3G30A

Ctx-m-9 class a beta-lactamase complexed with compound 3 (g30)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 262
sequence length 262
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g30A00
5GHYA 3G34A 4R4RA 3CG5A 3TSGA 3WRZA 4MBKA 3MFDA 2XD5A 1YMXA 4S2MA 4YFMA 2WZXA 1PW1A 1BLCA 2EX6A 2QZ6A 4LCLA 5CHMA 1CI8A 5AQ9A 3Q7VB 4Y0OA 3BYDA 4Q8IA 1KE4A 3OPPA 4HBUA 2IWDA 1IYOA 5DTTA 1N9BA 3E2KA 3OPRA 2ZC5B 4E3LA 4X55A 1BLSA 2WADA 1RCJA 3QHYA 1WYBA 5GHXA 4M3KA 4QD4A 1YQSA 2PBYA 1K55A 4DRTA 2Y2QA 3UDFA 4GOGA 2Y2LA 2VGKA 1GCEA 2ZMAA 4GN2A 5D3OA 4DXCA 1PIOA 3BFEA 2DRWA 3CMZA 3MZEA 5I94A 5TR7A 4WBGA 5FASA 4WZ4A 3W4PA 3Q1FA 5HFOA 5DF9A 1XX2A 3UPOA 2ZD8A 4QHCA 1PZPA 3VP0A 5EVIA 3V3RA 4E3NA 3AGEA 1YLZA 4OQHA 2ZQCA 3DWZA 5AQ7A 3UY6A 3MXSA 2WYXA 3RXWA 1BSGA 1XP4A 5F1FA 1FCOA 1KDWA 4MNRA 4EBLA 4B88A 4E3KA 1Q2QA 3IXBA 2XEPA 5FQKA 4U0TA 4DE2A 5FAOA 1MY8A 2ZQDA 5U47A 3ZFZA 3G2ZA 1XGIA 2P9VB 1HTZA 2V1ZA 2WGWA 5CGWA 4JPMA 3MZDA 3BEBA 5HX9A 2ZC7A 3BM6A 5CXWA 4Z9QA 1YT4A 3HLEA 1PWDA 2Y2JA 3IQAA 3EQUA 1CEFA 3FYZA 5FATA 2JBFA 4EBNA 3VSLA 1ESUA 4PM5A 3VMAA 1G6AA 1AXBA 4P0MA 4WZ5A 3CZDA 3UPNA 4ZAMA 5IHVA 1O7EA 4RYEA 2A49A 3LY4A 1EWZA 1G68A 5HAPA 4K0WA 3O87A 1L0GA 5JYOA 3ZGAB 2J9PA 4WEJA 4P6BA 2PU2A 1K6SA 4MBHA 3WRTA 3BFFA 2Y91A 2WK0A 5EUAA 1JWZA 2OLUA 1IYSA 2VGJA 4XUXA 3FZCA 2ZC6B 2C5WB 3WS2A 2JC7A 1HVBA 5EECA 2EFUA 3BLMA 4RX2A 1JWVA 1E3UA 3P09A 4ZJ3A 2BLSA 2XQZA 2Y2NA 5GLDA 1KGEA 1ZG6A 3OZHA 4JXSA 4OOYA 4S2NA 2IWBA 4WEKA 1S6RA 2IWCA 3QNBA 3WS1A 1Y54A 2V20A 2B5RA 3HVFA 4KZ4A 3WS0A 3UDIA 2OSUA 3GSGA 2HPBA 4JXWA 2WGVA 3N8RA 5FAQA 4OKPA 2XGNA 1XGJA 3M6BA 3G4PA 3M2KA 3VP2A 5CTNA 4OPQA 1XKZA 3M6HA 3ZG7B 5AQBA 5G18A 3GV9A 4ID4A 4WMCD 5FDHA 3HUMA 5CERA 3V5MA 4EV4A 1PI4A 1IYQA 3WS4A 2ZC3B 4UHUA 1M6KA 4KZ6A 5CHUA 5FQQA 1K6RA 4DF6A 4IVKA 5CECA 1L0FA 4BLMA 1K57C 3TOIA 3AGFA 1CEGA 3V3SA 4B4XA 3IH8A 4FH4A 1W7FA 5FI6A 4KQOA 1NXYA 3W4OA 1YLPA 1IKIA 2Y59A 5FQIA 4X53A 1DJCA 1SKFA 3IF6A 5E2FA 3HUNA 4PPRA 1W8QA 2HDRA 3BFGA 4OP5A 4R4SA 3GVBA 1KGFA 1U60A 2WKEA 4XXRA 4OONA 1FSWA 3G2YA 3GR2A 5TFQA 3PTEA 4PMAA 1EROA 1IKGA 1I2WA 1LI0A 2PU4A 3MKEA 4LV2A 4JXGA 4EUZA 3B3XA 4O7DA 1K54C 3NI9A 4CJNA 2ZC4B 4GKUA 1H8YA 3IXHA 3E2LA 1ONGA 3N8SA 1PWGA 3UDXA 1PYYA 5DF7A 4E3MA 1KVMA 4E6WA 1ESIA 3W4QA 2V2FF 4WYYA 1BZAA 1ES5A 4ZDXA 1ERQA 5E2GA 1VQQA 4GZBA 3C7VA 4BD1A 4R3BA 1VM1A 2EX8A 4KQQA 4C6YA 3V39A 2ZQAA 1NZOA 1LI9A 4GNUA 2ZQ9A 2DNSA 3RJUA 3SS4A 4U0XA 4WMCA 1ES2A 4IEDA 3A3JA 3LCEA 4DE1A 4Y7PA 3C5AA 1TEMA 2FFYA 4DE0A 5A92A 2ZLYA 1EI5A 4R23A 4QB8A 1ES4A 3Q7ZA 3IHBA 5CHJA 3OPHA 4C75A 4DE3A 3ZVTA 2H0TA 1IYPA 1JVJA 4E3JA 3SH8A 4DXBA 2HP6A 1K25A 5EOEA 2ZJ9A 3HL9A 4H8RA 1ZKJA 1IELA 5FQMA 4ZJ1A 4KZBA 3ITAA 2H5SA 3S1YA 3A3IA 4GDNA 4E6XA 4PM6A 4KZ3A 2WKIA 3N7WA 5CGSA 5F1GA 3A3EA 1JTGA 4ZJ2A 5HAQA 1YLJA 2WAFA 1CI9A 4FCFA 1MWSA 1NYYA 1K38A 4BL2A 1HD8A 4IBXA 3NDGA 4P85A 5E2HA 4BJPA 3DW0A 3S4XA 1GHPA 4LV0A 4HESA 5FI7A 2JCHA 3ZG9B 1SDEA 5HL1A 1E25A 5EVIB 2BG1A 4Y0UA 1S0WA 2Z2MB 1OMEA 3WS5A 3WWXA 3C4OA 3UE0A 1GA0A 5KMWA 3OCNA 5DTKA 4JKTA 5GLBA 4WELA 1MXOA 1M40A 3MZFA 1MWTA 4GDBA 4NETA 1XA1A 4A5RA 1QMEA 4UA7A 3SH7A 3NDEA 4HBTA 2XFTA 3G35A 2WGWB 3DWKA 1XPBA 4LENA 2HDSA 4OOLA 4PM9A 5EPHA 1FR1A 1SCWA 4LCMA 1L0EA 2XD1A 3ZG5A 5GL9A 2UWXA 3Q82A 3C4PA 1TVFA 5FQ9A 4KG6A 5A90A 2HDUA 2HP5A 2ZM0A 4PM7A 3IXDA 3AGDA 1XXMA 4S2LA 1BUEA 1YM1A 3NBLA 4LV1A 4N1XA 2DCFA 3C7UA 4OPZA 5F83A 2QMIA 3CJMA 4GB7A 2WGIA 4OPRA 1BLPA 2XLNA 5M18A 4BQMA 2ZM8A 1NJ4A 4DKIA 1LL9A 4R1GA 4X6TA 3V50A 1YLYA 4EWFA 1PI5A 2X71A 5HAIA 3EQVA 4QY5A 4ZBEA 2Y2KA 3BLSA 3Q7VA 1KGGA 1NRFA 3MKFA 3BRMA 4YINA 5EOOA 1QMFA 1PW8A 5A93A 4OVDA 3HUOA 3A3FA 4E3OA 1J9MA 5GLCA 2Y2MA 3UE3A 4BD0A 4N92A 4S2JA 1H5XA 2C6WB 3GTCA 2R9WA 4S2PA 1ERMA 3N8LA 4KZ7A 3ZNTA 3BFCA 3OPLA 4FD8A 2EXBA 2OLVA 4OH0A 3RXXA 2R9XA 3SH9A 1K57A 1JTDA 1MBLA 1I5QA 4B4ZA 5DVAA 2EFXA 4UA9A 4OP8A 3FKWA 3GQZA 3HLGA 2QPNA 1Q2PA 4PM8A 3HREA 4RA7A 1KDSA 2WZZA 5FA7A 2XK1A 1K55C 2H10A 2Z2LB 3IF5A 1XA7A 4UA6A 1Z6FA 3O86A 4UAAA 3NIAA 1BTLA 1MPLA 4JF6A 3VOYA 3OCLA 2FFFB 2OV5A 1TDGA 5L2FA 4NK3A 3M2JA 4X69A 4X68A 2HP9A 4JF5A 1GHMA 1K54A 5TGFA 3ZCZA 3NC8A 2WUQA 3TG9A 4OOMA 4D2OA 2P9VA 1FCMA 1KE3A 1WE4A 5EVIC 2X02A 4MBFA 4KENB 3NY4A 5FAPA 3HLDA 3IF6B 4P87A 5M1AA 4JBFA 5JYPA 3ITBA 2A3UA 5E43A 4KZ8A 1KVLA 3VOZA 5KSCA 3G31A 4N9KA 3ZG0A 3IWQA 2RCXA 4R0QA 3VFHA 2CC1A 1N4OA 1IEMA 3PBNA 5J8XA 4R3JA 1YMSA 4L0LA 1SHVA 3ZNYA 4WM9A 4DDSA 1SDNA 3MXRA 3PBTA 2XFSA 4BL3A 3DTMA 2EXAA 4OLGA 3LO7A 3A3DA 4JF4A 2XR0A 3UN7A 3PBRA 1E3UD 1W79A 1K4FA 4QJGA 2WKHA 4FSFA 1GA9A 3BECA 1MKIA 3IT9A 1RGZA 2Q9MA 3I7JA 1C3BA 5E2EA 5GHZA 4DDYA 1MWRA 4U3TA 2I72A 3GRJA 4N9LA 4FH2A 4QY6A 4WZ5C 3IHAA 4IVIA 3N6IA 3IH9A 4K91A 4S2IA 5CEBA 1H8ZA 5EVLA 4BENA 4F94A 3IWOA 4GD8A 4JXVA 5KSHA 1BLHA 1FOFA 3P98A 4RX3A 3N4IA 4LV3A 2Y55A 2Y2GA 4EBPA 3BFDA 2P74A 3W8KA 3QNCA 3FWLA 2GDNA 3HLCA 5CRFA 3UE1A 3VP1A 3LEZA 1FCNA 3ZVWA 2HDQA 3Q81A 1I2SA 3VFFA 2Y2IA 1K56D 1DJAA 1TDLA 3LY3A 4MEZA 3HBRA 4XUZA 2RL3A 2JE5A 1RP5A 2WAEA 3SOIA 5DF8A 1NZUA 3UO9A 1NY0A 1GHIA 3O3VA 3PBOA 4E3IA 2Y4AA 4S2NC 3S22A 3UNWA 2ZM2A 4GD6A 1W8YA 1NYMA 2J7VA 3FV7A 3VSKA 2XDMA 3VP4A 1FR6A 3PBQA 5HW3A 3G30A 4OQ0A 5GLAA 3NCKA 5EE8A 3IWIA 4S2OA 4OQIA 5HARA 4KG5A 5AQAA 5DTSA 3SS5A 3HLFA 3IXGA 4X56A 2EX9A 4OPYA 1KE0A 4N1HA 3ISGA 5FSRA 2E8IA 4OLDA 5KZHA 2ZQ7A 4CPKA 1ES3A 1HZOA 1ALQA 3PAGA 1LL5A 2X01A 1ONHA 2G2UA 4MLLA 3ZHHA 5FQJA 1K4EA 3OC2A 1DJBA 2Y2OA 5CGXA 2Q9NA 5F82A 1W5DA 4ZTKA 1ZC2A 4KZAA 2ZQ8A 3GMWA 4IBRA 2Y2HA 5CTMA 3MBZA 3ZG8B 3UPPA 5CEDA 1YLTA 3FKVA 2Y2PA 5BOHA 1L0DA 4S2KA 4KG2A 1JWPA 1BULA 5A91A 3IF6C 3PBSA 1YLWA 1LLBA 1L2SA 3HLWA 4JLFA 4KZ9A 1ZG4A 5EVID 1FSYA 1PZOA 1RGYA 5M19A 2EX2A 2XF3A 2H0YA 1BT5A 1K56A 1FQGA 3SS3A 4KQRA 1PWCA 4KZ5A 4C3QA 2XH9A 1DY6A 3O88A 2J9OA 4RVAA 2G2WA 3Q07A 2J8YA 1LHYA 3PAEA 1E4DA 3D4FA 4OQGA 1CK3A 1MWUA 4QU3A 3JYIA 4K0XA 1WYCA 4HEFA 3ZDJA 3HLBA 4EQIA 4Y0TA 5FI2A 3VP3A 3G32A 1O07A
chains in the Genus database with same CATH superfamily
3G34A 3SZTA 3A0RA 3T4JA 5CHMA 3C8CA 1CI8A 5AQ9A 3BYDA 4G3WA 3OPPA 3IS2B 1N9BA 3E2KA 4E3LA 2MJ6A 5FL3A 1WYBA 5GHXA 4M3KA 1K55A 2Y2QA 2V1BA 2VGKA 5D3OA 1PIOA 2DRWA 5I94A 1XX2A 4GS9A 4E3NA 5HSQA 2ZQCA 3DWZA 4PKYA 2WYXA 3RXWA 4MNRA 4EBLA 4U0TA 4DE2A 1MY8A 3ZFZA 2M7UA 1XGIA 4KUKA 3BEBA 5CXWA 3HLEA 3NHQA 2V9AA 2EWVA 4EXOA 2PR5A 4WZ5A 3LY4A 3OBFA 1EWZA 5HAPA 4K0WA 1L0GA 4WEJA 2PAVP 2PU2A 4MBHA 4DJ2A 3WRTA 1SKOA 2Y91A 2ZBBA 1JWZA 2VGJA 1IYSA 2WKPA 2C5WB 3PYPA 1HVBA 3BLMA 4ZJ3A 2Y2NA 1KGEA 5EVEA 1ZG6A 4NXEA 2BTFP 4JXSA 1S6RA 3QNBA 2B5RA 3DTKA 4JXWA 4OKPA 3M6BA 1XKZA 3JPUA 4EV4A 5CHUA 4DF6A 1K6RA 1L0FA 4BLMA 3TOIA 1CEGA 2ZMFA 4EU0A 4R6LA 5EM0A 2Y59A 2PYRA 3C2WA 3ULFA 3ZYTA 4X53A 1SKFA 4Y17A 4X1LA 4OP5A 3GVBA 2WKEA 4DMZA 1I2WA 4HQAA 2W3DA 3B3XA 3NI9A 3E2LA 1ONGA 1PYYA 4E6WA 1ESIA 5HWTA 2VZWA 1ES5A 4GZBA 1VQQA 3DTIA 4GCZA 1VM1A 2EX8A 3IX3A 3V39A 2ZQ9A 1ES2A 2LB5A 5TBMA 4Y7PA 1TEMA 2PRFA 4DE0A 3BQ8A 1EI5A 1OTEA 4R23A 3Q7ZA 3NECA 1LL8A 2JKTM 2KDKA 1IYPA 2D01A 4DXBA 5C5KA 4DN0A 2ZJ9A 4H8RA 4ZJ1A 4KZBA 3A3IA 4E6XA 2B18A 3EGDC 5CGSA 4ME4A 3A3EA 3VOLA 1JTGA 2HJEA 5HAQA 4BL2A 3NDGA 4P85A 4BBTA 4BJPA 5IS1A 1GHPA 4LV0A 2W0NA 4HESA 5FI7A 4YWZA 2JCHA 3ZG9B 5EVIB 3HJKA 2BG1A 1OMEA 3MQOA 2VLGA 3WWXA 5F69A 1GA0A 5KIZA 4JKTA 1QMEA 3MMHA 1PRQA 4UA7A 2WGWB 4PM9A 1XPBA 2HDSA 5GL9A 3C4PA 2Y79A 5FQ9A 4IUKA 2HP5A 4ARZA 3RTYA 1TS6A 3NBLA 4LV1A 4OPZA 4OPRA 2WGIA 3PR6A 3CHWP 3MQ0A 4ZRRA 1PFLA 4GHIB 3V50A 1YLYA 3BLSA 1NRFA 4GW9A 5FDSA 5EOOA 1P0ZA 5FEGA 5A93A 3W2ZA 4BD0A 3UE3A 4NG2A 1UWNX 3T4LA 1V9ZA 4S2PA 4FD8A 1D1JA 2R9XA 4CLCB 2Z6CA 4OP8A 3FKWA 4PM8A 3CI6A 1D7EA 1PNEA 3LIDA 5FA7A 3IF5A 1XA7A 1NLZA 3O86A 3NIAA 4NXGA 3VOYA 1TDGA 4NK3A 4G3KA 1K54A 3ZCZA 4BBVA 5EVIC 4KENB 4JBFA 3ITBA 4PAUA 4KZ8A 1KVLA 2VV6A 5KSCA 2J3WA 2RCXA 3VFHA 2CC1A 2K31A 1IEMA 3ZNYA 1Y4OA 1YMSA 4WM9A 1SDNA 2EXAA 4BWIA 2W27A 3UN7A 5I5LA 1K4FA 5MC7A 2WKHA 3JVVA 4FSFA 4DDYA 2PD8A 1MWRA 3E0YA 3IHAA 4IVIA 2JKRM 3IH9A 4CLCD 3T1XA 1FOFA 4RX3A 4EBPA 1YKDA 3QNCA 5L07A 2XROA 5CRFA 4WUJA 3UE1A 2CMNA 1I2SA 1UWPX 2VV8A 4HY8A 4MEZA 1CJFA 5J7EA 4YNRA 1RP5A 1T1CA 3UO9A 3S22A 2ZM2A 1FR6A 3G30A 4CLCC 5HARA 4OQIA 4MN5A 4NXBA 4OPYA 3ISGA 4OLDA 1TS8A 1ES3A 2X01A 1ALQA 1ONHA 2O99A 1K4EA 4I3JA 5CGXA 3S7PA 4KZAA 4IBRA 1F5MA 3ZG8B 1VETA 1YLTA 3B33A 2Y2PA 1BULA 4R3AA 4B93A 4KZ9A 3HLWA 2V8FA 5G4YA 2J9OA 3Q07A 4I39A 4OQGA 3IX8A 3UB7A 1GSWA 1DP6A 2A2LA 1FILA 3P7NA 4S2MA 1PW1A 1G6OA 2EX6A 4HBUA 3F1OB 3QHYA 1OT9A 4QD4A 2PBYA 4DRTA 1OJGA 3ICYA 4GOGA 3ZQ5A 2ZMAA 4DXCA 1S4SA 3MZEA 3CMZA 2ACGA 5TR7A 3UB6A 3W4PA 2QJ5A 5DF9A 4D60A 3UPOA 2ZD8A 4QHCA 1T1AA 3V3RA 2VEAA 4Y5FA 3AGEA 5IU1A 1BSGA 4GLQA 1FCOA 1KDWA 4E3KA 5FQKA 5FAOA 4LLOB 5L09A 1HTZA 3MQQA 5HX9A 2ZC7A 4Z9QA 3TW8A 3IQAA 3EQUA 4ETZA 3OLOA 4NKPA 3V67A 4P0MA 4L9FA 3UB5P 1AWIA 4ZAMA 5IHVA 1O7EA 1A0KA 3T1RA 5DKLA 3BFFA 2WK0A 5EUAA 1TF1A 3FZCA 3DAVA 3WS2A 4QWOA 5EECA 2EFUA 3D9YA 1E3UA 2XQZA 3QP8A 1X0OA 4WEKA 4KZ4A 3UDIA 2OSUA 2HPBA 2WGVA 3N8RA 2OWJA 1XGJA 3VP2A 3ZG7B 4H6JA 4HNBA 5G18A 1PI4A 3IBJA 2ZC3B 1M6KA 3E4PA 5DFYA 2V0UA 1W7FA 4KQOA 5FQIA 3U2AA 5L8MA 5E2FA 1NLYA 1W8QA 2HDRA 4R4SA 2OOLA 1U60A 3C38A 1FSWA 3GR2A 1EROA 1WA9A 1N9OA 4JXGA 3A0SA 1H8YA 1F9IA 3N8SA 3JVUA 1PWGA 5DF7A 4E3MA 1TS7A 3W4QA 3IBRA 2V2FF 4BMWA 4L9GA 1MKMA 2V1AA 4BD1A 2DMWA 2FH5A 1D06A 2HZ5A 2W3GA 1LI9A 4HIAA 2QKPA 3LCEA 4DE1A 3C5AA 5A92A 1DRMA 2O9CA 3F1NA 3IHBA 3OPHA 4DE3A 1W63Q 4WN5A 4E3JA 3SH8A 1ZKJA 1IELA 3S1YA 4GDNA 4PM6A 2ZL1B 2VK3A 4ZJ2A 1YLJA 1S66L 4Y2FA 2W1RA 3S7QA 5E2HA 3KYEA 3LICA 3K2NA 5IT5A 1SDEA 5EV0A 3K3DA 3LIBA 4MN6A 4LPZA 3MS6A 3L7HA 3R7WA 1MXOA 1M40A 4NETA 1XA1A 3KYZA 4A5RA 4HOIA 3NDEA 3NJAA 4HBTA 2XFTA 3DWKA 4LENA 1XJ6A 2J3TD 1SCWA 4LCMA 3ZG5A 3Q82A 5A90A 1STZA 3AGDA 4JGQA 4MCWA 4EERA 3B47A 4XT2B 2FZ0A 4N1XA 5F83A 3TRCA 1VEUB 3LEQA 5G4ZA 1F98A 1LL9A 4R1GA 4X6TA 1MZUA 4QY5A 2Y2KA 1KGGA 2WKRA 3MKFA 2J3TC 4E04A 3BRMA 3VP3A 3IS2A 3A3FA 5GLCA 4PHTA 4N92A 4S2JA 2R9WA 1XJ3A 5HDDA 1JTDA 2EFXA 4Y13A 1Q2PA 3NULA 3HREA 1T1BA 4F3LB 2XK1A 4LGWA 4UAAA 4JF6A 4ETXA 3EOIA 3M2JA 4JF5A 4WF0A 4O8GA 5TGFA 3TG9A 4D2OA 1FCMA 1KE3A 1N9LA 4MMNA 3NY4A 3IF6B 5E43A 1XJ4A 3G31A 3IWQA 2AVXA 4R0QA 3PBNA 1K0KA 5J3WA 4BL3A 4Q0IA 3DTMA 2QYBA 3LO7A 4OLGA 4MDZA 4QJGA 2Y8HA 3LI9A 1RGZA 1C3BA 5E2EA 5GHZA 4U3TA 4X1MA 2I72A 4N9LA 4EBNA 4FH2A 4JGPA 3IWOA 4GD8A 3K3CA 1SZVA 2LB9A 3N4IA 1ZTUA 2Y2GA 3W8KA 3FWLA 2GDNA 3ZVWA 1FIKA 2Y2IA 1DJAA 2P7JA 1TDLA 3LY3A 4XUZA 2RL3A 4R38A 2JE5A 1NZUA 1NY0A 2HJ9C 1GHIA 3O3VA 3T1SA 3C30A 4S2NC 3KSFA 3CUEC 1W8YA 2XDMA 3VP4A 5DFXA 4KG5A 1OJ5A 5DTSA 3IXGA 3D72A 4N1HA 2E8IA 3EWKA 5KZHA 3QP4A 2OWHA 3ZHHA 5HDCA 1DJBA 4EW7A 1ZC2A 1MC0A 2Y2HA 4Q0JA 5CTMA 1L0DA 2L4RA 4S2KA 4KG2A 3IF6C 3PBSA 1L2SA 5EVID 2PBDP 1PZOA 5M19A 3TE8A 1BT5A 3E4OA 1FQGA 1PWCA 4C3QA 3O88A 1DY6A 1YSQA 3LR3A 1CK3A 4Y0TA 3HLBA 4I3IA 5HWVA 4R4RA 2XD5A 1YMXA 4YFMA 1BLCA 2QZ6A 4LCLA 2VA0A 3Q7VB 4Y0OA 4Q8IA 2IWDA 1IYOA 2ZC5B 4X55A 4EQ1A 4GN2A 3BFEA 3R4KA 5HFOA 1PZPA 5EVIA 2Q0OA 4OQHA 1XFNA 5F1FA 1XP4A 5EFWA 4B88A 1Q2QA 5U47A 3G2ZA 3MJQA 3LIAA 2P9VB 2WGWA 3E98A 5CGWA 3FC7A 3MZDA 1YT4A 4NXFA 2Y2JA 5HDSA 5DJUA 3KO6A 3FYZA 5FATA 2JBFA 2W1TB 3VMAA 2M7VA 3UPNA 4CQHA 3O5YA 1G68A 4GHIA 4EEPA 2J9PA 2WKQA 4P6BA 2OLUA 2A24B 3MR0A 2HF6A 4RX2A 1JWVA 3P09A 5GLDA 2HGVA 4I5SA 2H28A 4OOYA 2IWBA 4DJ3A 3WS1A 1Y54A 3HVFA 3GSGA 5FAQA 4CLCA 2XGNA 3HJIA 3G4PA 4EUVA 1OTBA 4OPQA 4HP9A 3H7WB 5AQBA 4MN7A 4EESA 4AFIA 4WMCD 4LRYC 3V5MA 2OAP1 3H82B 1S4RA 4UHUA 4KZ6A 3LR5A 1K57C 3CITA 3QP5A 5HL6A 3CPTB 5FI6A 1NXYA 1IKIA 1DJCA 3BFGA 3VE3A 4X25A 4XXRA 2PYPA 3BQAA 4FUWA 1IKGA 2PU4A 4LV2A 4HH2A 4EUZA 4B9OA 3T4KA 2ZC4B 2O9BA 4GKUA 3IXHA 1W63M 3UMEA 2P08A 3A0VA 4WYYA 1BZAA 2QWSA 1ERQA 5E2GA 1J3WA 3C7VA 1Z09A 3F1PB 3B42A 2JKFA 4R3BA 4C6YA 2ZQAA 2PDRA 4GNUA 2DNSA 3RJUA 4WMCA 2FFYA 2ZLYA 1DP8A 3QP1A 5CHJA 3QP2A 4C75A 4YOFA 3NOPC 1JVJA 2G7UA 5EOEA 2VKSA 5FQMA 1XFQA 4KZ3A 2WKIA 3N7WA 5F1GA 5HPIA 4IJGA 1CI9A 3T1QB 1MWSA 1HD8A 4IBXA 2K7SA 3BY8A 3FPWA 4GS9B 5HL1A 1S0WA 2NUPC 3UE0A 3KX0X 5KMWA 3OCNA 5GLBA 4WELA 3MZFA 1MWTA 2XA7S 2XD1A 2UWXA 2KLIA 4KG6A 2HDUA 4PM7A 3IXDA 1XXMA 1BUEA 1YM1A 1GSVA 2DCFA 1LSWA 4I38A 4GB7A 5M18A 4DKIA 4EWFA 3EQVA 4ZBEA 4UQIS 1SKOB 2JKGA 3F1OA 1PW8A 3HUOA 2VV7A 4E3OA 1J9MA 1H5XA 3BY9A 1XJ2A 4P6ZS 4KZ7A 3ZNTA 3OPLA 1P9RA 3RH8B 1T19A 1I5QA 4B4ZA 5DVAA 4UA9A 3NOUC 2KOIA 4O0PA 2QPNA 1IOUA 4I3AA 1VB6A 2HV1A 4Z1WA 1ACFA 1K55C 1Z6FA 2GJ3A 1LSVA 3OCLA 2FFFB 2I9VA 5L10A 4CLCE 4X69A 4X68A 2EA9A 1GHMA 3P01A 5EM1A 2WUQA 4OOMA 3GECA 2XA7M 2X02A 4MBFA 5FAPA 3HLDA 5M1AA 3LR0A 2A3UA 4JGOA 4IHQA 4N9KA 2YKFA 3ZG0A 5DJTA 1N4OA 4ESPA 5J8XA 2NUTC 4R3JA 4L0LA 1SHVA 3EGXC 3OOVA 4DDSA 3MXRA 5LBRA 3UB8A 3A3DA 4JF4A 1YPRA 4UQIM 1W79A 1GA9A 3BECA 2R78A 3IT9A 4HJ3A 3LIFA 4WZ5C 4QY6A 3N6IA 5CEBA 1H8ZA 3RFBA 4BENA 4F94A 5TBMB 4LV3A 4P6ZM 2Y55A 1CQAA 3MF0A 4RQ9A 1JNUA 3BFDA 3EEHA 3HLCA 3VP1A 1FCNA 4G3VA 3Q81A 1K56D 1T18A 2GX5A 5K5BA 3LIEA 2WAEA 1P97A 5DF8A 4E3IA 3PBOA 2JKRI 2OAQ1 2Y4AA 4GD6A 3L9KA 3FV7A 3CWFA 5HW3A 5FEFA 5GLAA 3NCKA 3IWIA 4S2OA 5AQAA 3E4QA 3HLFA 3VE4A 4X56A 5FSRA 1KE0A 2M1CA 3MSHA 2QJ7A 1HZOA 1LL5A 3KSHA 3H9WA 4WLAA 5FQJA 5F82A 2W3EA 2ZQ8A 3GMWA 3MBZA 5CEDA 5BOHA 3D3OA 2VJWA 1LLBA 4JLFA 2D02A 1RGYA 3FPVA 1OTIA 2EX2A 3LGOA 2H0YA 4ARZB 1K56A 3SS3A 3KSGA 4RVAA 2G2WA 2J8YA 1LHYA 3PAEA 1E4DA 3D4FA 1MWUA 3JYIA 4K0XA 1WYCA 4Y15A 4HEFA 3ZDJA 4EQIA 1DP9A 5GHYA 3WRZA 3CG5A 3TSGA 4MBKA 3MFDA 3DTEA 5J4EA 1VHMA 2WZXA 5AVEA 3NOTC 1KE4A 1GSXA 2QHKA 5DTTA 3OPRA 1NRJA 1BLSA 2WADA 1RCJA 2ZL1A 1YQSA 4LFUA 2P04A 3TJZC 2J80A 3UDFA 2Y2LA 1GCEA 1G28A 1H3QA 4WBGA 5FASA 4WZ4A 3Q1FA 3VP0A 4HJ6A 1YLZA 2L0WA 5AQ7A 3UY6A 2IA2A 3MXSA 4WL9A 3IXBA 2XEPA 2JN7A 3VV4A 4EEUA 2ZQDA 4BBUA 3S7OA 3EEAA 2V1ZA 4JPMA 3BM6A 2Z6DA 1PWDA 1YSPA 1P9WA 1CEFA 3S7NA 3VSLA 1ESUA 4PM5A 1G6AA 1AXBA 5F68A 3CZDA 3G6OA 4XT2A 5TJJA 4RYEA 2A49A 1VEUA 4UEYA 1LT0A 3O87A 5JYOA 3ZGAB 3T4TA 3GDIA 1K6SA 1TD5A 3SW1A 1IFQA 4XUXA 4FTXA 2ZC6B 4Q0HA 3UMDA 2JC7A 2BLSA 2B95A 4L9EA 4HP4A 3OZHA 4S2NA 3CUEA 2IWCA 2V20A 3WS0A 4HI4A 4II7A 3M2KA 3MXQA 5CTNA 3M6HA 1ODVA 4F3LA 2O0YA 3GV9A 4ID4A 5FDHA 2YKHA 3HUMA 5CERA 1L3LA 1IYQA 3WS4A 5FQQA 4IVKA 5CECA 3LUQA 3AGFA 4HJ4A 3V3SA 1LSXA 4KUOA 1N9NA 4B4XA 3IH8A 4FH4A 3W4OA 1YLPA 1Y28A 5DKKA 3IF6A 3HUNA 4PPRA 3PHYA 1KGFA 4M4XA 5HD3A 1S67L 4OONA 3G2YA 5TFQA 3PTEA 4PMAA 1LI0A 3MKEA 4O7DA 4HHDA 1K54C 4CJNA 1VETB 3U4LP 3UDXA 1KVMA 4ZDXA 4KQQA 2PR6A 1NZOA 3SS4A 2INWA 4U0XA 4IEDA 3A3JA 3KYQA 2BASA 4QB8A 1ES4A 2L1MA 4Y3IA 3ZVTA 2H0TA 2XSSA 3CAXA 2HP6A 1K25A 3HL9A 1YAXA 5CX7A 1OTAA 2H5SA 3ITAA 3FG8A 2WAFA 4FCFA 1NYYA 1K38A 2VGLS 1HLUP 1EW0A 3DW0A 3S4XA 5HWWA 2W3HA 3LYXA 1E25A 4Y0UA 2Z2MB 3WS5A 3C4OA 1ZHHB 2PD7A 1F2KA 5DTKA 4LRZE 4GDBA 5AJGA 3SH7A 3CLOA 3G35A 5EPHA 4OOLA 1UGUA 1FR1A 2UV0E 1L0EA 5HD5A 5HZHA 1TVFA 3T4SA 2ZM0A 1H0MA 3T4QA 4S2LA 4KQDA 3C7UA 2EWWA 2QMIA 3CJMA 1BLPA 2XLNA 3T12B 4BQMA 2ZM8A 1NJ4A 2V8CA 1PI5A 3T50A 2X71A 5HAIA 4HH3A 3Q7VA 3IX4A 2ZOHA 4YINA 1QMFA 4OVDA 2B02A 2JHEA 2Y2MA 2C6WB 3GTCA 2K2NA 1ERMA 3N8LA 2VGLM 3BFCA 1OPXA 2EXBA 2OLVA 4OH0A 3RXXA 3SH9A 5AVFA 1K57A 1MBLA 3HLGA 3GQZA 4H6JB 4RA7A 1V9YA 1KDSA 2WZZA 2Z2LB 2H10A 4UA6A 1BTLA 1MPLA 2VX8A 2OV5A 3LFVA 5L2FA 3BJNA 2HP9A 4FOFA 4O01A 2XRNA 3NC8A 4EETB 2P9VA 1WE4A 1OTDA 4P87A 1KOUA 1S1ZA 5JYPA 3UB9A 1BYWA 1OT6A 2W3FA 3VOZA 2W1TA 3HCYA 2KX6A 1G5UA 5F6AA 3PBTA 2XFSA 3T4OA 2XR0A 4JGRA 3PBRA 4LRXC 1E3UD 3DBAA 1MKIA 2Q9MA 3I7JA 4NEED 2A24A 3GRJA 3UE6A 4S2IA 4K91A 2JKTI 5EVLA 2O9AA 4JXVA 5KSHA 1BLHA 3P98A 3QP6A 4PKYG 1H8MA 4QPRA 2P74A 3F1NB 5F5YA 3LEZA 2HDQA 3VFFA 3HBRA 3H7WA 2GZAA 5HPFA 3SOIA 3H82A 3UNWA 2PHYA 2J7VA 1NYMA 3BW6A 3VSKA 3PBQA 1NWZA 4OQ0A 5EE8A 2ZOIA 3BWLA 3CPTA 3SS5A 2EX9A 2ZQ7A 4CPKA 3LI8A 5A8BA 4IUHA 3KSIA 3PAGA 2G2UA 4MLLA 3OC2A 2PT7A 2Y2OA 2Q9NA 4GJ4A 4R70A 1W5DA 4ZTKA 3R7WB 3MFXA 3UPPA 3FKVA 1JWPA 5A91A 1YLWA 1ZG4A 3LR4A 2GNXA 3PXPA 1FSYA 2XF3A 3F1PA 1S1YA 4KQRA 4KZ5A 4K08A 2XH9A 1TS0A 2V0WA 4QU3A 2ZMVA 2E8JA 5FI2A 1CF0A 3G32A 1O07A
chains in the Genus database with same CATH topology
5GHYA 3G34A 4R4RA 3CG5A 3TSGA 3WRZA 4MBKA 3MFDA 2XD5A 1YMXA 4S2MA 4YFMA 2WZXA 1PW1A 1BLCA 2EX6A 2QZ6A 4LCLA 5CHMA 1CI8A 5AQ9A 3Q7VB 4Y0OA 3BYDA 4Q8IA 1KE4A 3OPPA 4HBUA 2IWDA 1IYOA 5DTTA 1N9BA 3E2KA 3OPRA 2ZC5B 4E3LA 4X55A 1BLSA 2WADA 1RCJA 3QHYA 1WYBA 5GHXA 4M3KA 4QD4A 1YQSA 2PBYA 1K55A 4DRTA 2Y2QA 3UDFA 4GOGA 2Y2LA 2VGKA 1GCEA 2ZMAA 4GN2A 5D3OA 4DXCA 1PIOA 3BFEA 2DRWA 3CMZA 3MZEA 5I94A 5TR7A 4WBGA 5FASA 4WZ4A 3W4PA 3Q1FA 5HFOA 5DF9A 1XX2A 3UPOA 2ZD8A 4QHCA 1PZPA 3VP0A 5EVIA 3V3RA 4E3NA 3AGEA 1YLZA 4OQHA 2ZQCA 3DWZA 5AQ7A 3UY6A 3MXSA 2WYXA 3RXWA 1BSGA 1XP4A 5F1FA 1FCOA 1KDWA 4MNRA 4EBLA 4B88A 4E3KA 1Q2QA 3IXBA 2XEPA 5FQKA 4U0TA 4DE2A 5FAOA 1MY8A 2ZQDA 5U47A 3ZFZA 3G2ZA 1XGIA 2P9VB 1HTZA 2V1ZA 2WGWA 5CGWA 4JPMA 3MZDA 3BEBA 5HX9A 2ZC7A 3BM6A 5CXWA 4Z9QA 1YT4A 3HLEA 1PWDA 2Y2JA 3IQAA 3EQUA 1CEFA 3FYZA 5FATA 2JBFA 4EBNA 3VSLA 1ESUA 4PM5A 3VMAA 1G6AA 1AXBA 4P0MA 4WZ5A 3CZDA 3UPNA 4ZAMA 5IHVA 1O7EA 4RYEA 2A49A 3LY4A 1EWZA 1G68A 5HAPA 4K0WA 3O87A 1L0GA 5JYOA 3ZGAB 2J9PA 4WEJA 4P6BA 2PU2A 1K6SA 4MBHA 3WRTA 3BFFA 2Y91A 2WK0A 5EUAA 1JWZA 2OLUA 1IYSA 2VGJA 4XUXA 3FZCA 2ZC6B 2C5WB 3WS2A 2JC7A 1HVBA 5EECA 2EFUA 3BLMA 4RX2A 1JWVA 1E3UA 3P09A 4ZJ3A 2BLSA 2XQZA 2Y2NA 5GLDA 1KGEA 1ZG6A 3OZHA 4JXSA 4OOYA 4S2NA 2IWBA 4WEKA 1S6RA 2IWCA 3QNBA 3WS1A 1Y54A 2V20A 2B5RA 3HVFA 4KZ4A 3WS0A 3UDIA 2OSUA 3GSGA 2HPBA 4JXWA 2WGVA 3N8RA 5FAQA 4OKPA 2XGNA 1XGJA 3M6BA 3G4PA 3M2KA 3VP2A 5CTNA 4OPQA 1XKZA 3M6HA 3ZG7B 5AQBA 5G18A 3GV9A 4ID4A 4WMCD 5FDHA 3HUMA 5CERA 3V5MA 4EV4A 1PI4A 1IYQA 3WS4A 2ZC3B 4UHUA 1M6KA 4KZ6A 5CHUA 5FQQA 1K6RA 4DF6A 4IVKA 5CECA 1L0FA 4BLMA 1K57C 3TOIA 3AGFA 1CEGA 3V3SA 4B4XA 3IH8A 4FH4A 1W7FA 5FI6A 4KQOA 1NXYA 3W4OA 1YLPA 1IKIA 2Y59A 5FQIA 4X53A 1DJCA 1SKFA 3IF6A 5E2FA 3HUNA 4PPRA 1W8QA 2HDRA 3BFGA 4OP5A 4R4SA 3GVBA 1KGFA 1U60A 2WKEA 4XXRA 4OONA 1FSWA 3G2YA 3GR2A 5TFQA 3PTEA 4PMAA 1EROA 1IKGA 1I2WA 1LI0A 2PU4A 3MKEA 4LV2A 4JXGA 4EUZA 3B3XA 4O7DA 1K54C 3NI9A 4CJNA 2ZC4B 4GKUA 1H8YA 3IXHA 3E2LA 1ONGA 3N8SA 1PWGA 3UDXA 1PYYA 5DF7A 4E3MA 1KVMA 4E6WA 1ESIA 3W4QA 2V2FF 4WYYA 1BZAA 1ES5A 4ZDXA 1ERQA 5E2GA 1VQQA 4GZBA 3C7VA 4BD1A 4R3BA 1VM1A 2EX8A 4KQQA 4C6YA 3V39A 2ZQAA 1NZOA 1LI9A 4GNUA 2ZQ9A 2DNSA 3RJUA 3SS4A 4U0XA 4WMCA 1ES2A 4IEDA 3A3JA 3LCEA 4DE1A 4Y7PA 3C5AA 1TEMA 2FFYA 4DE0A 5A92A 2ZLYA 1EI5A 4R23A 4QB8A 1ES4A 3Q7ZA 3IHBA 5CHJA 3OPHA 4C75A 4DE3A 3ZVTA 2H0TA 1IYPA 1JVJA 4E3JA 3SH8A 4DXBA 2HP6A 1K25A 5EOEA 2ZJ9A 3HL9A 4H8RA 1ZKJA 1IELA 5FQMA 4ZJ1A 4KZBA 3ITAA 2H5SA 3S1YA 3A3IA 4GDNA 4E6XA 4PM6A 4KZ3A 2WKIA 3N7WA 5CGSA 5F1GA 3A3EA 1JTGA 4ZJ2A 5HAQA 1YLJA 2WAFA 1CI9A 4FCFA 1MWSA 1NYYA 1K38A 4BL2A 1HD8A 4IBXA 3NDGA 4P85A 5E2HA 4BJPA 3DW0A 3S4XA 1GHPA 4LV0A 4HESA 5FI7A 2JCHA 3ZG9B 1SDEA 5HL1A 1E25A 5EVIB 2BG1A 4Y0UA 1S0WA 2Z2MB 1OMEA 3WS5A 3WWXA 3C4OA 3UE0A 1GA0A 5KMWA 3OCNA 5DTKA 4JKTA 5GLBA 4WELA 1MXOA 1M40A 3MZFA 1MWTA 4GDBA 4NETA 1XA1A 4A5RA 1QMEA 4UA7A 3SH7A 3NDEA 4HBTA 2XFTA 3G35A 2WGWB 3DWKA 1XPBA 4LENA 2HDSA 4OOLA 4PM9A 5EPHA 1FR1A 1SCWA 4LCMA 1L0EA 2XD1A 3ZG5A 5GL9A 2UWXA 3Q82A 3C4PA 1TVFA 5FQ9A 4KG6A 5A90A 2HDUA 2HP5A 2ZM0A 4PM7A 3IXDA 3AGDA 1XXMA 4S2LA 1BUEA 1YM1A 3NBLA 4LV1A 4N1XA 2DCFA 3C7UA 4OPZA 5F83A 2QMIA 3CJMA 4GB7A 2WGIA 4OPRA 1BLPA 2XLNA 5M18A 4BQMA 2ZM8A 1NJ4A 4DKIA 1LL9A 4R1GA 4X6TA 3V50A 1YLYA 4EWFA 1PI5A 2X71A 5HAIA 3EQVA 4QY5A 4ZBEA 2Y2KA 3BLSA 3Q7VA 1KGGA 1NRFA 3MKFA 3BRMA 4YINA 5EOOA 1QMFA 1PW8A 5A93A 4OVDA 3HUOA 3A3FA 4E3OA 1J9MA 5GLCA 2Y2MA 3UE3A 4BD0A 4N92A 4S2JA 1H5XA 2C6WB 3GTCA 2R9WA 4S2PA 1ERMA 3N8LA 4KZ7A 3ZNTA 3BFCA 3OPLA 4FD8A 2EXBA 2OLVA 4OH0A 3RXXA 2R9XA 3SH9A 1K57A 1JTDA 1MBLA 1I5QA 4B4ZA 5DVAA 2EFXA 4UA9A 4OP8A 3FKWA 3GQZA 3HLGA 2QPNA 1Q2PA 4PM8A 3HREA 4RA7A 1KDSA 2WZZA 5FA7A 2XK1A 1K55C 2H10A 2Z2LB 3IF5A 1XA7A 4UA6A 1Z6FA 3O86A 4UAAA 3NIAA 1BTLA 1MPLA 4JF6A 3VOYA 3OCLA 2FFFB 2OV5A 1TDGA 5L2FA 4NK3A 3M2JA 4X69A 4X68A 2HP9A 4JF5A 1GHMA 1K54A 5TGFA 3ZCZA 3NC8A 2WUQA 3TG9A 4OOMA 4D2OA 2P9VA 1FCMA 1KE3A 1WE4A 5EVIC 2X02A 4MBFA 4KENB 3NY4A 5FAPA 3HLDA 3IF6B 4P87A 5M1AA 4JBFA 5JYPA 3ITBA 2A3UA 5E43A 4KZ8A 1KVLA 3VOZA 5KSCA 3G31A 4N9KA 3ZG0A 3IWQA 2RCXA 4R0QA 3VFHA 2CC1A 1N4OA 1IEMA 3PBNA 5J8XA 4R3JA 1YMSA 4L0LA 1SHVA 3ZNYA 4WM9A 4DDSA 1SDNA 3MXRA 3PBTA 2XFSA 4BL3A 3DTMA 2EXAA 4OLGA 3LO7A 3A3DA 4JF4A 2XR0A 3UN7A 3PBRA 1E3UD 1W79A 1K4FA 4QJGA 2WKHA 4FSFA 1GA9A 3BECA 1MKIA 3IT9A 1RGZA 2Q9MA 3I7JA 1C3BA 5E2EA 5GHZA 4DDYA 1MWRA 4U3TA 2I72A 3GRJA 4N9LA 4FH2A 4QY6A 4WZ5C 3IHAA 4IVIA 3N6IA 3IH9A 4K91A 4S2IA 5CEBA 1H8ZA 5EVLA 4BENA 4F94A 3IWOA 4GD8A 4JXVA 5KSHA 1BLHA 1FOFA 3P98A 4RX3A 3N4IA 4LV3A 2Y55A 2Y2GA 4EBPA 3BFDA 2P74A 3W8KA 3QNCA 3FWLA 2GDNA 3HLCA 5CRFA 3UE1A 3VP1A 3LEZA 1FCNA 3ZVWA 2HDQA 3Q81A 1I2SA 3VFFA 2Y2IA 1K56D 1DJAA 1TDLA 3LY3A 4MEZA 3HBRA 4XUZA 2RL3A 2JE5A 1RP5A 2WAEA 3SOIA 5DF8A 1NZUA 3UO9A 1NY0A 1GHIA 3O3VA 3PBOA 4E3IA 2Y4AA 4S2NC 3S22A 3UNWA 2ZM2A 4GD6A 1W8YA 1NYMA 2J7VA 3FV7A 3VSKA 2XDMA 3VP4A 1FR6A 3PBQA 5HW3A 3G30A 4OQ0A 5GLAA 3NCKA 5EE8A 3IWIA 4S2OA 4OQIA 5HARA 4KG5A 5AQAA 5DTSA 3SS5A 3HLFA 3IXGA 4X56A 2EX9A 4OPYA 1KE0A 4N1HA 3ISGA 5FSRA 2E8IA 4OLDA 5KZHA 2ZQ7A 4CPKA 1ES3A 1HZOA 1ALQA 3PAGA 1LL5A 2X01A 1ONHA 2G2UA 4MLLA 3ZHHA 5FQJA 1K4EA 3OC2A 1DJBA 2Y2OA 5CGXA 2Q9NA 5F82A 1W5DA 4ZTKA 1ZC2A 4KZAA 2ZQ8A 3GMWA 4IBRA 2Y2HA 5CTMA 3MBZA 3ZG8B 3UPPA 5CEDA 1YLTA 3FKVA 2Y2PA 5BOHA 1L0DA 4S2KA 4KG2A 1JWPA 1BULA 5A91A 3IF6C 3PBSA 1YLWA 1LLBA 1L2SA 3HLWA 4JLFA 4KZ9A 1ZG4A 5EVID 1FSYA 1PZOA 1RGYA 5M19A 2EX2A 2XF3A 2H0YA 1BT5A 1K56A 1FQGA 3SS3A 4KQRA 1PWCA 4KZ5A 4C3QA 2XH9A 1DY6A 3O88A 2J9OA 4RVAA 2G2WA 3Q07A 2J8YA 1LHYA 3PAEA 1E4DA 3D4FA 4OQGA 1CK3A 1MWUA 4QU3A 3JYIA 4K0XA 1WYCA 4HEFA 3ZDJA 3HLBA 4EQIA 4Y0TA 5FI2A 3VP3A 3G32A 1O07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GHY A;  3G34 A;  4R4R A;  3CG5 A;  3TSG A;  3WRZ A;  4MBK A;  3MFD A;  2XD5 A;  1YMX A;  4S2M A;  4YFM A;  2WZX A;  1PW1 A;  1BLC A;  2EX6 A;  2QZ6 A;  4LCL A;  5CHM A;  1CI8 A;  5AQ9 A;  3Q7V B;  4Y0O A;  3BYD A;  4Q8I A;  1KE4 A;  3OPP A;  4HBU A;  2IWD A;  1IYO A;  5DTT A;  1N9B A;  3E2K A;  3OPR A;  2ZC5 B;  4E3L A;  4X55 A;  1BLS A;  2WAD A;  1RCJ A;  3QHY A;  1WYB A;  5GHX A;  4M3K A;  4QD4 A;  1YQS A;  2PBY A;  1K55 A;  4DRT A;  2Y2Q A;  3UDF A;  4GOG A;  2Y2L A;  2VGK A;  1GCE A;  2ZMA A;  4GN2 A;  5D3O A;  4DXC A;  1PIO A;  3BFE A;  2DRW A;  3CMZ A;  3MZE A;  5I94 A;  5TR7 A;  4WBG A;  5FAS A;  4WZ4 A;  3W4P A;  3Q1F A;  5HFO A;  5DF9 A;  1XX2 A;  3UPO A;  2ZD8 A;  4QHC A;  1PZP A;  3VP0 A;  5EVI A;  3V3R A;  4E3N A;  3AGE A;  1YLZ A;  4OQH A;  2ZQC A;  3DWZ A;  5AQ7 A;  3UY6 A;  3MXS A;  2WYX A;  3RXW A;  1BSG A;  1XP4 A;  5F1F A;  1FCO A;  1KDW A;  4MNR A;  4EBL A;  4B88 A;  4E3K A;  1Q2Q A;  3IXB A;  2XEP A;  5FQK A;  4U0T A;  4DE2 A;  5FAO A;  1MY8 A;  2ZQD A;  5U47 A;  3ZFZ A;  3G2Z A;  1XGI A;  2P9V B;  1HTZ A;  2V1Z A;  2WGW A;  5CGW A;  4JPM A;  3MZD A;  3BEB A;  5HX9 A;  2ZC7 A;  3BM6 A;  5CXW A;  4Z9Q A;  1YT4 A;  3HLE A;  1PWD A;  2Y2J A;  3IQA A;  3EQU A;  1CEF A;  3FYZ A;  5FAT A;  2JBF A;  4EBN A;  3VSL A;  1ESU A;  4PM5 A;  3VMA A;  1G6A A;  1AXB A;  4P0M A;  4WZ5 A;  3CZD A;  3UPN A;  4ZAM A;  5IHV A;  1O7E A;  4RYE A;  2A49 A;  3LY4 A;  1EWZ A;  1G68 A;  5HAP A;  4K0W A;  3O87 A;  1L0G A;  5JYO A;  3ZGA B;  2J9P A;  4WEJ A;  4P6B A;  2PU2 A;  1K6S A;  4MBH A;  3WRT A;  3BFF A;  2Y91 A;  2WK0 A;  5EUA A;  1JWZ A;  2OLU A;  1IYS A;  2VGJ A;  4XUX A;  3FZC A;  2ZC6 B;  2C5W B;  3WS2 A;  2JC7 A;  1HVB A;  5EEC A;  2EFU A;  3BLM A;  4RX2 A;  1JWV A;  1E3U A;  3P09 A;  4ZJ3 A;  2BLS A;  2XQZ A;  2Y2N A;  5GLD A;  1KGE A;  1ZG6 A;  3OZH A;  4JXS A;  4OOY A;  4S2N A;  2IWB A;  4WEK A;  1S6R A;  2IWC A;  3QNB A;  3WS1 A;  1Y54 A;  2V20 A;  2B5R A;  3HVF A;  4KZ4 A;  3WS0 A;  3UDI A;  2OSU A;  3GSG A;  2HPB A;  4JXW A;  2WGV A;  3N8R A;  5FAQ A;  4OKP A;  2XGN A;  1XGJ A;  3M6B A;  3G4P A;  3M2K A;  3VP2 A;  5CTN A;  4OPQ A;  1XKZ A;  3M6H A;  3ZG7 B;  5AQB A;  5G18 A;  3GV9 A;  4ID4 A;  4WMC D;  5FDH A;  3HUM A;  5CER A;  3V5M A;  4EV4 A;  1PI4 A;  1IYQ A;  3WS4 A;  2ZC3 B;  4UHU A;  1M6K A;  4KZ6 A;  5CHU A;  5FQQ A;  1K6R A;  4DF6 A;  4IVK A;  5CEC A;  1L0F A;  4BLM A;  1K57 C;  3TOI A;  3AGF A;  1CEG A;  3V3S A;  4B4X A;  3IH8 A;  4FH4 A;  1W7F A;  5FI6 A;  4KQO A;  1NXY A;  3W4O A;  1YLP A;  1IKI A;  2Y59 A;  5FQI A;  4X53 A;  1DJC A;  1SKF A;  3IF6 A;  5E2F A;  3HUN A;  4PPR A;  1W8Q A;  2HDR A;  3BFG A;  4OP5 A;  4R4S A;  3GVB A;  1KGF A;  1U60 A;  2WKE A;  4XXR A;  4OON A;  1FSW A;  3G2Y A;  3GR2 A;  5TFQ A;  3PTE A;  4PMA A;  1ERO A;  1IKG A;  1I2W A;  1LI0 A;  2PU4 A;  3MKE A;  4LV2 A;  4JXG A;  4EUZ A;  3B3X A;  4O7D A;  1K54 C;  3NI9 A;  4CJN A;  2ZC4 B;  4GKU A;  1H8Y A;  3IXH A;  3E2L A;  1ONG A;  3N8S A;  1PWG A;  3UDX A;  1PYY A;  5DF7 A;  4E3M A;  1KVM A;  4E6W A;  1ESI A;  3W4Q A;  2V2F F;  4WYY A;  1BZA A;  1ES5 A;  4ZDX A;  1ERQ A;  5E2G A;  1VQQ A;  4GZB A;  3C7V A;  4BD1 A;  4R3B A;  1VM1 A;  2EX8 A;  4KQQ A;  4C6Y A;  3V39 A;  2ZQA A;  1NZO A;  1LI9 A;  4GNU A;  2ZQ9 A;  2DNS A;  3RJU A;  3SS4 A;  4U0X A;  4WMC A;  1ES2 A;  4IED A;  3A3J A;  3LCE A;  4DE1 A;  4Y7P A;  3C5A A;  1TEM A;  2FFY A;  4DE0 A;  5A92 A;  2ZLY A;  1EI5 A;  4R23 A;  4QB8 A;  1ES4 A;  3Q7Z A;  3IHB A;  5CHJ A;  3OPH A;  4C75 A;  4DE3 A;  3ZVT A;  2H0T A;  1IYP A;  1JVJ A;  4E3J A;  3SH8 A;  4DXB A;  2HP6 A;  1K25 A;  5EOE A;  2ZJ9 A;  3HL9 A;  4H8R A;  1ZKJ A;  1IEL A;  5FQM A;  4ZJ1 A;  4KZB A;  3ITA A;  2H5S A;  3S1Y A;  3A3I A;  4GDN A;  4E6X A;  4PM6 A;  4KZ3 A;  2WKI A;  3N7W A;  5CGS A;  5F1G A;  3A3E A;  1JTG A;  4ZJ2 A;  5HAQ A;  1YLJ A;  2WAF A;  1CI9 A;  4FCF A;  1MWS A;  1NYY A;  1K38 A;  4BL2 A;  1HD8 A;  4IBX A;  3NDG A;  4P85 A;  5E2H A;  4BJP A;  3DW0 A;  3S4X A;  1GHP A;  4LV0 A;  4HES A;  5FI7 A;  2JCH A;  3ZG9 B;  1SDE A;  5HL1 A;  1E25 A;  5EVI B;  2BG1 A;  4Y0U A;  1S0W A;  2Z2M B;  1OME A;  3WS5 A;  3WWX A;  3C4O A;  3UE0 A;  1GA0 A;  5KMW A;  3OCN A;  5DTK A;  4JKT A;  5GLB A;  4WEL A;  1MXO A;  1M40 A;  3MZF A;  1MWT A;  4GDB A;  4NET A;  1XA1 A;  4A5R A;  1QME A;  4UA7 A;  3SH7 A;  3NDE A;  4HBT A;  2XFT A;  3G35 A;  2WGW B;  3DWK A;  1XPB A;  4LEN A;  2HDS A;  4OOL A;  4PM9 A;  5EPH A;  1FR1 A;  1SCW A;  4LCM A;  1L0E A;  2XD1 A;  3ZG5 A;  5GL9 A;  2UWX A;  3Q82 A;  3C4P A;  1TVF A;  5FQ9 A;  4KG6 A;  5A90 A;  2HDU A;  2HP5 A;  2ZM0 A;  4PM7 A;  3IXD A;  3AGD A;  1XXM A;  4S2L A;  1BUE A;  1YM1 A;  3NBL A;  4LV1 A;  4N1X A;  2DCF A;  3C7U A;  4OPZ A;  5F83 A;  2QMI A;  3CJM A;  4GB7 A;  2WGI A;  4OPR A;  1BLP A;  2XLN A;  5M18 A;  4BQM A;  2ZM8 A;  1NJ4 A;  4DKI A;  1LL9 A;  4R1G A;  4X6T A;  3V50 A;  1YLY A;  4EWF A;  1PI5 A;  2X71 A;  5HAI A;  3EQV A;  4QY5 A;  4ZBE A;  2Y2K A;  3BLS A;  3Q7V A;  1KGG A;  1NRF A;  3MKF A;  3BRM A;  4YIN A;  5EOO A;  1QMF A;  1PW8 A;  5A93 A;  4OVD A;  3HUO A;  3A3F A;  4E3O A;  1J9M A;  5GLC A;  2Y2M A;  3UE3 A;  4BD0 A;  4N92 A;  4S2J A;  1H5X A;  2C6W B;  3GTC A;  2R9W A;  4S2P A;  1ERM A;  3N8L A;  4KZ7 A;  3ZNT A;  3BFC A;  3OPL A;  4FD8 A;  2EXB A;  2OLV A;  4OH0 A;  3RXX A;  2R9X A;  3SH9 A;  1K57 A;  1JTD A;  1MBL A;  1I5Q A;  4B4Z A;  5DVA A;  2EFX A;  4UA9 A;  4OP8 A;  3FKW A;  3GQZ A;  3HLG A;  2QPN A;  1Q2P A;  4PM8 A;  3HRE A;  4RA7 A;  1KDS A;  2WZZ A;  5FA7 A;  2XK1 A;  1K55 C;  2H10 A;  2Z2L B;  3IF5 A;  1XA7 A;  4UA6 A;  1Z6F A;  3O86 A;  4UAA A;  3NIA A;  1BTL A;  1MPL A;  4JF6 A;  3VOY A;  3OCL A;  2FFF B;  2OV5 A;  1TDG A;  5L2F A;  4NK3 A;  3M2J A;  4X69 A;  4X68 A;  2HP9 A;  4JF5 A;  1GHM A;  1K54 A;  5TGF A;  3ZCZ A;  3NC8 A;  2WUQ A;  3TG9 A;  4OOM A;  4D2O A;  2P9V A;  1FCM A;  1KE3 A;  1WE4 A;  5EVI C;  2X02 A;  4MBF A;  4KEN B;  3NY4 A;  5FAP A;  3HLD A;  3IF6 B;  4P87 A;  5M1A A;  4JBF A;  5JYP A;  3ITB A;  2A3U A;  5E43 A;  4KZ8 A;  1KVL A;  3VOZ A;  5KSC A;  3G31 A;  4N9K A;  3ZG0 A;  3IWQ A;  2RCX A;  4R0Q A;  3VFH A;  2CC1 A;  1N4O A;  1IEM A;  3PBN A;  5J8X A;  4R3J A;  1YMS A;  4L0L A;  1SHV A;  3ZNY A;  4WM9 A;  4DDS A;  1SDN A;  3MXR A;  3PBT A;  2XFS A;  4BL3 A;  3DTM A;  2EXA A;  4OLG A;  3LO7 A;  3A3D A;  4JF4 A;  2XR0 A;  3UN7 A;  3PBR A;  1E3U D;  1W79 A;  1K4F A;  4QJG A;  2WKH A;  4FSF A;  1GA9 A;  3BEC A;  1MKI A;  3IT9 A;  1RGZ A;  2Q9M A;  3I7J A;  1C3B A;  5E2E A;  5GHZ A;  4DDY A;  1MWR A;  4U3T A;  2I72 A;  3GRJ A;  4N9L A;  4FH2 A;  4QY6 A;  4WZ5 C;  3IHA A;  4IVI A;  3N6I A;  3IH9 A;  4K91 A;  4S2I A;  5CEB A;  1H8Z A;  5EVL A;  4BEN A;  4F94 A;  3IWO A;  4GD8 A;  4JXV A;  5KSH A;  1BLH A;  1FOF A;  3P98 A;  4RX3 A;  3N4I A;  4LV3 A;  2Y55 A;  2Y2G A;  4EBP A;  3BFD A;  2P74 A;  3W8K A;  3QNC A;  3FWL A;  2GDN A;  3HLC A;  5CRF A;  3UE1 A;  3VP1 A;  3LEZ A;  1FCN A;  3ZVW A;  2HDQ A;  3Q81 A;  1I2S A;  3VFF A;  2Y2I A;  1K56 D;  1DJA A;  1TDL A;  3LY3 A;  4MEZ A;  3HBR A;  4XUZ A;  2RL3 A;  2JE5 A;  1RP5 A;  2WAE A;  3SOI A;  5DF8 A;  1NZU A;  3UO9 A;  1NY0 A;  1GHI A;  3O3V A;  3PBO A;  4E3I A;  2Y4A A;  4S2N C;  3S22 A;  3UNW A;  2ZM2 A;  4GD6 A;  1W8Y A;  1NYM A;  2J7V A;  3FV7 A;  3VSK A;  2XDM A;  3VP4 A;  1FR6 A;  3PBQ A;  5HW3 A;  3G30 A;  4OQ0 A;  5GLA A;  3NCK A;  5EE8 A;  3IWI A;  4S2O A;  4OQI A;  5HAR A;  4KG5 A;  5AQA A;  5DTS A;  3SS5 A;  3HLF A;  3IXG A;  4X56 A;  2EX9 A;  4OPY A;  1KE0 A;  4N1H A;  3ISG A;  5FSR A;  2E8I A;  4OLD A;  5KZH A;  2ZQ7 A;  4CPK A;  1ES3 A;  1HZO A;  1ALQ A;  3PAG A;  1LL5 A;  2X01 A;  1ONH A;  2G2U A;  4MLL A;  3ZHH A;  5FQJ A;  1K4E A;  3OC2 A;  1DJB A;  2Y2O A;  5CGX A;  2Q9N A;  5F82 A;  1W5D A;  4ZTK A;  1ZC2 A;  4KZA A;  2ZQ8 A;  3GMW A;  4IBR A;  2Y2H A;  5CTM A;  3MBZ A;  3ZG8 B;  3UPP A;  5CED A;  1YLT A;  3FKV A;  2Y2P A;  5BOH A;  1L0D A;  4S2K A;  4KG2 A;  1JWP A;  1BUL A;  5A91 A;  3IF6 C;  3PBS A;  1YLW A;  1LLB A;  1L2S A;  3HLW A;  4JLF A;  4KZ9 A;  1ZG4 A;  5EVI D;  1FSY A;  1PZO A;  1RGY A;  5M19 A;  2EX2 A;  2XF3 A;  2H0Y A;  1BT5 A;  1K56 A;  1FQG A;  3SS3 A;  4KQR A;  1PWC A;  4KZ5 A;  4C3Q A;  2XH9 A;  1DY6 A;  3O88 A;  2J9O A;  4RVA A;  2G2W A;  3Q07 A;  2J8Y A;  1LHY A;  3PAE A;  1E4D A;  3D4F A;  4OQG A;  1CK3 A;  1MWU A;  4QU3 A;  3JYI A;  4K0X A;  1WYC A;  4HEF A;  3ZDJ A;  3HLB A;  4EQI A;  4Y0T A;  5FI2 A;  3VP3 A;  3G32 A;  1O07 A; 
#chains in the Genus database with same CATH topology
 3G34 A;  3SZT A;  3A0R A;  3T4J A;  5CHM A;  3C8C A;  1CI8 A;  5AQ9 A;  3BYD A;  4G3W A;  3OPP A;  3IS2 B;  1N9B A;  3E2K A;  4E3L A;  2MJ6 A;  5FL3 A;  1WYB A;  5GHX A;  4M3K A;  1K55 A;  2Y2Q A;  2V1B A;  2VGK A;  5D3O A;  1PIO A;  2DRW A;  5I94 A;  1XX2 A;  4GS9 A;  4E3N A;  5HSQ A;  2ZQC A;  3DWZ A;  4PKY A;  2WYX A;  3RXW A;  4MNR A;  4EBL A;  4U0T A;  4DE2 A;  1MY8 A;  3ZFZ A;  2M7U A;  1XGI A;  4KUK A;  3BEB A;  5CXW A;  3HLE A;  3NHQ A;  2V9A A;  2EWV A;  4EXO A;  2PR5 A;  4WZ5 A;  3LY4 A;  3OBF A;  1EWZ A;  5HAP A;  4K0W A;  1L0G A;  4WEJ A;  2PAV P;  2PU2 A;  4MBH A;  4DJ2 A;  3WRT A;  1SKO A;  2Y91 A;  2ZBB A;  1JWZ A;  2VGJ A;  1IYS A;  2WKP A;  2C5W B;  3PYP A;  1HVB A;  3BLM A;  4ZJ3 A;  2Y2N A;  1KGE A;  5EVE A;  1ZG6 A;  4NXE A;  2BTF P;  4JXS A;  1S6R A;  3QNB A;  2B5R A;  3DTK A;  4JXW A;  4OKP A;  3M6B A;  1XKZ A;  3JPU A;  4EV4 A;  5CHU A;  4DF6 A;  1K6R A;  1L0F A;  4BLM A;  3TOI A;  1CEG A;  2ZMF A;  4EU0 A;  4R6L A;  5EM0 A;  2Y59 A;  2PYR A;  3C2W A;  3ULF A;  3ZYT A;  4X53 A;  1SKF A;  4Y17 A;  4X1L A;  4OP5 A;  3GVB A;  2WKE A;  4DMZ A;  1I2W A;  4HQA A;  2W3D A;  3B3X A;  3NI9 A;  3E2L A;  1ONG A;  1PYY A;  4E6W A;  1ESI A;  5HWT A;  2VZW A;  1ES5 A;  4GZB A;  1VQQ A;  3DTI A;  4GCZ A;  1VM1 A;  2EX8 A;  3IX3 A;  3V39 A;  2ZQ9 A;  1ES2 A;  2LB5 A;  5TBM A;  4Y7P A;  1TEM A;  2PRF A;  4DE0 A;  3BQ8 A;  1EI5 A;  1OTE A;  4R23 A;  3Q7Z A;  3NEC A;  1LL8 A;  2JKT M;  2KDK A;  1IYP A;  2D01 A;  4DXB A;  5C5K A;  4DN0 A;  2ZJ9 A;  4H8R A;  4ZJ1 A;  4KZB A;  3A3I A;  4E6X A;  2B18 A;  3EGD C;  5CGS A;  4ME4 A;  3A3E A;  3VOL A;  1JTG A;  2HJE A;  5HAQ A;  4BL2 A;  3NDG A;  4P85 A;  4BBT A;  4BJP A;  5IS1 A;  1GHP A;  4LV0 A;  2W0N A;  4HES A;  5FI7 A;  4YWZ A;  2JCH A;  3ZG9 B;  5EVI B;  3HJK A;  2BG1 A;  1OME A;  3MQO A;  2VLG A;  3WWX A;  5F69 A;  1GA0 A;  5KIZ A;  4JKT A;  1QME A;  3MMH A;  1PRQ A;  4UA7 A;  2WGW B;  4PM9 A;  1XPB A;  2HDS A;  5GL9 A;  3C4P A;  2Y79 A;  5FQ9 A;  4IUK A;  2HP5 A;  4ARZ A;  3RTY A;  1TS6 A;  3NBL A;  4LV1 A;  4OPZ A;  4OPR A;  2WGI A;  3PR6 A;  3CHW P;  3MQ0 A;  4ZRR A;  1PFL A;  4GHI B;  3V50 A;  1YLY A;  3BLS A;  1NRF A;  4GW9 A;  5FDS A;  5EOO A;  1P0Z A;  5FEG A;  5A93 A;  3W2Z A;  4BD0 A;  3UE3 A;  4NG2 A;  1UWN X;  3T4L A;  1V9Z A;  4S2P A;  4FD8 A;  1D1J A;  2R9X A;  4CLC B;  2Z6C A;  4OP8 A;  3FKW A;  4PM8 A;  3CI6 A;  1D7E A;  1PNE A;  3LID A;  5FA7 A;  3IF5 A;  1XA7 A;  1NLZ A;  3O86 A;  3NIA A;  4NXG A;  3VOY A;  1TDG A;  4NK3 A;  4G3K A;  1K54 A;  3ZCZ A;  4BBV A;  5EVI C;  4KEN B;  4JBF A;  3ITB A;  4PAU A;  4KZ8 A;  1KVL A;  2VV6 A;  5KSC A;  2J3W A;  2RCX A;  3VFH A;  2CC1 A;  2K31 A;  1IEM A;  3ZNY A;  1Y4O A;  1YMS A;  4WM9 A;  1SDN A;  2EXA A;  4BWI A;  2W27 A;  3UN7 A;  5I5L A;  1K4F A;  5MC7 A;  2WKH A;  3JVV A;  4FSF A;  4DDY A;  2PD8 A;  1MWR A;  3E0Y A;  3IHA A;  4IVI A;  2JKR M;  3IH9 A;  4CLC D;  3T1X A;  1FOF A;  4RX3 A;  4EBP A;  1YKD A;  3QNC A;  5L07 A;  2XRO A;  5CRF A;  4WUJ A;  3UE1 A;  2CMN A;  1I2S A;  1UWP X;  2VV8 A;  4HY8 A;  4MEZ A;  1CJF A;  5J7E A;  4YNR A;  1RP5 A;  1T1C A;  3UO9 A;  3S22 A;  2ZM2 A;  1FR6 A;  3G30 A;  4CLC C;  5HAR A;  4OQI A;  4MN5 A;  4NXB A;  4OPY A;  3ISG A;  4OLD A;  1TS8 A;  1ES3 A;  2X01 A;  1ALQ A;  1ONH A;  2O99 A;  1K4E A;  4I3J A;  5CGX A;  3S7P A;  4KZA A;  4IBR A;  1F5M A;  3ZG8 B;  1VET A;  1YLT A;  3B33 A;  2Y2P A;  1BUL A;  4R3A A;  4B93 A;  4KZ9 A;  3HLW A;  2V8F A;  5G4Y A;  2J9O A;  3Q07 A;  4I39 A;  4OQG A;  3IX8 A;  3UB7 A;  1GSW A;  1DP6 A;  2A2L A;  1FIL A;  3P7N A;  4S2M A;  1PW1 A;  1G6O A;  2EX6 A;  4HBU A;  3F1O B;  3QHY A;  1OT9 A;  4QD4 A;  2PBY A;  4DRT A;  1OJG A;  3ICY A;  4GOG A;  3ZQ5 A;  2ZMA A;  4DXC A;  1S4S A;  3MZE A;  3CMZ A;  2ACG A;  5TR7 A;  3UB6 A;  3W4P A;  2QJ5 A;  5DF9 A;  4D60 A;  3UPO A;  2ZD8 A;  4QHC A;  1T1A A;  3V3R A;  2VEA A;  4Y5F A;  3AGE A;  5IU1 A;  1BSG A;  4GLQ A;  1FCO A;  1KDW A;  4E3K A;  5FQK A;  5FAO A;  4LLO B;  5L09 A;  1HTZ A;  3MQQ A;  5HX9 A;  2ZC7 A;  4Z9Q A;  3TW8 A;  3IQA A;  3EQU A;  4ETZ A;  3OLO A;  4NKP A;  3V67 A;  4P0M A;  4L9F A;  3UB5 P;  1AWI A;  4ZAM A;  5IHV A;  1O7E A;  1A0K A;  3T1R A;  5DKL A;  3BFF A;  2WK0 A;  5EUA A;  1TF1 A;  3FZC A;  3DAV A;  3WS2 A;  4QWO A;  5EEC A;  2EFU A;  3D9Y A;  1E3U A;  2XQZ A;  3QP8 A;  1X0O A;  4WEK A;  4KZ4 A;  3UDI A;  2OSU A;  2HPB A;  2WGV A;  3N8R A;  2OWJ A;  1XGJ A;  3VP2 A;  3ZG7 B;  4H6J A;  4HNB A;  5G18 A;  1PI4 A;  3IBJ A;  2ZC3 B;  1M6K A;  3E4P A;  5DFY A;  2V0U A;  1W7F A;  4KQO A;  5FQI A;  3U2A A;  5L8M A;  5E2F A;  1NLY A;  1W8Q A;  2HDR A;  4R4S A;  2OOL A;  1U60 A;  3C38 A;  1FSW A;  3GR2 A;  1ERO A;  1WA9 A;  1N9O A;  4JXG A;  3A0S A;  1H8Y A;  1F9I A;  3N8S A;  3JVU A;  1PWG A;  5DF7 A;  4E3M A;  1TS7 A;  3W4Q A;  3IBR A;  2V2F F;  4BMW A;  4L9G A;  1MKM A;  2V1A A;  4BD1 A;  2DMW A;  2FH5 A;  1D06 A;  2HZ5 A;  2W3G A;  1LI9 A;  4HIA A;  2QKP A;  3LCE A;  4DE1 A;  3C5A A;  5A92 A;  1DRM A;  2O9C A;  3F1N A;  3IHB A;  3OPH A;  4DE3 A;  1W63 Q;  4WN5 A;  4E3J A;  3SH8 A;  1ZKJ A;  1IEL A;  3S1Y A;  4GDN A;  4PM6 A;  2ZL1 B;  2VK3 A;  4ZJ2 A;  1YLJ A;  1S66 L;  4Y2F A;  2W1R A;  3S7Q A;  5E2H A;  3KYE A;  3LIC A;  3K2N A;  5IT5 A;  1SDE A;  5EV0 A;  3K3D A;  3LIB A;  4MN6 A;  4LPZ A;  3MS6 A;  3L7H A;  3R7W A;  1MXO A;  1M40 A;  4NET A;  1XA1 A;  3KYZ A;  4A5R A;  4HOI A;  3NDE A;  3NJA A;  4HBT A;  2XFT A;  3DWK A;  4LEN A;  1XJ6 A;  2J3T D;  1SCW A;  4LCM A;  3ZG5 A;  3Q82 A;  5A90 A;  1STZ A;  3AGD A;  4JGQ A;  4MCW A;  4EER A;  3B47 A;  4XT2 B;  2FZ0 A;  4N1X A;  5F83 A;  3TRC A;  1VEU B;  3LEQ A;  5G4Z A;  1F98 A;  1LL9 A;  4R1G A;  4X6T A;  1MZU A;  4QY5 A;  2Y2K A;  1KGG A;  2WKR A;  3MKF A;  2J3T C;  4E04 A;  3BRM A;  3VP3 A;  3IS2 A;  3A3F A;  5GLC A;  4PHT A;  4N92 A;  4S2J A;  2R9W A;  1XJ3 A;  5HDD A;  1JTD A;  2EFX A;  4Y13 A;  1Q2P A;  3NUL A;  3HRE A;  1T1B A;  4F3L B;  2XK1 A;  4LGW A;  4UAA A;  4JF6 A;  4ETX A;  3EOI A;  3M2J A;  4JF5 A;  4WF0 A;  4O8G A;  5TGF A;  3TG9 A;  4D2O A;  1FCM A;  1KE3 A;  1N9L A;  4MMN A;  3NY4 A;  3IF6 B;  5E43 A;  1XJ4 A;  3G31 A;  3IWQ A;  2AVX A;  4R0Q A;  3PBN A;  1K0K A;  5J3W A;  4BL3 A;  4Q0I A;  3DTM A;  2QYB A;  3LO7 A;  4OLG A;  4MDZ A;  4QJG A;  2Y8H A;  3LI9 A;  1RGZ A;  1C3B A;  5E2E A;  5GHZ A;  4U3T A;  4X1M A;  2I72 A;  4N9L A;  4EBN A;  4FH2 A;  4JGP A;  3IWO A;  4GD8 A;  3K3C A;  1SZV A;  2LB9 A;  3N4I A;  1ZTU A;  2Y2G A;  3W8K A;  3FWL A;  2GDN A;  3ZVW A;  1FIK A;  2Y2I A;  1DJA A;  2P7J A;  1TDL A;  3LY3 A;  4XUZ A;  2RL3 A;  4R38 A;  2JE5 A;  1NZU A;  1NY0 A;  2HJ9 C;  1GHI A;  3O3V A;  3T1S A;  3C30 A;  4S2N C;  3KSF A;  3CUE C;  1W8Y A;  2XDM A;  3VP4 A;  5DFX A;  4KG5 A;  1OJ5 A;  5DTS A;  3IXG A;  3D72 A;  4N1H A;  2E8I A;  3EWK A;  5KZH A;  3QP4 A;  2OWH A;  3ZHH A;  5HDC A;  1DJB A;  4EW7 A;  1ZC2 A;  1MC0 A;  2Y2H A;  4Q0J A;  5CTM A;  1L0D A;  2L4R A;  4S2K A;  4KG2 A;  3IF6 C;  3PBS A;  1L2S A;  5EVI D;  2PBD P;  1PZO A;  5M19 A;  3TE8 A;  1BT5 A;  3E4O A;  1FQG A;  1PWC A;  4C3Q A;  3O88 A;  1DY6 A;  1YSQ A;  3LR3 A;  1CK3 A;  4Y0T A;  3HLB A;  4I3I A;  5HWV A;  4R4R A;  2XD5 A;  1YMX A;  4YFM A;  1BLC A;  2QZ6 A;  4LCL A;  2VA0 A;  3Q7V B;  4Y0O A;  4Q8I A;  2IWD A;  1IYO A;  2ZC5 B;  4X55 A;  4EQ1 A;  4GN2 A;  3BFE A;  3R4K A;  5HFO A;  1PZP A;  5EVI A;  2Q0O A;  4OQH A;  1XFN A;  5F1F A;  1XP4 A;  5EFW A;  4B88 A;  1Q2Q A;  5U47 A;  3G2Z A;  3MJQ A;  3LIA A;  2P9V B;  2WGW A;  3E98 A;  5CGW A;  3FC7 A;  3MZD A;  1YT4 A;  4NXF A;  2Y2J A;  5HDS A;  5DJU A;  3KO6 A;  3FYZ A;  5FAT A;  2JBF A;  2W1T B;  3VMA A;  2M7V A;  3UPN A;  4CQH A;  3O5Y A;  1G68 A;  4GHI A;  4EEP A;  2J9P A;  2WKQ A;  4P6B A;  2OLU A;  2A24 B;  3MR0 A;  2HF6 A;  4RX2 A;  1JWV A;  3P09 A;  5GLD A;  2HGV A;  4I5S A;  2H28 A;  4OOY A;  2IWB A;  4DJ3 A;  3WS1 A;  1Y54 A;  3HVF A;  3GSG A;  5FAQ A;  4CLC A;  2XGN A;  3HJI A;  3G4P A;  4EUV A;  1OTB A;  4OPQ A;  4HP9 A;  3H7W B;  5AQB A;  4MN7 A;  4EES A;  4AFI A;  4WMC D;  4LRY C;  3V5M A;  2OAP 1;  3H82 B;  1S4R A;  4UHU A;  4KZ6 A;  3LR5 A;  1K57 C;  3CIT A;  3QP5 A;  5HL6 A;  3CPT B;  5FI6 A;  1NXY A;  1IKI A;  1DJC A;  3BFG A;  3VE3 A;  4X25 A;  4XXR A;  2PYP A;  3BQA A;  4FUW A;  1IKG A;  2PU4 A;  4LV2 A;  4HH2 A;  4EUZ A;  4B9O A;  3T4K A;  2ZC4 B;  2O9B A;  4GKU A;  3IXH A;  1W63 M;  3UME A;  2P08 A;  3A0V A;  4WYY A;  1BZA A;  2QWS A;  1ERQ A;  5E2G A;  1J3W A;  3C7V A;  1Z09 A;  3F1P B;  3B42 A;  2JKF A;  4R3B A;  4C6Y A;  2ZQA A;  2PDR A;  4GNU A;  2DNS A;  3RJU A;  4WMC A;  2FFY A;  2ZLY A;  1DP8 A;  3QP1 A;  5CHJ A;  3QP2 A;  4C75 A;  4YOF A;  3NOP C;  1JVJ A;  2G7U A;  5EOE A;  2VKS A;  5FQM A;  1XFQ A;  4KZ3 A;  2WKI A;  3N7W A;  5F1G A;  5HPI A;  4IJG A;  1CI9 A;  3T1Q B;  1MWS A;  1HD8 A;  4IBX A;  2K7S A;  3BY8 A;  3FPW A;  4GS9 B;  5HL1 A;  1S0W A;  2NUP C;  3UE0 A;  3KX0 X;  5KMW A;  3OCN A;  5GLB A;  4WEL A;  3MZF A;  1MWT A;  2XA7 S;  2XD1 A;  2UWX A;  2KLI A;  4KG6 A;  2HDU A;  4PM7 A;  3IXD A;  1XXM A;  1BUE A;  1YM1 A;  1GSV A;  2DCF A;  1LSW A;  4I38 A;  4GB7 A;  5M18 A;  4DKI A;  4EWF A;  3EQV A;  4ZBE A;  4UQI S;  1SKO B;  2JKG A;  3F1O A;  1PW8 A;  3HUO A;  2VV7 A;  4E3O A;  1J9M A;  1H5X A;  3BY9 A;  1XJ2 A;  4P6Z S;  4KZ7 A;  3ZNT A;  3OPL A;  1P9R A;  3RH8 B;  1T19 A;  1I5Q A;  4B4Z A;  5DVA A;  4UA9 A;  3NOU C;  2KOI A;  4O0P A;  2QPN A;  1IOU A;  4I3A A;  1VB6 A;  2HV1 A;  4Z1W A;  1ACF A;  1K55 C;  1Z6F A;  2GJ3 A;  1LSV A;  3OCL A;  2FFF B;  2I9V A;  5L10 A;  4CLC E;  4X69 A;  4X68 A;  2EA9 A;  1GHM A;  3P01 A;  5EM1 A;  2WUQ A;  4OOM A;  3GEC A;  2XA7 M;  2X02 A;  4MBF A;  5FAP A;  3HLD A;  5M1A A;  3LR0 A;  2A3U A;  4JGO A;  4IHQ A;  4N9K A;  2YKF A;  3ZG0 A;  5DJT A;  1N4O A;  4ESP A;  5J8X A;  2NUT C;  4R3J A;  4L0L A;  1SHV A;  3EGX C;  3OOV A;  4DDS A;  3MXR A;  5LBR A;  3UB8 A;  3A3D A;  4JF4 A;  1YPR A;  4UQI M;  1W79 A;  1GA9 A;  3BEC A;  2R78 A;  3IT9 A;  4HJ3 A;  3LIF A;  4WZ5 C;  4QY6 A;  3N6I A;  5CEB A;  1H8Z A;  3RFB A;  4BEN A;  4F94 A;  5TBM B;  4LV3 A;  4P6Z M;  2Y55 A;  1CQA A;  3MF0 A;  4RQ9 A;  1JNU A;  3BFD A;  3EEH A;  3HLC A;  3VP1 A;  1FCN A;  4G3V A;  3Q81 A;  1K56 D;  1T18 A;  2GX5 A;  5K5B A;  3LIE A;  2WAE A;  1P97 A;  5DF8 A;  4E3I A;  3PBO A;  2JKR I;  2OAQ 1;  2Y4A A;  4GD6 A;  3L9K A;  3FV7 A;  3CWF A;  5HW3 A;  5FEF A;  5GLA A;  3NCK A;  3IWI A;  4S2O A;  5AQA A;  3E4Q A;  3HLF A;  3VE4 A;  4X56 A;  5FSR A;  1KE0 A;  2M1C A;  3MSH A;  2QJ7 A;  1HZO A;  1LL5 A;  3KSH A;  3H9W A;  4WLA A;  5FQJ A;  5F82 A;  2W3E A;  2ZQ8 A;  3GMW A;  3MBZ A;  5CED A;  5BOH A;  3D3O A;  2VJW A;  1LLB A;  4JLF A;  2D02 A;  1RGY A;  3FPV A;  1OTI A;  2EX2 A;  3LGO A;  2H0Y A;  4ARZ B;  1K56 A;  3SS3 A;  3KSG A;  4RVA A;  2G2W A;  2J8Y A;  1LHY A;  3PAE A;  1E4D A;  3D4F A;  1MWU A;  3JYI A;  4K0X A;  1WYC A;  4Y15 A;  4HEF A;  3ZDJ A;  4EQI A;  1DP9 A;  5GHY A;  3WRZ A;  3CG5 A;  3TSG A;  4MBK A;  3MFD A;  3DTE A;  5J4E A;  1VHM A;  2WZX A;  5AVE A;  3NOT C;  1KE4 A;  1GSX A;  2QHK A;  5DTT A;  3OPR A;  1NRJ A;  1BLS A;  2WAD A;  1RCJ A;  2ZL1 A;  1YQS A;  4LFU A;  2P04 A;  3TJZ C;  2J80 A;  3UDF A;  2Y2L A;  1GCE A;  1G28 A;  1H3Q A;  4WBG A;  5FAS A;  4WZ4 A;  3Q1F A;  3VP0 A;  4HJ6 A;  1YLZ A;  2L0W A;  5AQ7 A;  3UY6 A;  2IA2 A;  3MXS A;  4WL9 A;  3IXB A;  2XEP A;  2JN7 A;  3VV4 A;  4EEU A;  2ZQD A;  4BBU A;  3S7O A;  3EEA A;  2V1Z A;  4JPM A;  3BM6 A;  2Z6D A;  1PWD A;  1YSP A;  1P9W A;  1CEF A;  3S7N A;  3VSL A;  1ESU A;  4PM5 A;  1G6A A;  1AXB A;  5F68 A;  3CZD A;  3G6O A;  4XT2 A;  5TJJ A;  4RYE A;  2A49 A;  1VEU A;  4UEY A;  1LT0 A;  3O87 A;  5JYO A;  3ZGA B;  3T4T A;  3GDI A;  1K6S A;  1TD5 A;  3SW1 A;  1IFQ A;  4XUX A;  4FTX A;  2ZC6 B;  4Q0H A;  3UMD A;  2JC7 A;  2BLS A;  2B95 A;  4L9E A;  4HP4 A;  3OZH A;  4S2N A;  3CUE A;  2IWC A;  2V20 A;  3WS0 A;  4HI4 A;  4II7 A;  3M2K A;  3MXQ A;  5CTN A;  3M6H A;  1ODV A;  4F3L A;  2O0Y A;  3GV9 A;  4ID4 A;  5FDH A;  2YKH A;  3HUM A;  5CER A;  1L3L A;  1IYQ A;  3WS4 A;  5FQQ A;  4IVK A;  5CEC A;  3LUQ A;  3AGF A;  4HJ4 A;  3V3S A;  1LSX A;  4KUO A;  1N9N A;  4B4X A;  3IH8 A;  4FH4 A;  3W4O A;  1YLP A;  1Y28 A;  5DKK A;  3IF6 A;  3HUN A;  4PPR A;  3PHY A;  1KGF A;  4M4X A;  5HD3 A;  1S67 L;  4OON A;  3G2Y A;  5TFQ A;  3PTE A;  4PMA A;  1LI0 A;  3MKE A;  4O7D A;  4HHD A;  1K54 C;  4CJN A;  1VET B;  3U4L P;  3UDX A;  1KVM A;  4ZDX A;  4KQQ A;  2PR6 A;  1NZO A;  3SS4 A;  2INW A;  4U0X A;  4IED A;  3A3J A;  3KYQ A;  2BAS A;  4QB8 A;  1ES4 A;  2L1M A;  4Y3I A;  3ZVT A;  2H0T A;  2XSS A;  3CAX A;  2HP6 A;  1K25 A;  3HL9 A;  1YAX A;  5CX7 A;  1OTA A;  2H5S A;  3ITA A;  3FG8 A;  2WAF A;  4FCF A;  1NYY A;  1K38 A;  2VGL S;  1HLU P;  1EW0 A;  3DW0 A;  3S4X A;  5HWW A;  2W3H A;  3LYX A;  1E25 A;  4Y0U A;  2Z2M B;  3WS5 A;  3C4O A;  1ZHH B;  2PD7 A;  1F2K A;  5DTK A;  4LRZ E;  4GDB A;  5AJG A;  3SH7 A;  3CLO A;  3G35 A;  5EPH A;  4OOL A;  1UGU A;  1FR1 A;  2UV0 E;  1L0E A;  5HD5 A;  5HZH A;  1TVF A;  3T4S A;  2ZM0 A;  1H0M A;  3T4Q A;  4S2L A;  4KQD A;  3C7U A;  2EWW A;  2QMI A;  3CJM A;  1BLP A;  2XLN A;  3T12 B;  4BQM A;  2ZM8 A;  1NJ4 A;  2V8C A;  1PI5 A;  3T50 A;  2X71 A;  5HAI A;  4HH3 A;  3Q7V A;  3IX4 A;  2ZOH A;  4YIN A;  1QMF A;  4OVD A;  2B02 A;  2JHE A;  2Y2M A;  2C6W B;  3GTC A;  2K2N A;  1ERM A;  3N8L A;  2VGL M;  3BFC A;  1OPX A;  2EXB A;  2OLV A;  4OH0 A;  3RXX A;  3SH9 A;  5AVF A;  1K57 A;  1MBL A;  3HLG A;  3GQZ A;  4H6J B;  4RA7 A;  1V9Y A;  1KDS A;  2WZZ A;  2Z2L B;  2H10 A;  4UA6 A;  1BTL A;  1MPL A;  2VX8 A;  2OV5 A;  3LFV A;  5L2F A;  3BJN A;  2HP9 A;  4FOF A;  4O01 A;  2XRN A;  3NC8 A;  4EET B;  2P9V A;  1WE4 A;  1OTD A;  4P87 A;  1KOU A;  1S1Z A;  5JYP A;  3UB9 A;  1BYW A;  1OT6 A;  2W3F A;  3VOZ A;  2W1T A;  3HCY A;  2KX6 A;  1G5U A;  5F6A A;  3PBT A;  2XFS A;  3T4O A;  2XR0 A;  4JGR A;  3PBR A;  4LRX C;  1E3U D;  3DBA A;  1MKI A;  2Q9M A;  3I7J A;  4NEE D;  2A24 A;  3GRJ A;  3UE6 A;  4S2I A;  4K91 A;  2JKT I;  5EVL A;  2O9A A;  4JXV A;  5KSH A;  1BLH A;  3P98 A;  3QP6 A;  4PKY G;  1H8M A;  4QPR A;  2P74 A;  3F1N B;  5F5Y A;  3LEZ A;  2HDQ A;  3VFF A;  3HBR A;  3H7W A;  2GZA A;  5HPF A;  3SOI A;  3H82 A;  3UNW A;  2PHY A;  2J7V A;  1NYM A;  3BW6 A;  3VSK A;  3PBQ A;  1NWZ A;  4OQ0 A;  5EE8 A;  2ZOI A;  3BWL A;  3CPT A;  3SS5 A;  2EX9 A;  2ZQ7 A;  4CPK A;  3LI8 A;  5A8B A;  4IUH A;  3KSI A;  3PAG A;  2G2U A;  4MLL A;  3OC2 A;  2PT7 A;  2Y2O A;  2Q9N A;  4GJ4 A;  4R70 A;  1W5D A;  4ZTK A;  3R7W B;  3MFX A;  3UPP A;  3FKV A;  1JWP A;  5A91 A;  1YLW A;  1ZG4 A;  3LR4 A;  2GNX A;  3PXP A;  1FSY A;  2XF3 A;  3F1P A;  1S1Y A;  4KQR A;  4KZ5 A;  4K08 A;  2XH9 A;  1TS0 A;  2V0W A;  4QU3 A;  2ZMV A;  2E8J A;  5FI2 A;  1CF0 A;  3G32 A;  1O07 A; 
#chains in the Genus database with same CATH homology
 5GHY A;  3G34 A;  4R4R A;  3CG5 A;  3TSG A;  3WRZ A;  4MBK A;  3MFD A;  2XD5 A;  1YMX A;  4S2M A;  4YFM A;  2WZX A;  1PW1 A;  1BLC A;  2EX6 A;  2QZ6 A;  4LCL A;  5CHM A;  1CI8 A;  5AQ9 A;  3Q7V B;  4Y0O A;  3BYD A;  4Q8I A;  1KE4 A;  3OPP A;  4HBU A;  2IWD A;  1IYO A;  5DTT A;  1N9B A;  3E2K A;  3OPR A;  2ZC5 B;  4E3L A;  4X55 A;  1BLS A;  2WAD A;  1RCJ A;  3QHY A;  1WYB A;  5GHX A;  4M3K A;  4QD4 A;  1YQS A;  2PBY A;  1K55 A;  4DRT A;  2Y2Q A;  3UDF A;  4GOG A;  2Y2L A;  2VGK A;  1GCE A;  2ZMA A;  4GN2 A;  5D3O A;  4DXC A;  1PIO A;  3BFE A;  2DRW A;  3CMZ A;  3MZE A;  5I94 A;  5TR7 A;  4WBG A;  5FAS A;  4WZ4 A;  3W4P A;  3Q1F A;  5HFO A;  5DF9 A;  1XX2 A;  3UPO A;  2ZD8 A;  4QHC A;  1PZP A;  3VP0 A;  5EVI A;  3V3R A;  4E3N A;  3AGE A;  1YLZ A;  4OQH A;  2ZQC A;  3DWZ A;  5AQ7 A;  3UY6 A;  3MXS A;  2WYX A;  3RXW A;  1BSG A;  1XP4 A;  5F1F A;  1FCO A;  1KDW A;  4MNR A;  4EBL A;  4B88 A;  4E3K A;  1Q2Q A;  3IXB A;  2XEP A;  5FQK A;  4U0T A;  4DE2 A;  5FAO A;  1MY8 A;  2ZQD A;  5U47 A;  3ZFZ A;  3G2Z A;  1XGI A;  2P9V B;  1HTZ A;  2V1Z A;  2WGW A;  5CGW A;  4JPM A;  3MZD A;  3BEB A;  5HX9 A;  2ZC7 A;  3BM6 A;  5CXW A;  4Z9Q A;  1YT4 A;  3HLE A;  1PWD A;  2Y2J A;  3IQA A;  3EQU A;  1CEF A;  3FYZ A;  5FAT A;  2JBF A;  4EBN A;  3VSL A;  1ESU A;  4PM5 A;  3VMA A;  1G6A A;  1AXB A;  4P0M A;  4WZ5 A;  3CZD A;  3UPN A;  4ZAM A;  5IHV A;  1O7E A;  4RYE A;  2A49 A;  3LY4 A;  1EWZ A;  1G68 A;  5HAP A;  4K0W A;  3O87 A;  1L0G A;  5JYO A;  3ZGA B;  2J9P A;  4WEJ A;  4P6B A;  2PU2 A;  1K6S A;  4MBH A;  3WRT A;  3BFF A;  2Y91 A;  2WK0 A;  5EUA A;  1JWZ A;  2OLU A;  1IYS A;  2VGJ A;  4XUX A;  3FZC A;  2ZC6 B;  2C5W B;  3WS2 A;  2JC7 A;  1HVB A;  5EEC A;  2EFU A;  3BLM A;  4RX2 A;  1JWV A;  1E3U A;  3P09 A;  4ZJ3 A;  2BLS A;  2XQZ A;  2Y2N A;  5GLD A;  1KGE A;  1ZG6 A;  3OZH A;  4JXS A;  4OOY A;  4S2N A;  2IWB A;  4WEK A;  1S6R A;  2IWC A;  3QNB A;  3WS1 A;  1Y54 A;  2V20 A;  2B5R A;  3HVF A;  4KZ4 A;  3WS0 A;  3UDI A;  2OSU A;  3GSG A;  2HPB A;  4JXW A;  2WGV A;  3N8R A;  5FAQ A;  4OKP A;  2XGN A;  1XGJ A;  3M6B A;  3G4P A;  3M2K A;  3VP2 A;  5CTN A;  4OPQ A;  1XKZ A;  3M6H A;  3ZG7 B;  5AQB A;  5G18 A;  3GV9 A;  4ID4 A;  4WMC D;  5FDH A;  3HUM A;  5CER A;  3V5M A;  4EV4 A;  1PI4 A;  1IYQ A;  3WS4 A;  2ZC3 B;  4UHU A;  1M6K A;  4KZ6 A;  5CHU A;  5FQQ A;  1K6R A;  4DF6 A;  4IVK A;  5CEC A;  1L0F A;  4BLM A;  1K57 C;  3TOI A;  3AGF A;  1CEG A;  3V3S A;  4B4X A;  3IH8 A;  4FH4 A;  1W7F A;  5FI6 A;  4KQO A;  1NXY A;  3W4O A;  1YLP A;  1IKI A;  2Y59 A;  5FQI A;  4X53 A;  1DJC A;  1SKF A;  3IF6 A;  5E2F A;  3HUN A;  4PPR A;  1W8Q A;  2HDR A;  3BFG A;  4OP5 A;  4R4S A;  3GVB A;  1KGF A;  1U60 A;  2WKE A;  4XXR A;  4OON A;  1FSW A;  3G2Y A;  3GR2 A;  5TFQ A;  3PTE A;  4PMA A;  1ERO A;  1IKG A;  1I2W A;  1LI0 A;  2PU4 A;  3MKE A;  4LV2 A;  4JXG A;  4EUZ A;  3B3X A;  4O7D A;  1K54 C;  3NI9 A;  4CJN A;  2ZC4 B;  4GKU A;  1H8Y A;  3IXH A;  3E2L A;  1ONG A;  3N8S A;  1PWG A;  3UDX A;  1PYY A;  5DF7 A;  4E3M A;  1KVM A;  4E6W A;  1ESI A;  3W4Q A;  2V2F F;  4WYY A;  1BZA A;  1ES5 A;  4ZDX A;  1ERQ A;  5E2G A;  1VQQ A;  4GZB A;  3C7V A;  4BD1 A;  4R3B A;  1VM1 A;  2EX8 A;  4KQQ A;  4C6Y A;  3V39 A;  2ZQA A;  1NZO A;  1LI9 A;  4GNU A;  2ZQ9 A;  2DNS A;  3RJU A;  3SS4 A;  4U0X A;  4WMC A;  1ES2 A;  4IED A;  3A3J A;  3LCE A;  4DE1 A;  4Y7P A;  3C5A A;  1TEM A;  2FFY A;  4DE0 A;  5A92 A;  2ZLY A;  1EI5 A;  4R23 A;  4QB8 A;  1ES4 A;  3Q7Z A;  3IHB A;  5CHJ A;  3OPH A;  4C75 A;  4DE3 A;  3ZVT A;  2H0T A;  1IYP A;  1JVJ A;  4E3J A;  3SH8 A;  4DXB A;  2HP6 A;  1K25 A;  5EOE A;  2ZJ9 A;  3HL9 A;  4H8R A;  1ZKJ A;  1IEL A;  5FQM A;  4ZJ1 A;  4KZB A;  3ITA A;  2H5S A;  3S1Y A;  3A3I A;  4GDN A;  4E6X A;  4PM6 A;  4KZ3 A;  2WKI A;  3N7W A;  5CGS A;  5F1G A;  3A3E A;  1JTG A;  4ZJ2 A;  5HAQ A;  1YLJ A;  2WAF A;  1CI9 A;  4FCF A;  1MWS A;  1NYY A;  1K38 A;  4BL2 A;  1HD8 A;  4IBX A;  3NDG A;  4P85 A;  5E2H A;  4BJP A;  3DW0 A;  3S4X A;  1GHP A;  4LV0 A;  4HES A;  5FI7 A;  2JCH A;  3ZG9 B;  1SDE A;  5HL1 A;  1E25 A;  5EVI B;  2BG1 A;  4Y0U A;  1S0W A;  2Z2M B;  1OME A;  3WS5 A;  3WWX A;  3C4O A;  3UE0 A;  1GA0 A;  5KMW A;  3OCN A;  5DTK A;  4JKT A;  5GLB A;  4WEL A;  1MXO A;  1M40 A;  3MZF A;  1MWT A;  4GDB A;  4NET A;  1XA1 A;  4A5R A;  1QME A;  4UA7 A;  3SH7 A;  3NDE A;  4HBT A;  2XFT A;  3G35 A;  2WGW B;  3DWK A;  1XPB A;  4LEN A;  2HDS A;  4OOL A;  4PM9 A;  5EPH A;  1FR1 A;  1SCW A;  4LCM A;  1L0E A;  2XD1 A;  3ZG5 A;  5GL9 A;  2UWX A;  3Q82 A;  3C4P A;  1TVF A;  5FQ9 A;  4KG6 A;  5A90 A;  2HDU A;  2HP5 A;  2ZM0 A;  4PM7 A;  3IXD A;  3AGD A;  1XXM A;  4S2L A;  1BUE A;  1YM1 A;  3NBL A;  4LV1 A;  4N1X A;  2DCF A;  3C7U A;  4OPZ A;  5F83 A;  2QMI A;  3CJM A;  4GB7 A;  2WGI A;  4OPR A;  1BLP A;  2XLN A;  5M18 A;  4BQM A;  2ZM8 A;  1NJ4 A;  4DKI A;  1LL9 A;  4R1G A;  4X6T A;  3V50 A;  1YLY A;  4EWF A;  1PI5 A;  2X71 A;  5HAI A;  3EQV A;  4QY5 A;  4ZBE A;  2Y2K A;  3BLS A;  3Q7V A;  1KGG A;  1NRF A;  3MKF A;  3BRM A;  4YIN A;  5EOO A;  1QMF A;  1PW8 A;  5A93 A;  4OVD A;  3HUO A;  3A3F A;  4E3O A;  1J9M A;  5GLC A;  2Y2M A;  3UE3 A;  4BD0 A;  4N92 A;  4S2J A;  1H5X A;  2C6W B;  3GTC A;  2R9W A;  4S2P A;  1ERM A;  3N8L A;  4KZ7 A;  3ZNT A;  3BFC A;  3OPL A;  4FD8 A;  2EXB A;  2OLV A;  4OH0 A;  3RXX A;  2R9X A;  3SH9 A;  1K57 A;  1JTD A;  1MBL A;  1I5Q A;  4B4Z A;  5DVA A;  2EFX A;  4UA9 A;  4OP8 A;  3FKW A;  3GQZ A;  3HLG A;  2QPN A;  1Q2P A;  4PM8 A;  3HRE A;  4RA7 A;  1KDS A;  2WZZ A;  5FA7 A;  2XK1 A;  1K55 C;  2H10 A;  2Z2L B;  3IF5 A;  1XA7 A;  4UA6 A;  1Z6F A;  3O86 A;  4UAA A;  3NIA A;  1BTL A;  1MPL A;  4JF6 A;  3VOY A;  3OCL A;  2FFF B;  2OV5 A;  1TDG A;  5L2F A;  4NK3 A;  3M2J A;  4X69 A;  4X68 A;  2HP9 A;  4JF5 A;  1GHM A;  1K54 A;  5TGF A;  3ZCZ A;  3NC8 A;  2WUQ A;  3TG9 A;  4OOM A;  4D2O A;  2P9V A;  1FCM A;  1KE3 A;  1WE4 A;  5EVI C;  2X02 A;  4MBF A;  4KEN B;  3NY4 A;  5FAP A;  3HLD A;  3IF6 B;  4P87 A;  5M1A A;  4JBF A;  5JYP A;  3ITB A;  2A3U A;  5E43 A;  4KZ8 A;  1KVL A;  3VOZ A;  5KSC A;  3G31 A;  4N9K A;  3ZG0 A;  3IWQ A;  2RCX A;  4R0Q A;  3VFH A;  2CC1 A;  1N4O A;  1IEM A;  3PBN A;  5J8X A;  4R3J A;  1YMS A;  4L0L A;  1SHV A;  3ZNY A;  4WM9 A;  4DDS A;  1SDN A;  3MXR A;  3PBT A;  2XFS A;  4BL3 A;  3DTM A;  2EXA A;  4OLG A;  3LO7 A;  3A3D A;  4JF4 A;  2XR0 A;  3UN7 A;  3PBR A;  1E3U D;  1W79 A;  1K4F A;  4QJG A;  2WKH A;  4FSF A;  1GA9 A;  3BEC A;  1MKI A;  3IT9 A;  1RGZ A;  2Q9M A;  3I7J A;  1C3B A;  5E2E A;  5GHZ A;  4DDY A;  1MWR A;  4U3T A;  2I72 A;  3GRJ A;  4N9L A;  4FH2 A;  4QY6 A;  4WZ5 C;  3IHA A;  4IVI A;  3N6I A;  3IH9 A;  4K91 A;  4S2I A;  5CEB A;  1H8Z A;  5EVL A;  4BEN A;  4F94 A;  3IWO A;  4GD8 A;  4JXV A;  5KSH A;  1BLH A;  1FOF A;  3P98 A;  4RX3 A;  3N4I A;  4LV3 A;  2Y55 A;  2Y2G A;  4EBP A;  3BFD A;  2P74 A;  3W8K A;  3QNC A;  3FWL A;  2GDN A;  3HLC A;  5CRF A;  3UE1 A;  3VP1 A;  3LEZ A;  1FCN A;  3ZVW A;  2HDQ A;  3Q81 A;  1I2S A;  3VFF A;  2Y2I A;  1K56 D;  1DJA A;  1TDL A;  3LY3 A;  4MEZ A;  3HBR A;  4XUZ A;  2RL3 A;  2JE5 A;  1RP5 A;  2WAE A;  3SOI A;  5DF8 A;  1NZU A;  3UO9 A;  1NY0 A;  1GHI A;  3O3V A;  3PBO A;  4E3I A;  2Y4A A;  4S2N C;  3S22 A;  3UNW A;  2ZM2 A;  4GD6 A;  1W8Y A;  1NYM A;  2J7V A;  3FV7 A;  3VSK A;  2XDM A;  3VP4 A;  1FR6 A;  3PBQ A;  5HW3 A;  3G30 A;  4OQ0 A;  5GLA A;  3NCK A;  5EE8 A;  3IWI A;  4S2O A;  4OQI A;  5HAR A;  4KG5 A;  5AQA A;  5DTS A;  3SS5 A;  3HLF A;  3IXG A;  4X56 A;  2EX9 A;  4OPY A;  1KE0 A;  4N1H A;  3ISG A;  5FSR A;  2E8I A;  4OLD A;  5KZH A;  2ZQ7 A;  4CPK A;  1ES3 A;  1HZO A;  1ALQ A;  3PAG A;  1LL5 A;  2X01 A;  1ONH A;  2G2U A;  4MLL A;  3ZHH A;  5FQJ A;  1K4E A;  3OC2 A;  1DJB A;  2Y2O A;  5CGX A;  2Q9N A;  5F82 A;  1W5D A;  4ZTK A;  1ZC2 A;  4KZA A;  2ZQ8 A;  3GMW A;  4IBR A;  2Y2H A;  5CTM A;  3MBZ A;  3ZG8 B;  3UPP A;  5CED A;  1YLT A;  3FKV A;  2Y2P A;  5BOH A;  1L0D A;  4S2K A;  4KG2 A;  1JWP A;  1BUL A;  5A91 A;  3IF6 C;  3PBS A;  1YLW A;  1LLB A;  1L2S A;  3HLW A;  4JLF A;  4KZ9 A;  1ZG4 A;  5EVI D;  1FSY A;  1PZO A;  1RGY A;  5M19 A;  2EX2 A;  2XF3 A;  2H0Y A;  1BT5 A;  1K56 A;  1FQG A;  3SS3 A;  4KQR A;  1PWC A;  4KZ5 A;  4C3Q A;  2XH9 A;  1DY6 A;  3O88 A;  2J9O A;  4RVA A;  2G2W A;  3Q07 A;  2J8Y A;  1LHY A;  3PAE A;  1E4D A;  3D4F A;  4OQG A;  1CK3 A;  1MWU A;  4QU3 A;  3JYI A;  4K0X A;  1WYC A;  4HEF A;  3ZDJ A;  3HLB A;  4EQI A;  4Y0T A;  5FI2 A;  3VP3 A;  3G32 A;  1O07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...