JHE A;  2V9A A;  4P87 A;  2J80 A;  4BD1 A;  1PW8 A;  2WAE A;  2LB5 A;  2Y55 A;  4G3K A;  2Y2N A;  2VV6 A;  2FFF B;  2XF3 A;  5DF8 A;  4IHQ A;  3T4T A;  4KZ3 A;  4HBU A;  4OOL A;  1FSY A;  2O9C A;  1O7E A;  4OLD A;  5EVI A;  1ZC2 A;  5TBM B;  2DNS A;  5HD5 A;  1K38 A;  4HJ3 A;  3UE0 A;  1CK3 A;  4JF4 A;  1YLW A;  2PBY A;  1GSV A;  1DP6 A;  3CIT A;  1Q2Q A;  4BEN A;  1UWP X;  5A91 A;  5HFO A;  1GSX A;  5CRF A;  1GHP A;  4Y3I A;  5IHV A;  5DF7 A;  4YWZ A;  2M7V A;  3ZG8 B;  4EXO A;  2LB9 A;  5AQ9 A;  3EOI A;  2JKG A;  1ZKJ A;  1YT4 A;  4L0L A;  1LSV A;  4IBR A;  1LI0 A;  4PAU A;  4ARZ B;  5IT5 A;  1WA9 A;  1DJA A;  1STZ A;  3LEZ A;  2V1A A;  4BL3 A;  4EU0 A;  5GHY A;  1D06 A;  3BQ8 A;  2VGJ A;  5CHM A;  2IA2 A;  2ZC4 B;  5E2E A;  3WWX A;  5HAR A;  2EX8 A;  3NIA A;  4WZ5 A;  3N6I A;  1DJC A;  2HF6 A;  2XEP A;  1ZG6 A;  1T18 A;  1HVB A;  2XGN A;  5KSH A;  1PWD A;  3DAV A;  4M3K A;  5KSC A;  1FIL A;  3ZHH A;  3A0V A;  3WS1 A;  3VOZ A;  1XFQ A;  2EWV A;  2Y2P A;  1VET B;  4CJN A;  3T1S A;  1WE4 A;  3A3F A;  4IVK A;  3TSG A;  3N8R A;  1HD8 A;  2G2W A;  4KQD A;  5EM0 A;  1GA0 A;  1FR1 A;  1XA7 A;  2O99 A;  4PM7 A;  2VGL M;  5HDD A;  1H0M A;  4E3K A;  2W3E A;  4PM5 A;  1XX2 A;  2HDU A;  3DWZ A;  3IH9 A;  1G6A A;  1SKF A;  2OSU A;  3LR5 A;  2YKH A;  3BQA A;  2H10 A;  4GLQ A;  3TW8 A;  4CPK A;  2Y2Q A;  5M18 A;  3PBO A;  1XJ6 A;  4MBH A;  3ZFZ A;  2B95 A;  5CX7 A;  4B4Z A;  1T19 A;  3UPO A;  1N9N A;  4WL9 A;  3RFB A;  4DE0 A;  3UO9 A;  4JXG A;  3DTI A;  1CJF A;  4PM8 A;  1G5U A;  1K0K A;  4OOM A;  4GW9 A;  3OPP A;  3FYZ A;  2ZOH A;  1E4D A;  2P9V B;  4HP9 A;  4DRT A;  3N4I A;  4NKP A;  3NDG A;  4E3N A;  3H82 A;  4RQ9 A;  3IBR A;  2EXA A;  4AFI A;  4MN5 A;  1IYP A;  3HLG A;  3ZQ5 A;  3VSK A;  1PYY A;  4K0X A;  2FFY A;  3NY4 A;  5AJG A;  3HUO A;  4P6Z S;  3NOT C;  4ZTK A;  1MWT A;  4IED A;  1LLB A;  5CGX A;  3ZG0 A;  1KGE A;  3W8K A;  2Z2L B;  4QY6 A;  3Q7Z A;  1WYB A;  1NYY A;  4JLF A;  1NJ4 A;  3O88 A;  3FPW A;  2J9O A;  4EV4 A;  3ULF A;  5DF9 A;  2Y2G A;  4MN7 A;  4UEY A;  4R3A A;  5EUA A;  2V1Z A;  3C4O A;  2WKQ A;  3IXD A;  4Q0J A;  3O5Y A;  4DF6 A;  3T4Q A;  4RYE A;  3F1N B;  2VV8 A;  2WKH A;  4QPR A;  5G4Z A;  4KQR A;  2ZL1 A;  4KUK A;  1J9M A;  1OTD A;  4GZB A;  3QP8 A;  2QPN A;  2W27 A;  3VP3 A;  1KE0 A;  2GZA A;  1SKO B;  3MF0 A;  3LEQ A;  3K3D A;  1T1C A;  4K08 A;  1OJ5 A;  3UB7 A;  3BFC A;  1YMS A;  2E8I A;  3D3O A;  2J9P A;  3M2K A;  1BTL A;  3ZVT A;  4DE1 A;  2GX5 A;  5CXW A;  3UN7 A;  1SHV A;  1SDE A;  2R9X A;  4CLC A;  2P04 A;  1FCM A;  5FDH A;  3TE8 A;  1BUL A;  4EUV A;  1JVJ A;  1PI5 A;  1YAX A;  5FQJ A;  3O86 A;  1PIO A;  2ZBB A;  3IF6 B;  4QU3 A;  2VX8 A;  4NXE A;  1O07 A;  4YOF A;  4LRY C;  1N4O A;  4WYY A;  1OTE A;  3SOI A;  5FQM A;  3T4K A;  4HIA A;  3IX4 A;  3VOL A;  1TDL A;  5DVA A;  4E3I A;  1OPX A;  1HLU P;  4IBX A;  2JCH A;  3FG8 A;  4EW7 A;  3W4P A;  2PU2 A;  3BY9 A;  2JE5 A;  3BRM A;  1PWG A;  1P97 A;  3DW0 A;  4BBU A;  2IWD A;  4FD8 A;  4S2N A;  3HRE A;  1BYW A;  4LPZ A;  4XUZ A;  1Y4O A;  1KVM A;  1K54 C;  2VZW A;  5FI6 A;  2W1T A;  3LIE A;  3E4O A;  1BSG A;  2ZQ8 A;  4R4S A;  1ERM A;  2Y2O A;  2VLG A;  2FZ0 A;  1XGJ A;  5F83 A;  5HAQ A;  4WLA A;  4ZBE A;  1EWZ A;  3NC8 A;  3MQ0 A;  3VSL A;  1CF0 A;  1S67 L;  5DFY A;  1MXO A;  5DTS A;  4Y7P A;  2XA7 M;  4MNR A;  2Y4A A;  4U0X A;  5EVE A;  4Y0O A;  4HJ4 A;  3LI9 A;  4OH0 A;  2JBF A;  4DJ2 A;  4LRX C;  2XQZ A;  1YLZ A;  2VV7 A;  4PM6 A;  5E2F A;  4S2O A;  3S7N A;  1RCJ A;  1F2K A;  4GKU A;  4DKI A;  1K6S A;  3QP2 A;  4GDB A;  2P08 A;  3Q7V A;  2Y2I A;  4OP5 A;  4MMN A;  3HLE A;  4LRZ E;  2H28 A;  2K7S A;  3LUQ A;  4HH3 A;  3C7U A;  4ZAM A;  1TVF A;  5F82 A;  4X68 A;  4C3Q A;  2VK3 A;  3TG9 A;  1YQS A;  3C30 A;  3PBS A;  4DDS A;  3IS2 A;  4Q0I A;  3WS2 A;  5E2G A;  3A3J A;  3PBN A;  2QHK A;  1EI5 A;  4EWF A;  5CTN A;  3VP1 A;  2ZC7 A;  1MBL A;  2WAF A;  3LO7 A;  1PZP A;  4IUK A;  1K57 C;  1L0E A;  4LCM A;  2UWX A;  2G7U A;  3M2J A;  4N92 A;  2H0T A;  1P0Z A;  4LV1 A;  2Z6C A;  1LL8 A;  3S22 A;  3QP1 A;  3LI8 A;  5HL1 A;  2HDS A;  3F1O A;  2CMN A;  4ETZ A;  4KZ9 A;  1BT5 A;  4ZRR A;  3T1X A;  4G3V A;  5EEC A;  5FDS A;  3T4L A;  4E04 A;  3BFD A;  3IH8 A;  1ODV A;  3KYZ A;  5HAP A;  4JGO A;  4MLL A;  1NWZ A;  2INW A;  4KEN B;  1BLP A;  5F1G A;  4R23 A;  2Q9N A;  4FTX A;  5CEB A;  3UDI A;  4JXV A;  2L1M A;  2B5R A;  4EBL A;  1IEL A;  4JBF A;  4WEK A;  5DKK A;  3H7W A;  2Y2K A;  1Y54 A;  3UNW A;  5TR7 A;  3ZDJ A;  4P85 A;  1FIK A;  3RXX A;  1JWV A;  4Y0U A;  1E25 A;  2XSS A;  3S1Y A;  3MXQ A;  5AQB A;  3OOV A;  2VGL S;  5FQ9 A;  3IF6 C;  2OLU A;  3MKE A;  2XRN A;  3CAX A;  3IWI A;  5IS1 A;  3NEC A;  1K56 D;  2WKR A;  2HV1 A;  5CGS A;  2A24 A;  5HPF A;  1NY0 A;  4I3J A;  3HLC A;  3CUE C;  2ZLY A;  1TF1 A;  1YLT A;  3FC7 A;  4HHD A;  1W5D A;  2UV0 E;  4ESP A;  2WGI A;  3BYD A;  5FL3 A;  3V3S A;  2ZMV A;  2ZQ9 A;  5G18 A;  2BTF P;  3LID A;  3P01 A;  4BBT A;  3QP4 A;  4GDN A;  5GL9 A;  4KZ4 A;  5EPH A;  2HGV A;  2QKP A;  3UPN A;  3AGD A;  4PKY A;  2M7U A;  1X0O A;  3SS3 A;  3IWQ A;  1IKI A;  1VEU A;  4DE2 A;  1FQG A;  5FA7 A;  1PWC A;  3ITA A;  4E3J A;  4X1L A;  1S66 L;  3PTE A;  5EOE A;  2ZM2 A;  4PM9 A;  5KIZ A;  1YPR A;  3CWF A;  4R6L A;  4B9O A;  5EM1 A;  3IBJ A;  1OJG A;  2EXB A;  5GLC A;  5LBR A;  2XFS A;  4OPQ A;  4O7D A;  5CHJ A;  3EEH A;  1A0K A;  2H0Y A;  5KZH A;  3T12 B;  3TOI A;  4WBG A;  4GS9 A;  1ERQ A;  4PKY G;  4R3B A;  1NLZ A;  3KX0 X;  3T1Q B;  5FEF A;  2KOI A;  1S4R A;  5BOH A;  3OLO A;  1VB6 A;  4XT2 A;  2ZOI A;  3Q82 A;  2YKF A;  3W4Q A;  4OQ0 A;  5U47 A;  1MWS A;  3MKF A;  1M40 A;  3R4K A;  2XD1 A;  3BEB A;  3HLF A;  1OT9 A;  3TJZ C;  3LY4 A;  2FH5 A;  2ZMA A;  4GNU A;  5I5L A;  3GV9 A;  4Y0T A;  4MBF A;  2QMI A;  1RP5 A;  1YLY A;  2QZ6 A;  4NET A;  4HI4 A;  4P6B A;  3HL9 A;  5DFX A;  2WKE A;  3CZD A;  2GNX A;  2HP5 A;  1FCN A;  2B18 A;  3HLD A;  4I39 A;  1XJ2 A;  2J3T C;  2WZX A;  4WZ4 A;  3T50 A;  5F5Y A;  1QMF A;  2M1C A;  1TS7 A;  3D72 A;  3VMA A;  4NXG A;  5J4E A;  1C3B A;  2PYP A;  2K2N A;  3CHW P;  4KZ8 A;  1QME A;  1MKI A;  2PYR A;  4O8G A;  5F69 A;  5J7E A;  4HP4 A;  3CPT B;  4FH4 A;  2ZD8 A;  1XXM A;  5HDC A;  1CI9 A;  2W3D A;  4X53 A;  4ZJ1 A;  3MXS A;  1XP4 A;  3PBT A;  3I7J A;  3M6B A;  2JKF A;  3UMD A;  4Q8I A;  5CER A;  3GTC A;  3S7P A;  4KUO A;  1YSP A;  2Y2L A;  1GHM A;  4HY8 A;  5EE8 A;  1HTZ A;  4LLO B;  2HDQ A;  5G4Y A;  4NXB A;  1P9R A;  2WYX A;  3RH8 B;  5TBM A;  4OPZ A;  1ZG4 A;  3KSH A;  3QP5 A;  4ID4 A;  2JN7 A;  3Q1F A;  4LEN A;  2NUT C;  1DP9 A;  1BLS A;  3IX8 A;  2XA7 S;  3BJN A;  1TS8 A;  2OWJ A;  4RX3 A;  5EOO A;  5FAP A;  4L9G A;  3FKV A;  1FSW A;  3UB5 P;  4UQI M;  2WGW B;  4WM9 A;  4ARZ A;  4GHI A;  1N9O A;  4MDZ A;  3L9K A;  4E6W A;  4O0P A;  4F3L B;  5HAI A;  4X6T A;  3TRC A;  3UB8 A;  1ES4 A;  2PAV P;  4WZ5 C;  3SZT A;  3F1P B;  5M1A A;  1BLC A;  4X69 A;  4UHU A;  2PR6 A;  3W2Z A;  1KDW A;  1BLH A;  4IJG A;  5TJJ A;  3UDF A;  3BY8 A;  5FAQ A;  3ZYT A;  2WZZ A;  1M6K A;  2J7V A;  4JGQ A;  4X55 A;  1F9I A;  1K55 C;  5GLB A;  1I5Q A;  1RGZ A;  3IQA A;  1VET A;  2JKR M;  5AQ7 A;  1IYS A;  5DTT A;  3PXP A;  4BWI A;  3WRZ A;  1K25 A;  2Q9M A;  5TFQ A;  5A93 A;  4WMC D;  2QJ5 A;  2CC1 A;  3G31 A;  4YFM A;  3RJU A;  4RVA A;  3DTM A;  3SH7 A;  3MS6 A;  2VGK A;  3CJM A;  3LFV A;  4KZ6 A;  2OWH A;  3UE3 A;  3P09 A;  3G30 A;  4OP8 A;  4XXR A;  1BZA A;  4FSF A;  4KQO A;  4K91 A;  3LGO A;  2W0N A;  3DTK A;  2OV5 A;  4OKP A;  3BLS A;  2A3U A;  2H5S A;  3LIB A;  3BEC A;  3LIF A;  3N8L A;  4FH2 A;  3O87 A;  3VFH A;  5HPI A;  4KZA A;  5GLA A;  4UA7 A;  3BW6 A;  2Q0O A;  4GD8 A;  2XDM A;  5CHU A;  3DWK A;  4LV3 A;  4BBV A;  4R4R A;  3FPV A;  5FI7 A;  3U4L P;  2P9V A;  4L9E A;  1N9B A;  2OLV A;  1KGF A;  2RL3 A;  3D4F A;  1PI4 A;  4FUW A;  3B33 A;  2HPB A;  3BFF A;  2HJ9 C;  5DKL A;  1OT6 A;  3AGF A;  3JVV A;  3JPU A;  1W8Q A;  4R0Q A;  1J3W A;  2ZQ7 A;  1W8Y A;  5L2F A;  1W79 A;  2NUP C;  3M6H A;  3V67 A;  3ISG A;  1KVL A;  3JVU A;  5CED A;  3MMH A;  3ZG5 A;  4PPR A;  2GJ3 A;  3FV7 A;  2Y79 A;  3IF5 A;  4N1H A;  2EX2 A;  1E3U D;  1K57 A;  3LIA A;  3HJI A;  4I3A A;  3CMZ A;  1YM1 A;  3FKW A;  4JKT A;  3C4P A;  3G35 A;  4S2I A;  5C5K A;  2MJ6 A;  3B3X A;  3PAE A;  2BG1 A;  4JPM A;  3W4O A;  3SS5 A;  4Y13 A;  4DXC A;  3KO6 A;  1KE3 A;  3NDE A;  5FQQ A;  2ZQA A;  4DN0 A;  3ITB A;  3F1N A;  5CTM A;  2KX6 A;  3ZG7 B;  2PHY A;  3MSH A;  4I5S A;  1IOU A;  3OPL A;  1SKO A;  4HQA A;  5F6A A;  2QJ7 A;  1ESU A;  1W63 M;  4O01 A;  3IWO A;  4CLC C;  1KE4 A;  2ZQC A;  1IYO A;  3GQZ A;  3NBL A;  3SW1 A;  2ZC3 B;  1N9L A;  4NG2 A;  2ZM0 A;  3B47 A;  3A3D A;  2V0W A;  1T1A A;  3C8C A;  2JKT I;  3QHY A;  1ZTU A;  3OC2 A;  1NLY A;  1F98 A;  3KYE A;  2WK0 A;  3OCL A;  5M19 A;  1KDS A;  2R78 A;  3CUE A;  3G4P A;  1NXY A;  5EFW A;  1BUE A;  1H3Q A;  1SZV A;  2P7J A;  3LIC A;  3PBR A;  1U60 A;  4LV0 A;  4S2N C;  3GVB A;  3RXW A;  5J3W A;  1IFQ A;  4LCL A;  1W7F A;  4PMA A;  1OTB A;  2O9B A;  3E2L A;  2V8C A;  4H6J B;  4M4X A;  5GHX A;  3G6O A;  3SS4 A;  1DJB A;  3HVF A;  3HLB A;  1XJ3 A;  3OBF A;  4IVI A;  5CEC A;  3C38 A;  3EWK A;  3IHB A;  4KZB A;  1OTI A;  2HJE A;  4YIN A;  2Y2M A;  1JWP A;  3UDX A;  1RGY A;  1S0W A;  4E3M A;  1I2S A;  4EBN A;  4X56 A;  4OVD A;  3T4O A;  2DRW A;  2J3W A;  2K31 A;  3VOY A;  1XJ4 A;  1TS6 A;  1ZHH B;  5IU1 A;  1S1Z A;  5DJT A;  3ZCZ A;  3NCK A;  4OQG A;  2VA0 A;  1LL5 A;  2J3T D;  1NZU A;  5EVL A;  2X02 A;  1PNE A;  3LR4 A;  3V5M A;  3DTE A;  1VQQ A;  5EVI B;  1L0G A;  4XUX A;  1YSQ A;  3MQQ A;  4XT2 B;  4E3L A;  4II7 A;  3GEC A;  1CEF A;  3IT9 A;  4MBK A;  4EEU A;  2ZJ9 A;  4K0W A;  1UGU A;  4S2M A;  4Y5F A;  4F94 A;  3H9W A;  2DMW A;  2KDK A;  4S2K A;  1D1J A;  2V0U A;  1L0D A;  4UQI S;  1TDG A;  4HES A;  1Z6F A;  4OON A;  2JC7 A;  2A2L A;  4HJ6 A;  3GRJ A;  4MEZ A;  1YLP A;  3IXB A;  1IEM A;  1K6R A;  3A0R A;  5EVI D;  2D01 A;  2EX6 A;  4UAA A;  3VP2 A;  3VE4 A;  2ZC5 B;  4L9F A;  3MR0 A;  5F1F A;  1EW0 A;  1K56 A;  3CLO A;  3EGX C;  4QD4 A;  1XFN A;  3HLW A;  3VFF A;  2V8F A;  1K4E A;  5HL6 A;  1ALQ A;  2IWB A;  2A49 A;  2IWC A;  4FCF A;  1DP8 A;  2Y2J A;  3T1R A;  3ZG9 B;  4JGP A;  4I3I A;  3UB6 A;  3PHY A;  2GDN A;  3ZGA B;  4OQI A;  3UE1 A;  4JF6 A;  5D3O A;  4P0M A;  1YLJ A;  3C7V A;  1CI8 A;  1GCE A;  2XD5 A;  4QHC A;  1MY8 A;  3A3E A;  1XPB A;  1LI9 A;  3N8S A;  2ZMF A;  5HWW A;  3GDI A;  3C5A A;  4S2L A;  4LV2 A;  4Y2F A;  3JYI A;  4Y15 A;  3E2K A;  2ZM8 A;  5L10 A;  3K2N A;  1Z09 A;  1GA9 A;  4LGW A;  5FI2 A;  2WUQ A;  4GN2 A;  2EFU A;  1PZO A;  3PYP A;  3ICY A;  1ERO A;  3NOU C;  3R7W A;  3UPP A;  4GHI B;  4HNB A;  3VP0 A;  2D02 A;  5FSR A;  1SCW A;  3RTY A;  4GJ4 A;  2I9V A;  3H82 B;  4GCZ A;  3EQV A;  3OCN A;  2W3H A;  1OTA A;  2OAP 1;  4DDY A;  4OOY A;  1HZO A;  3S4X A;  3SH8 A;  4RX2 A;  5JYP A;  1JTG A;  3BWL A;  3PBQ A;  1TD5 A;  3E0Y A;  4WN5 A;  1YMX A;  3P7N A;  3P98 A;  3A3I A;  2HP9 A;  2BLS A;  3E4Q A;  3KSI A;  3UB9 A;  3KSG A;  3PAG A;  4DMZ A;  1K55 A;  4KG5 A;  1LSX A;  5EVI C;  4X1M A;  5GLD A;  2PR5 A;  4EEP A;  3GMW A;  2X71 A;  4U0T A;  1JTD A;  2BAS A;  3T4J A;  3FWL A;  2C5W B;  5FQI A;  4WUJ A;  2L0W A;  2B02 A;  3QNB A;  1ES2 A;  2VKS A;  2P74 A;  3D9Y A;  3OPH A;  5A90 A;  3LY3 A;  3WS4 A;  1L3L A;  2ZL1 B;  3VV4 A;  2AVX A;  2O0Y A;  3S7Q A;  4N9L A;  3MZD A;  3ZVW A;  1TS0 A;  3E4P A;  5HDS A;  4GOG A;  3V50 A;  4WEJ A;  5K5B A;  4CLC B;  3MJQ A;  1IKG A;  1L0F A;  3MXR A;  4B88 A;  5A8B A;  1MWR A;  1KGG A;  5DJU A;  3IXH A;  1DRM A;  4DJ3 A;  3G2Y A;  4DE3 A;  4I38 A;  1OME A;  4BLM A;  5L09 A;  2E8J A;  3DBA A;  1CQA A;  4Y17 A;  4MN6 A;  2EFX A;  3Q07 A;  1XGI A;  3CPT A;  2QYB A;  4HOI A;  1IYQ A;  4MCW A;  1G6O A;  4QB8 A;  5GHZ A;  2Y91 A;  3C2W A;  2I72 A;  4CLC D;  3GSG A;  4IUH A;  3CG5 A;  3UY6 A;  1F5M A;  1LSW A;  2W1T B;  4BQM A;  1PFL A;  3B42 A;  3LR0 A;  1K54 A;  3OZH A;  4GD6 A;  3NOP C;  3LCE A;  4KG6 A;  2PT7 A;  1LL9 A;  2XH9 A;  5AQA A;  1I2W A;  1FCO A;  5AVF A;  2ZC6 B;  2JKR I;  4C75 A;  2L4R A;  4OPY A;  3OPR A;  5HZH A;  2Y2H A;  4GB7 A;  1NZO A;  3PR6 A;  3VP4 A;  5EV0 A;  4G3W A;  2EA9 A;  4JF5 A;  4WF0 A;  2WGV A;  3NI9 A;  3Q7V B;  2WGW A;  3MFD A;  1D7E A;  5A92 A;  5FEG A;  1Y28 A;  3MZE A;  2R9W A;  4R70 A;  3Q81 A;  1G28 A;  5AVE A;  4F3L A;  4WMC A;  2OOL A;  2VEA A;  5KMW A;  1YKD A;  1MPL A;  3F1P A;  5I94 A;  2C6W B;  3QP6 A;  3IS2 B;  1ES3 A;  4R38 A;  4JXW A;  2WKP A;  4BD0 A;  3MBZ A;  3BFE A;  4KZ5 A;  1PRQ A;  1S4S A;  5TGF A;  1T1B A;  2XK1 A;  2XFT A;  5MC7 A;  1ONG A;  4BJP A;  4KQQ A;  4N9K A;  1L2S A;  2Y8H A;  1PW1 A;  5FQK A;  3WS0 A;  3F1O B;  2EWW A;  3V39 A;  4NEE D;  4B4X A;  1MWU A;  2XRO A;  1LHY A;  4UA9 A;  1V9Z A;  4QWO A;  1ONH A;  3UME A;  1DY6 A;  3U2A A;  4PHT A;  4OQH A;  3E98 A;  2WKI A;  2PD8 A;  2HP6 A;  2KLI A;  3BFG A;  3A0S A;  1ACF A;  2HZ5 A;  3LR3 A;  1VM1 A;  3H7W B;  3T4S A;  1ES5 A;  5DTK A;  5HD3 A;  1NRF A;  2JKT M;  5J8X A;  4EER A;  1JNU A;  3FZC A;  4NK3 A;  3IF6 A;  3VE3 A;  1E3U A;  5E2H A;  3NUL A;  2A24 B;  3ZNY A;  1MKM A;  3BLM A;  4X25 A;  5HWV A;  4OPR A;  3K3C A;  4QJG A;  3S7O A;  4E6X A;  2O9A A;  3LYX A;  3QNC A;  1LT0 A;  4S2P A;  4D2O A;  4EES A;  4Z1W A;  1GSW A;  5F68 A;  2PD7 A;  2V2F F;  5FAS A;  4S2J A;  4P6Z M;  4R1G A;  4EQI A;  1KOU A;  2PDR A;  3WS5 A;  1JWZ A;  4ETX A;  3G2Z A;  2WAD A;  3IX3 A;  4HEF A;  1H8M A;  4ZJ2 A;  4HH2 A;  3AGE A;  1UWN X;  1FR6 A;  4EUZ A;  2QWS A;  4DXB A;  2W1R A;  1VEU B;  3MFX A;  2Z2M B;  1GHI A;  4ZDX A;  3NJA A;  3MZF A;  3SH9 A; 
#chains in the Genus database with same CATH homology
 4UA6 A;  3FKV A;  1FSW A;  2XD5 A;  1TDL A;  3WRT A;  5DVA A;  4QHC A;  4E3I A;  1MY8 A;  3A3E A;  4IBX A;  1XPB A;  1LI9 A;  2JCH A;  2WGW B;  3N8S A;  4R3J A;  4WM9 A;  5FAO A;  1Q2P A;  5FAT A;  1G68 A;  3W4P A;  2PU2 A;  1NYM A;  4E6W A;  3C5A A;  2JE5 A;  3BRM A;  4S2L A;  4LV2 A;  1PWG A;  3JYI A;  5HAI A;  3DW0 A;  4X6T A;  2IWD A;  3E2K A;  2ZM8 A;  4FD8 A;  4S2N A;  1ES4 A;  3HRE A;  3N7W A;  4KG2 A;  4WZ5 C;  3HUM A;  5M1A A;  4XUZ A;  1GA9 A;  1BLC A;  1SDN A;  4X69 A;  1KVM A;  1K54 C;  4UHU A;  5FI6 A;  5FI2 A;  2G2U A;  4BLM A;  3IXG A;  1BSG A;  1KDW A;  2ZQ8 A;  2WUQ A;  4GN2 A;  4R4S A;  1ERM A;  2Y2O A;  4A5R A;  1BLH A;  1AXB A;  1XGJ A;  5F83 A;  3UDF A;  4HBT A;  3HBR A;  5FAQ A;  5HAQ A;  2WZZ A;  1S6R A;  1XA1 A;  1M6K A;  1TEM A;  4OLG A;  2EFU A;  3IHA A;  4ZBE A;  3ZNT A;  1PZO A;  2J7V A;  1EWZ A;  3EQU A;  1ERO A;  4X55 A;  3NC8 A;  1K55 C;  4JXS A;  5GLB A;  1I5Q A;  3VSL A;  3UPP A;  5HW3 A;  1RGZ A;  2EX9 A;  3G32 A;  3IQA A;  3VP0 A;  5FSR A;  4U3T A;  1SCW A;  1MXO A;  2PU4 A;  5AQ7 A;  5DTS A;  1IYS A;  5DTT A;  4WEL A;  4Y7P A;  4MNR A;  2Y4A A;  4U0X A;  3WRZ A;  1K25 A;  4E3O A;  3GR2 A;  2Q9M A;  5TFQ A;  5A93 A;  4WMC D;  4Y0O A;  3EQV A;  4OH0 A;  3V3R A;  3OCN A;  1WYC A;  2JBF A;  2XQZ A;  1YLZ A;  2CC1 A;  4PM6 A;  5E2F A;  3G31 A;  4S2O A;  5HX9 A;  1RCJ A;  4YFM A;  4GKU A;  4DKI A;  1K6S A;  4BL2 A;  2Y59 A;  4GDB A;  3RJU A;  4RVA A;  3DTM A;  3SH7 A;  4DDY A;  3Q7V A;  2Y2I A;  2VGK A;  1FOF A;  3HUN A;  2DCF A;  4OP5 A;  3HLE A;  1HZO A;  3CJM A;  4OOY A;  3S4X A;  3SH8 A;  4RX2 A;  5JYO A;  1JTG A;  1ESI A;  5JYP A;  4KZ6 A;  2XR0 A;  4ZJ3 A;  2RCX A;  3PBQ A;  1CEG A;  3G34 A;  4RA7 A;  3UE3 A;  3P09 A;  3G30 A;  1YMX A;  3C7U A;  4OP8 A;  3P98 A;  4QY5 A;  1H8Z A;  4XXR A;  1BZA A;  4ZAM A;  1TVF A;  3A3I A;  4N1X A;  4FSF A;  2HP9 A;  2V20 A;  2BLS A;  4KQO A;  4K91 A;  4X68 A;  5F82 A;  4C3Q A;  4C6Y A;  2OV5 A;  4H8R A;  5E43 A;  1YQS A;  3TG9 A;  4Z9Q A;  3PAG A;  3PBS A;  4DDS A;  4EBP A;  1K55 A;  3WS2 A;  5E2G A;  2HDR A;  3A3J A;  3BLS A;  3PBN A;  4KG5 A;  4OKP A;  2A3U A;  5EVI C;  1EI5 A;  2H5S A;  4EWF A;  5GLD A;  1K4F A;  3BEC A;  3N8L A;  5CTN A;  4FH2 A;  4KZ7 A;  3GMW A;  3O87 A;  3BM6 A;  3VFH A;  2X71 A;  4KZA A;  5GLA A;  4U0T A;  1JTD A;  2ZC7 A;  4UA7 A;  1MBL A;  3VP1 A;  1H8Y A;  2WAF A;  3LO7 A;  1PZP A;  2ZQD A;  1H5X A;  1K57 C;  1L0E A;  3FWL A;  2C5W B;  5FQI A;  4LCM A;  2UWX A;  4GD8 A;  2XDM A;  3M2J A;  2J8Y A;  3DWK A;  3QNB A;  1XKZ A;  5CHU A;  4LV3 A;  4N92 A;  2H0T A;  4R4R A;  3O3V A;  1ES2 A;  4LV1 A;  5CGW A;  2P74 A;  5FI7 A;  3S22 A;  2P9V A;  3OPH A;  5A90 A;  3LY3 A;  2X01 A;  2XLN A;  1N9B A;  5HL1 A;  3WS4 A;  2OLV A;  1KGF A;  2HDS A;  2RL3 A;  3D4F A;  1PI4 A;  4KZ9 A;  4P87 A;  1BT5 A;  4BD1 A;  1PW8 A;  2HPB A;  2WAE A;  2Y55 A;  3BFF A;  2Y2N A;  4N9L A;  5EEC A;  2FFF B;  2XF3 A;  3MZD A;  3ZVW A;  3AGF A;  3BFD A;  3IH8 A;  5DF8 A;  4EBL A;  4KZ3 A;  5HAP A;  1W8Q A;  4HBU A;  4MLL A;  4OOL A;  4R0Q A;  1FSY A;  2ZQ7 A;  4GOG A;  1W8Y A;  5L2F A;  1W79 A;  4KEN B;  3V50 A;  3M6H A;  4WEJ A;  1O7E A;  1BLP A;  4OLD A;  3ISG A;  1KVL A;  5EVI A;  5F1G A;  5CED A;  3ZG5 A;  1ZC2 A;  4R23 A;  2Q9N A;  2DNS A;  1IKG A;  1L0F A;  3MXR A;  4B88 A;  5CEB A;  1MWR A;  1K38 A;  4PPR A;  3UDI A;  4JXV A;  3UE0 A;  1KGG A;  2B5R A;  1CK3 A;  4JF4 A;  3IXH A;  1YLW A;  2PBY A;  3FV7 A;  3IF5 A;  3G2Y A;  4N1H A;  4DE3 A;  1IEL A;  1Q2Q A;  1E3U D;  1K57 A;  2EX2 A;  4JBF A;  4WEK A;  5A91 A;  5HFO A;  4BEN A;  5CRF A;  1OME A;  1GHP A;  2Y2K A;  1YM1 A;  1Y54 A;  3CMZ A;  3FKW A;  5IHV A;  4JKT A;  5TR7 A;  3C4P A;  5DF7 A;  3UNW A;  3ZDJ A;  3G35 A;  4P85 A;  4S2I A;  3RXX A;  1JWV A;  4Y0U A;  1E25 A;  3S1Y A;  3ZG8 B;  3B3X A;  3PAE A;  5AQB A;  2BG1 A;  2EFX A;  3Q07 A;  5AQ9 A;  4JPM A;  3W4O A;  1XGI A;  5FQ9 A;  3IF6 C;  2OLU A;  3SS5 A;  1ZKJ A;  3MKE A;  1IYQ A;  1YT4 A;  3IWI A;  4DXC A;  4L0L A;  4IBR A;  1LI0 A;  1DJA A;  1KE3 A;  1K56 D;  3NDE A;  5FQQ A;  2ZQA A;  5CGS A;  4QB8 A;  3ITB A;  5GHZ A;  1NY0 A;  2Y91 A;  5CTM A;  2I72 A;  3LEZ A;  3HLC A;  3ZG7 B;  2ZLY A;  3GSG A;  4BL3 A;  1YLT A;  1W5D A;  5GHY A;  3OPL A;  2VGJ A;  3CG5 A;  5CHM A;  3UY6 A;  2WGI A;  2ZC4 B;  5E2E A;  3WWX A;  5HAR A;  4BQM A;  2EX8 A;  3BYD A;  3NIA A;  4WZ5 A;  3N6I A;  1ESU A;  1DJC A;  2XEP A;  1K54 A;  3IWO A;  3V3S A;  3OZH A;  1ZG6 A;  2ZQ9 A;  1KE4 A;  2ZQC A;  1IYO A;  3GQZ A;  4GD6 A;  3NBL A;  5G18 A;  3LCE A;  4KG6 A;  2ZC3 B;  1LL9 A;  1HVB A;  2XGN A;  5KSH A;  2XH9 A;  1PWD A;  4GDN A;  5GL9 A;  2ZM0 A;  5AQA A;  1I2W A;  4KZ4 A;  4M3K A;  5EPH A;  5KSC A;  3A3D A;  1FCO A;  2ZC6 B;  3ZHH A;  3WS1 A;  3UPN A;  4C75 A;  3AGD A;  3VOZ A;  2Y2P A;  4CJN A;  4OPY A;  3QHY A;  1WE4 A;  3OPR A;  3SS3 A;  3A3F A;  3IWQ A;  2Y2H A;  1IKI A;  4IVK A;  3OC2 A;  3TSG A;  4DE2 A;  1NZO A;  3N8R A;  4GB7 A;  1HD8 A;  2G2W A;  1FQG A;  2WK0 A;  5FA7 A;  1PWC A;  3ITA A;  3VP4 A;  3OCL A;  4E3J A;  1GA0 A;  1FR1 A;  1XA7 A;  5M19 A;  1KDS A;  4PM7 A;  3G4P A;  3PTE A;  5EOE A;  1NXY A;  2ZM2 A;  4JF5 A;  4PM9 A;  1BUE A;  2WGV A;  3NI9 A;  4E3K A;  3Q7V B;  3PBR A;  4PM5 A;  2WGW A;  1U60 A;  3MFD A;  2EXB A;  5A92 A;  1XX2 A;  2HDU A;  3DWZ A;  3IH9 A;  1G6A A;  1SKF A;  2OSU A;  4LV0 A;  3MZE A;  2R9W A;  5GLC A;  2H10 A;  4S2N C;  3Q81 A;  3GVB A;  3RXW A;  2XFS A;  4WMC A;  5KMW A;  4LCL A;  4OPQ A;  4O7D A;  1W7F A;  4PMA A;  4CPK A;  5CHJ A;  2Y2Q A;  5M18 A;  3PBO A;  3E2L A;  2H0Y A;  4MBH A;  1MPL A;  5KZH A;  5GHX A;  5I94 A;  3TOI A;  2C6W B;  3SS4 A;  3ZFZ A;  1DJB A;  1ES3 A;  3HVF A;  4WBG A;  3HLB A;  4JXW A;  4BD0 A;  1ERQ A;  3MBZ A;  3BFE A;  4B4Z A;  4R3B A;  4KZ5 A;  3UPO A;  4IVI A;  5CEC A;  4DE0 A;  5TGF A;  3UO9 A;  4JXG A;  5BOH A;  3IHB A;  2XK1 A;  4KZB A;  4PM8 A;  2XFT A;  4OOM A;  4YIN A;  2Y2M A;  1JWP A;  3UDX A;  1RGY A;  1S0W A;  4E3M A;  1I2S A;  3Q82 A;  1ONG A;  3OPP A;  4EBN A;  3W4Q A;  4OQ0 A;  4X56 A;  3FYZ A;  4OVD A;  4BJP A;  4KQQ A;  2DRW A;  1E4D A;  4N9K A;  2P9V B;  5U47 A;  1L2S A;  1PW1 A;  5FQK A;  1MWS A;  3VOY A;  4DRT A;  3N4I A;  4E3N A;  3NDG A;  3WS0 A;  3MKF A;  1M40 A;  3V39 A;  2XD1 A;  3BEB A;  3HLF A;  4B4X A;  1MWU A;  3ZCZ A;  2EXA A;  3LY4 A;  3NCK A;  1LHY A;  4OQG A;  2ZMA A;  1LL5 A;  1IYP A;  3HLG A;  1NZU A;  4GNU A;  4UA9 A;  3VSK A;  1PYY A;  1ONH A;  3GV9 A;  4K0X A;  4Y0T A;  4MBF A;  2FFY A;  5EVL A;  2X02 A;  3NY4 A;  2QMI A;  3HUO A;  1RP5 A;  1YLY A;  1DY6 A;  2QZ6 A;  3V5M A;  4NET A;  4ZTK A;  1MWT A;  4P6B A;  3HL9 A;  4OQH A;  1VQQ A;  5EVI B;  1L0G A;  2WKE A;  3CZD A;  4IED A;  4XUX A;  1LLB A;  5CGX A;  3ZG0 A;  1KGE A;  2WKI A;  2Z2L B;  2HP5 A;  2HP6 A;  3W8K A;  1FCN A;  3HLD A;  3BFG A;  4QY6 A;  2WZX A;  3Q7Z A;  4WZ4 A;  1WYB A;  4E3L A;  1NYY A;  1QMF A;  1VM1 A;  4JLF A;  1NJ4 A;  1CEF A;  3O88 A;  3IT9 A;  1ES5 A;  5DTK A;  4MBK A;  3VMA A;  1C3B A;  2ZJ9 A;  4K0W A;  1NRF A;  2J9O A;  4EV4 A;  4S2M A;  5DF9 A;  2Y2G A;  4KZ8 A;  4F94 A;  1QME A;  1MKI A;  1GCE A;  4S2K A;  5J8X A;  4FH4 A;  5EUA A;  1L0D A;  1XXM A;  2ZD8 A;  1TDG A;  4HES A;  2V1Z A;  3FZC A;  1Z6F A;  3C4O A;  3IF6 A;  4NK3 A;  4OON A;  3IXD A;  1E3U A;  1CI9 A;  4X53 A;  2JC7 A;  4ZJ1 A;  5E2H A;  4DF6 A;  3ZNY A;  3MXS A;  1XP4 A;  3GRJ A;  3PBT A;  4MEZ A;  4RYE A;  1YLP A;  3I7J A;  3IXB A;  1IEM A;  1K6R A;  5EVI D;  2WKH A;  3M6B A;  4KQR A;  3BLM A;  1J9M A;  2EX6 A;  4GZB A;  4Q8I A;  2QPN A;  4OPR A;  5CER A;  1KE0 A;  3VP3 A;  3GTC A;  4QJG A;  4UAA A;  4E6X A;  3VP2 A;  2Y2L A;  3QNC A;  4S2P A;  4D2O A;  2ZC5 B;  1GHM A;  5EE8 A;  3BFC A;  1YMS A;  2E8I A;  5F1F A;  1K56 A;  2J9P A;  2V2F F;  3M2K A;  1BTL A;  5FAS A;  1HTZ A;  3ZVT A;  2HDQ A;  4S2J A;  4DE1 A;  4QD4 A;  4R1G A;  5CXW A;  3UN7 A;  1SHV A;  4EQI A;  3HLW A;  3VFF A;  1SDE A;  2WYX A;  2R9X A;  3WS5 A;  1K4E A;  1ALQ A;  1JWZ A;  3G2Z A;  2IWB A;  1FCM A;  2A49 A;  2WAD A;  2IWC A;  4FCF A;  4OPZ A;  5FDH A;  2Y2J A;  4HEF A;  1BUL A;  1JVJ A;  1ZG4 A;  1PI5 A;  4ID4 A;  5FQJ A;  3O86 A;  3Q1F A;  4LEN A;  1PIO A;  4ZJ2 A;  3IF6 B;  3ZG9 B;  3AGE A;  1FR6 A;  4QU3 A;  1O07 A;  4EUZ A;  1BLS A;  2GDN A;  3ZGA B;  4OQI A;  3UE1 A;  4DXB A;  4JF6 A;  1N4O A;  2Z2M B;  1GHI A;  4WYY A;  5D3O A;  4ZDX A;  4P0M A;  3SOI A;  4RX3 A;  5FQM A;  5EOO A;  5FAP A;  3MZF A;  1YLJ A;  3SH9 A;  3C7V A;  1CI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...