3G30A

Ctx-m-9 class a beta-lactamase complexed with compound 3 (g30)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
b'TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
molecule tags Hydrolase/hydrolase inhibitor
source organism Escherichia coli
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
total genus 93
structure length 262
sequence length 262
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g30A00
3UE3A 4LCMA 2XFSA 1CI9A 2ZQ8A 4KZ7A 5DF8A 3V3SA 3NCKA 1PIOA 1TEMA 3GR2A 5U47A 3V5MA 4CJNA 1MWRA 3G31A 5GLBA 1FQGA 1QMEA 2P9VA 3GQZA 2WUQA 4GKUA 3VP3A 1GHIA 1LI0A 3GTCA 2XDMA 1DJBA 5GHYA 4KG5A 1MBLA 3VSLA 1GHPA 1FR1A 4BL2A 4EQIA 5A93A 3BLSA 2FFFB 4OLDA 2OLUA 5CHUA 1ES2A 4P0MA 4E3NA 5DTTA 3C7VA 2JE5A 3HLDA 1GCEA 3N7WA 2G2WA 2IWCA 3N8LA 1IYQA 1KE3A 1O7EA 2ZLYA 3SS3A 1KDWA 2VGKA 2VGJA 4U3TA 2EFXA 3IXBA 4BENA 4C75A 3Q82A 2XR0A 1IEMA 4ID4A 5EUAA 5EVIA 1ZC2A 4JXVA 4KZ5A 3UPPA 3ZG9B 1YLZA 4IVKA 4QD4A 5D3OA 4BD0A 3ISGA 1YQSA 4RX2A 3HLGA 3MKFA 1KVMA 3UE0A 4LENA 4OH0A 1YT4A 1K38A 3RJUA 3BYDA 1RCJA 1RGYA 3G34A 4N92A 4OQGA 1VQQA 2Y4AA 5GLDA 1CEGA 2PBYA 4LCLA 2H5SA 5CRFA 1I5QA 3ZFZA 1XA7A 2X71A 4BLMA 3CMZA 4IVIA 4RA7A 5EVID 1PW1A 1Y54A 4HBTA 3FWLA 5F1GA 2ZM0A 3M2JA 4WMCD 3ZHHA 4EUZA 2RL3A 5KMWA 3BEBA 5AQ9A 2WGWA 4QY5A 3ZGAB 4RYEA 1SDNA 3SS4A 1N9BA 3RXXA 4GDBA 1IYPA 4OOYA 5FAPA 3WRTA 5J8XA 4FH4A 3WRZA 3UO9A 5FQMA 1PI5A 3DWZA 3PTEA 4E3OA 1LL9A 1K6RA 3ZVTA 2ZC5B 4IBXA 5E2EA 3IF6A 1Z6FA 2RCXA 1YLWA 4OPYA 5AQ7A 1IYSA 2C6WB 2HDQA 3AGFA 2FFYA 3PAEA 3Q7ZA 3DWKA 4ZBEA 2JCHA 1K57C 4LV1A 1MWSA 3Q1FA 5CXWA 1E3UA 4OP8A 3VSKA 2ZC4B 4PM6A 2J9OA 4PMAA 2ZC3B 5GHZA 1K25A 4F94A 4L0LA 1GA9A 1IELA 1K55C 4KG6A 1XP4A 5HAPA 2DNSA 3A3JA 2WADA 3GMWA 2HPBA 3IXGA 4MNRA 1ESIA 1FSWA 1XXMA 2WZZA 2ZQAA 2Y2NA 2H0YA 1FCNA 3LEZA 2OSUA 4GOGA 1PYYA 4X53A 4DKIA 3IWIA 1MPLA 5CERA 3S4XA 2JC7A 2BG1A 2R9XA 3M6BA 3I7JA 5M18A 3BRMA 4S2NA 3W4QA 4BL3A 1KE0A 3C7UA 3W4OA 3O86A 5KSCA 4WZ5A 2ZQDA 3OZHA 1L0GA 4DXCA 1TVFA 4HESA 1XA1A 4H8RA 2IWDA 3B3XA 3C4OA 4N1HA 1BLCA 4XUXA 5EVIC 3GRJA 3DTMA 4R4RA 4Q8IA 1SHVA 5CTMA 5FQIA 5FI2A 4KZAA 3N6IA 5FQJA 5HARA 3OCLA 3BM6A 3IF5A 4DF6A 1JTDA 2ZC6B 4NK3A 3EQUA 5FSRA 1K56A 3CJMA 3D4FA 1JTGA 2XFTA 4DE1A 5EECA 4R3BA 1KGGA 4BD1A 2Y2LA 5FQ9A 2JBFA 2QZ6A 3UPNA 3HUMA 5TGFA 1MY8A 4KQQA 3LCEA 3G2YA 1GA0A 1W8YA 1PW8A 4KZ3A 4R0QA 5CTNA 4UAAA 1U60A 2HDRA 2WKIA 3QNBA 4WELA 1YLYA 4OLGA 3WS0A 4Y0TA 3VP2A 5DF9A 5M1AA 5HL1A 3UDFA 4RVAA 4OQHA 3GVBA 3ITAA 3LY4A 1BLPA 2Q9MA 1ESUA 3FKVA 1BULA 2XK1A 4E6WA 2Y2IA 4DE2A 1H8YA 1FSYA 1TDGA 3CZDA 3IF6C 2EFUA 5E2FA 5HW3A 3S1YA 1OMEA 5CEDA 1NYMA 2P74A 4IEDA 4PM8A 4PM9A 3V3RA 4E3IA 3BFGA 3FV7A 5FAOA 3UDIA 2WYXA 3FZCA 3TOIA 4GD6A 1IKGA 1PWDA 2XH9A 3FKWA 3IWQA 3IF6B 3ZNTA 4E3KA 1SCWA 4K0XA 2EXAA 3BFCA 1EWZA 5GLAA 4KZ6A 3WWXA 1XX2A 3UNWA 5JYOA 3C5AA 1AXBA 4WEJA 5FI7A 1J9MA 1SKFA 2OLVA 4OPZA 3OCNA 1LL5A 1H5XA 3MXRA 5AQAA 3UDXA 4U0XA 1L0EA 3G4PA 4LV3A 1WYCA 3IQAA 1ONGA 4KZ4A 4QY6A 4DXBA 3CG5A 3BECA 1K6SA 5FI6A 5FQKA 5EOOA 3PBOA 3VP4A 1E25A 3OPHA 1XKZA 2V20A 3A3FA 4X69A 1XPBA 3O87A 4N9LA 4E3JA 2ZQCA 4ZAMA 1MKIA 1K54C 4E3LA 2Y91A 1KGFA 1FCOA 2Y2JA 5HFOA 4EBPA 5CHMA 2UWXA 3QHYA 2ZMAA 3VMAA 5E43A 4UHUA 2HP5A 2R9WA 1S0WA 1L2SA 3C4PA 3HL9A 1BLSA 2Y2KA 3VOYA 3HLCA 1L0DA 4JXSA 5EVIB 5HAQA 2QPNA 4X55A 3A3EA 5CEBA 1HVBA 5CGWA 2DRWA 4OKPA 1K54A 1MXOA 3HREA 4S2JA 4OONA 1M40A 1I2SA 2ZC7A 2BLSA 5HAIA 2QMIA 5F82A 2E8IA 4OP5A 4GDNA 3MZEA 2HDUA 4YFMA 3AGDA 4FSFA 3OPLA 1LI9A 3P98A 4DDYA 2ZD8A 3PBSA 3N4IA 3LY3A 5CGSA 2WAEA 4OVDA 1W5DA 2XLNA 1JVJA 1PZOA 4KZBA 3UY6A 3IWOA 3DW0A 3ZG8B 3PBNA 3BLMA 4E6XA 5DVAA 2HP6A 1PWGA 3TG9A 2Z2LB 4WYYA 4S2NC 1LHYA 2WZXA 3IT9A 2WKHA 4JXGA 1CK3A 4JKTA 2XF3A 3HUOA 4GN2A 4WM9A 2V1ZA 4P6BA 2HDSA 4ZDXA 4WBGA 3UPOA 3HLWA 3WS1A 5GLCA 2Y59A 4A5RA 1WE4A 4EV4A 3BFFA 4UA6A 5EE8A 4Z9QA 1BLHA 2J9PA 1S6RA 3BFEA 1W7FA 2XGNA 2WGIA 4IBRA 5CGXA 3ZCZA 1DJCA 4Y7PA 4DRTA 4PM7A 4KQRA 3NY4A 4X68A 4WZ5C 1FCMA 2C5WB 3E2KA 3IH9A 2Y55A 3WS5A 1XGIA 1ERMA 1E4DA 2PU4A 2ZM8A 1RP5A 3G35A 2CC1A 1KDSA 1JWZA 1IKIA 2ZJ9A 3A3IA 2XQZA 4MLLA 5AQBA 1WYBA 4S2LA 5FA7A 4P87A 4YINA 1BZAA 4ZJ2A 4QU3A 1NZOA 4K91A 3N8SA 1ONHA 4KENB 5TFQA 3NBLA 5A90A 1ES4A 4MEZA 4HEFA 3SS5A 2Q9NA 1EROA 2Y2PA 4OOMA 1MWUA 3V50A 1IYOA 1JWPA 1ERQA 3MXSA 4R23A 4S2OA 3Q81A 5HX9A 1ZKJA 4Y0UA 1W79A 4MBHA 1Q2QA 1ES5A 3V39A 2Y2MA 4Y0OA 1LLBA 5FATA 5FQQA 5IHVA 1C3BA 3OC2A 3ZNYA 3SH8A 1ALQA 1ZG6A 2Y2OA 4P85A 2EX6A 3QNCA 3NDGA 4N1XA 3HLBA 3JYIA 4JF4A 4O7DA 2ZM2A 4R1GA 4WMCA 4QB8A 4RX3A 1SDEA 1HD8A 4S2KA 4BQMA 3LO7A 3HBRA 3PAGA 4PM5A 1GHMA 1YLTA 1DJAA 2XD1A 5F1FA 5DTSA 4DE3A 3NI9A 2WKEA 5G18A 5BOHA 4EWFA 4XUZA 1K4EA 2EX9A 1XGJA 5GHXA 1K56D 4ZTKA 1NY0A 3W8KA 2IWBA 4LV2A 1BUEA 2X01A 4C3QA 3W4PA 5I94A 5L2FA 1FOFA 1W8QA 3RXWA 3VOZA 2WAFA 2OV5A 4C6YA 1QMFA 4JLFA 1I2WA 3HVFA 4OOLA 4E3MA 3SH7A 4ZJ3A 4XXRA 3Q7VB 2EX2A 3HLFA 1VM1A 5E2GA 3SOIA 1DY6A 3ZG0A 4LV0A 1YLJA 3ZDJA 4KZ9A 5CHJA 3A3DA 5M19A 5FAQA 4UA7A 1HTZA 4X6TA 3Q7VA 3UE1A 1K57A 1K4FA 4UA9A 4GD8A 4QHCA 2J8YA 4JF6A 1M6KA 4GZBA 3ZG7B 2PU2A 3ZG5A 4U0TA 4EBLA 2Y2HA 2DCFA 3PBRA 3G32A 1ES3A 1PZPA 3MZDA 1BSGA 1BT5A 4CPKA 1L0FA 1O07A 4X56A 1EI5A 2B5RA 4ZJ1A 5CECA 5A91A 1MWTA 3E2LA 4S2MA 3AGEA 3ITBA 3TSGA 3WS2A 3MFDA 4JXWA 4DE0A 2EXBA 1NYYA 3VP1A 2H10A 3OPRA 1YMXA 3IXHA 4WZ4A 4R4SA 3IHAA 3O88A 1TDLA 3BFDA 2GDNA 3GV9A 2Z2MB 1NJ4A 3HUNA 5EPHA 3VFHA 4K0WA 1RGZA 2P9VB 4D2OA 4DDSA 3PBQA 2Y2GA 5KSHA 5EOEA 3Q07A 1FR6A 1YMSA 1YM1A 4N9KA 4OQIA 3GSGA 2EX8A 3MKEA 3PBTA 4EBNA 3S22A 4WEKA 3FYZA 4OQ0A 4KQOA 4OPQA 3IHBA 1K55A 5E2HA 2V2FF 2A49A 4B4XA 1PI4A 2I72A 4GB7A 1KE4A 4GNUA 1ZG4A 5DTKA 4JPMA 5FDHA 4BJPA 3IXDA 2H0TA 2WGVA 2J7VA 3NC8A 1H8ZA 3WS4A 4FH2A 2A3UA 4FD8A 3IH8A 3NIAA 4QJGA 5JYPA 1G68A 5KZHA 1N4OA 4S2PA 5EVLA 4KZ8A 3ZVWA 1KVLA 3VFFA 3VP0A 1YLPA 1HZOA 4HBUA 3M2KA 3SH9A 5DF7A 2WGWB 5GL9A 4PPRA 4JBFA 2ZQ9A 4B88A 3HLEA 4MBFA 3MBZA 3O3VA 1KGEA 2X02A 4MBKA 1BTLA 3G30A 3NDEA 5TR7A 4JF5A 4B4ZA 1G6AA 1Q2PA 3N8RA 2Y2QA 1NZUA 5A92A 3M6HA 4KG2A 1JWVA 2XD5A 3P09A 3MZFA 5FASA 4OPRA 2HP9A 1CEFA 4S2IA 4R3JA 1E3UD 5F83A 2WK0A 4M3KA 3EQVA 1PWCA 1NXYA 2ZQ7A 3G2ZA 4NETA 1CI8A 2XEPA 2G2UA 3OPPA 4FCFA 3UN7A 1NRFA
chains in the Genus database with same CATH superfamily
5DJTA 2XFSA 2AVXA 4R3AA 3C2WA 2L0WA 2HZ5A 3NCKA 1TEMA 3V5MA 1H8MA 4GKUA 4XT2B 1GHIA 1LI0A 1GHPA 1FR1A 2QYBA 2J3TC 3BLSA 4LPZA 1XJ3A 5DTTA 3ULFA 3HLDA 2IWCA 1O7EA 4JGQA 1KDWA 2VGJA 3E4QA 2EFXA 3BWLA 2NUTC 1S1YA 4C75A 5EM0A 1IEMA 5EUAA 5EVIA 1ZC2A 4KZ5A 3UPPA 5MC7A 3QP1A 3ISGA 3MKFA 4OH0A 1YT4A 5FL3A 3BYDA 3G34A 5GLDA 5CRFA 3MFXA 4IVIA 4RA7A 4CLCB 3BW6A 4HBTA 3M2JA 4LRXC 1T1AA 3ZHHA 3T4LA 4Y17A 4MMNA 2B02A 4FH4A 3VE4A 2ZL1A 3G6OA 1Z6FA 3PAEA 3DWKA 2JCHA 1K57C 4L9GA 1D7EA 4PM6A 4PMAA 4DN0A 1YSPA 5AVFA 4I3JA 5F5YA 3GMWA 2HPBA 3IXGA 3UB8A 4D60A 1XXMA 2Y2NA 2JC7A 3I7JA 4BBVA 4II7A 3O86A 3OZHA 2MJ6A 4BMWA 4DXCA 1YAXA 4H8RA 3CWFA 4N1HA 5HDDA 2VK3A 5FQIA 4KZAA 5FQJA 5HARA 1ZHHB 3BM6A 4DF6A 4NK3A 5FSRA 3D4FA 2XFTA 1KGGA 3PHYA 2Y2LA 5FQ9A 1Y28A 2JKGA 3HUMA 4KQQA 3E98A 3LCEA 1KOUA 5CTNA 1U60A 2WKIA 3QNBA 4WELA 3VV4A 3KSGA 1NLZA 4Y0TA 3VP2A 3UDFA 4OQHA 4GLQA 1ESUA 4H6JA 1XFQA 2OAP1 1AWIA 4BWIA 2EFUA 4JGOA 5HW3A 2V0UA 2D02A 4PM8A 4E3IA 4NEED 2H28A 3UDIA 3TOIA 4GD6A 3IBRA 1IKGA 1PWDA 3BY9A 1CQAA 2D01A 3IF6B 3ZNTA 3PR6A 1ODVA 5GLAA 1XX2A 5JYOA 1ACFA 1AXBA 3MXRA 3UDXA 4IUKA 1WYCA 4QY6A 4DXBA 5FI6A 2GNXA 4F3LA 3A3FA 1XPBA 4N9LA 2KOIA 4EBPA 5CHMA 5E43A 3HL9A 1L2SA 3C4PA 4CLCE 5EVIB 5CEBA 1HVBA 3CLOA 5CGWA 4OONA 1M40A 1I2SA 3EEHA 2QMIA 1LI9A 2HV1A 3N4IA 2W3EA 1W5DA 1JVJA 3RFBA 3DW0A 4CLCA 5DVAA 1VHMA 4WYYA 4JKTA 3UPOA 3NOPC 1FILA 5EE8A 4QWOA 2W27A 2V8CA 1DJCA 2PBDP 5L10A 4Y7PA 4PM7A 4KQRA 5HWWA 1XGIA 4FUWA 4MLLA 4MCWA 5FA7A 1OT6A 4QU3A 3N8SA 3NBLA 1ES4A 4HEFA 2Q9NA 3BQAA 3V50A 3EGDC 1IYOA 2P08A 4Y5FA 4S2OA 3Q81A 4GS9B 4X25A 3F1PA 3KYZA 5TJJA 3R7WA 2O0YA 1ES5A 3V39A 2PYPA 1LLBA 5FQQA 3SH8A 3JVVA 4WMCA 3KO6A 2W0NA 4JF4A 3NJAA 1TD5A 2XD1A 3NI9A 1V9YA 4Y13A 5BOHA 1YPRA 3U2AA 1MC0A 1BUEA 5I94A 1FOFA 1W8QA 3RXWA 4BBTA 2WAFA 1QMFA 4OOLA 4MDZA 2WKQA 3Q7VB 1Y4OA 3HLFA 4L9EA 1JNUA 4LGWA 1YLJA 5CHJA 3MQQA 4X6TA 2G7UA 2QJ5A 2K7SA 4JF6A 1M6KA 4ETXA 2DCFA 2ZMVA 3F1NA 4ZJ1A 4S2MA 4DE0A 3MFDA 2EXBA 2R78A 2VV7A 2PRFA 3BFDA 1VEUA 5HDSA 4EQ1A 1S66L 2GJ3A 5EOEA 3Q07A 1YMSA 1YM1A 4N9KA 3FPVA 3IS2B 1EW0A 2V2FF 2I72A 5HPFA 5FDHA 1ZG4A 4GHIA 3C30A 2H0TA 4FD8A 3CITA 5EVLA 5L07A 3IS2A 2EWWA 3EOIA 3VFFA 1YLPA 2WGWB 3MBZA 1KGEA 1OPXA 4MBKA 3MJQA 4JF5A 3LYXA 1Q2PA 3N8RA 1NZUA 3MZFA 5FASA 1CEFA 5F83A 4EERA 2ZQ7A 1CI8A 3T4SA 2G2UA 1SKOA 4FCFA 1W63M 4LCMA 3CPTA 1CI9A 2ZQ8A 4KZ7A 3V3SA 3NOTC 3GR2A 3F1OB 3G31A 1QMEA 2P9VA 2WUQA 3H7WB 3TRCA 1DJBA 3QP2A 4BL2A 1DP6A 1H3QA 4LFUA 4OLDA 3H7WA 1ES2A 4XT2A 2DMWA 3C7VA 2JE5A 3SS3A 2G2WA 1IYQA 3TE8A 2PD7A 4JXVA 3LFVA 1VB6A 2W3FA 4RX2A 3FG8A 1LSWA 2GX5A 4LENA 3QP4A 2W1TB 4OQGA 1VQQA 1CEGA 2X71A 3CMZA 1XJ2A 5EVID 3FWLA 4WMCD 2RL3A 5AQ9A 4QY5A 2VZWA 3K3CA 4RYEA 4JGRA 1N9BA 4GDBA 3WRTA 4OOYA 2A24A 2P7JA 3UO9A 3TJZC 1LL9A 1K6RA 5E2EA 3QP6A 2VGLM 5AQ7A 2C6WB 2HDQA 3Q1FA 5CXWA 5G4YA 4OP8A 2ZC4B 1IELA 1XP4A 4P6ZM 3D72A 2WADA 4MNRA 1ESIA 1FSWA 4OPRA 2ZQAA 4NXBA 4GOGA 3U4LP 2OSUA 4DKIA 5CERA 2BG1A 1OJ5A 2FH5A 4EEUA 2OWJA 4S2NA 3W4QA 1KE0A 5KSCA 2JKTI 2B95A 1XA1A 2IWDA 2JKRI 2V1AA 1BLCA 3GRJA 4Q8IA 5CTMA 3NOUC 1JTDA 3CJMA 3E0YA 1XJ4A 4BD1A 2QKPA 5HPIA 2QZ6A 1SZVA 4O0PA 3UPNA 5TGFA 1GA0A 2HDRA 2CMNA 1TS0A 4OLGA 3B47A 4MN5A 5M1AA 3ITAA 2JKTM 3LY4A 2Q9MA 3T1XA 1BULA 1G5UA 4E6WA 1FSYA 4IEDA 3V3RA 3BFGA 3T50A 3CHWP 5FAOA 2WYXA 3O5YA 2Y8HA 2K2NA 3IWQA 4E3KA 3S7NA 3WWXA 3C5AA 2WKRA 2XROA 1J9MA 3T4QA 2OLVA 4U0XA 4LV3A 5TBMA 3CG5A 5FQKA 3VP4A 1S4RA 1E25A 4X69A 3O87A 2Q0OA 2Y91A 4HP4A 2UWXA 2ZMAA 1OJGA 3VMAA 4NXGA 4UHUA 2Y2KA 1P0ZA 4PAUA 4JXSA 5HAQA 2QPNA 3A3EA 1VETB 5K5BA 3HREA 5KIZA 5F82A 5CX7A 2HDUA 4YFMA 2ZD8A 2V9AA 3LY3A 2WAEA 5AVEA 3IWOA 2KX6A 4E6XA 2HP6A 5DKLA 1D06A 1LHYA 3IT9A 4NXFA 2WKHA 3DTIA 4GN2A 4ZDXA 4WBGA 1S4SA 3WS1A 3LI9A 4Z9QA 1BLHA 2J9PA 3BFEA 2XGNA 4IBRA 3ZCZA 3NY4A 4X68A 3E2KA 3GDIA 2PU4A 3DTKA 2W1RA 5EVEA 1UGUA 2CC1A 1KDSA 5AQBA 3A3IA 5I5LA 1WYBA 4S2LA 4YINA 4EUVA 1ONHA 5TFQA 5A90A 4MEZA 3SS5A 1Z09A 1PRQA 2Y2PA 3FC7A 4R23A 5HX9A 1ZKJA 3IX3A 4UEYA 3SZTA 5IHVA 1C3BA 1ALQA 4HI4A 2Y2OA 2YKFA 3UNWA 1N9NA 3HLBA 1H0MA 4QB8A 1SDEA 1HD8A 4HQAA 3LO7A 4PM5A 1YLTA 5F1FA 3KYQA 3MQOA 5G18A 1OTDA 4XUZA 4Q0JA 2O9BA 1K56D 4ZTKA 4UQIM 2IWBA 4UQIS 2OV5A 4C6YA 4JLFA 1NRFA 1MKMA 3SH7A 3A0SA 4XXRA 2EX2A 5E2GA 1G28A 1DY6A 3ZG0A 4KZ9A 3QP8A 4Y3IA 5FAQA 4UA7A 3T4OA 3Q7VA 3ZG7B 4ME4A 1XFNA 5HWTA 4X1MA 4ZRRA 1CF0A 1ES3A 1PZPA 3MZDA 3AGEA 3ITBA 1NYYA 3VP1A 2H10A 1YMXA 4ETZA 4Q0IA 3IX8A 1TDLA 2GDNA 3GV9A 4HNBA 2Z2MB 3PYPA 1NJ4A 5EPHA 4DDSA 2HF6A 2KLIA 5HWVA 5FDSA 3PBTA 4EBNA 1VEUB 2HGVA 4OQ0A 2ZOHA 5J7EA 3IHBA 1YKDA 3PXPA 4BJPA 1OT9A 2J7VA 3WS4A 4GW9A 4FH2A 4KUOA 3IH8A 4QJGA 1T1CA 1G68A 5KZHA 1N4OA 4S2PA 4KZ8A 1KVLA 3VP0A 4PPRA 3QP5A 4PKYA 4NXEA 1PNEA 2X02A 1IOUA 5F69A 1V9ZA 3G30A 5HL6A 4R6LA 3LR0A 1G6AA 2A24B 4B4ZA 4RQ9A 5L8MA 2HP9A 3S7PA 2WK0A 4HIAA 4JGPA 4M3KA 3EQVA 1PWCA 2VKSA 3G2ZA 4ARZA 2XEPA 2OWHA 3BJNA 3UE3A 1HLUP 3B33A 1PIOA 4CJNA 5GLBA 3GQZA 1OTIA 5HD3A 2W3DA 3H9WA 2K31A 4GCZA 3GTCA 2XDMA 5GHYA 4KG5A 1MBLA 1OTAA 3VSLA 4R70A 3OBFA 3EWKA 4EQIA 5A93A 2ACGA 2FFFB 2OLUA 4AFIA 2PDRA 4P0MA 2IA2A 1GCEA 2L1MA 3N7WA 1KE3A 2VGKA 4U3TA 3RTYA 3IXBA 3T4KA 4ID4A 3H82A 3T12B 1YLZA 5F68A 4HJ6A 1KVMA 3UE0A 3DAVA 2B18A 3RJUA 1PFLA 2M1CA 1RGYA 2Y4AA 1F2KA 2H5SA 3ZFZA 1Y54A 3MS6A 1YSQA 4EUZA 3BEBA 3HJKA 1P9RA 3C8CA 5FAPA 1IYPA 4E3OA 3IF6A 2RCXA 4OPYA 3B42A 2FFYA 4LV1A 4HP9A 4EW7A 1E3UA 3VSKA 2ZBBA 2J9OA 1K25A 3VE3A 4L0LA 1K55C 4KG6A 5HAPA 2JHEA 2DNSA 3A3JA 3CAXA 2H0YA 1PYYA 3S4XA 1MPLA 4LRYC 4BL3A 3LIEA 3C7UA 3NULA 3R4KA 2ZQDA 1L0GA 4HESA 2VV6A 3B3XA 3C4OA 3CI6A 4EESA 4XUXA 5EVIC 4R4RA 1SHVA 5FI2A 3IF5A 1UWNX 3EEAA 4DE1A 5EECA 4R3BA 2JBFA 3DTEA 3HJIA 1MY8A 5EM1A 3G2YA 1P97A 1W8YA 1PW8A 1YLYA 1F98A 3WS0A 1WA9A 5DF9A 3SW1A 4EETB 3E4PA 5HL1A 4WN5A 1BLPA 2Y2IA 3JVUA 3IF6C 1TDGA 3UMEA 1OMEA 1NYMA 2P74A 2Z6CA 3LUQA 4MN7A 2OAQ1 4FTXA 2ZL1B 2V0WA 4O8GA 3FKWA 3KX0X 5DFXA 4CLCC 2W3GA 4K0XA 2EXAA 3BFCA 1EWZA 2PHYA 3D9YA 5FI7A 4LLOB 5HD5A 1SKFA 3OCNA 1LL5A 4X1LA 1H5XA 5AJGA 1L0EA 3BQ8A 3IQAA 4GS9A 1ONGA 4YNRA 4P6ZS 3BECA 3S7QA 3OLOA 3MXQA 3OPHA 1XKZA 3T4TA 2FZ0A 4ZAMA 4IUHA 1K54C 3TW8A 1D1JA 2M7VA 3QHYA 2R9WA 3KSIA 1S0WA 1GSVA 1L0DA 2J80A 2PR6A 2DRWA 4OKPA 1MXOA 2ZC7A 4OP5A 4GDNA 3MZEA 3AGDA 4FSFA 3PBSA 4OVDA 2XLNA 3UB7A 1PZOA 2JKFA 1LL8A 3PBNA 1PWGA 2Z2LB 4S2NC 2XA7M 4JXGA 1CK3A 2XF3A 3HUOA 4WM9A 4P6BA 2HDSA 2Y59A 4A5RA 5FEGA 1WE4A 4EV4A 4UA6A 4HOIA 4H6JB 3NHQA 2WGIA 5CGXA 3IBJA 4WZ5C 5TBMB 1FCMA 3MF0A 3IH9A 3NECA 4HY8A 1ERMA 1E4DA 4DMZA 3G35A 4KUKA 1JWZA 3T1RA 1NZOA 4Q0HA 1CJFA 3MSHA 1G6OA 1EROA 4OOMA 1MWUA 2QHKA 1JWPA 2ZOIA 3P7NA 2HJEA 4NKPA 4Y0UA 1W79A 1X0OA 4MBHA 3EGXC 4IHQA 3P01A 3ZNYA 1NLYA 1MZUA 3QNCA 4N1XA 4R1GA 4O7DA 1TS6A 4RX3A 2L4RA 3PAGA 1DJAA 4DE3A 4G3VA 2WKEA 4EWFA 1K4EA 3UMDA 3W8KA 4LV2A 5L2FA 3W4PA 3T1QB 1I2WA 4E3MA 5FEFA 5G4ZA 3ZDJA 3A3DA 1OTEA 5M19A 2J3WA 3W2ZA 1HTZA 1K57A 5L09A 4UA9A 1DP8A 2J8YA 5EFWA 2PU2A 2BTFP 4U0TA 5HSQA 2Z6DA 4R38A 2NUPC 3PBRA 1T18A 3G32A 2EWVA 1F9IA 4CPKA 4X56A 1EI5A 5CECA 3E2LA 3TSGA 4JXWA 4KQDA 4R4SA 3IHAA 5DJUA 2PR5A 3KYEA 4E04A 1RGZA 3PBQA 4Y15A 5KSHA 4O01A 1FR6A 4OQIA 3GSGA 2EX8A 3MKEA 5J3WA 4OPQA 4KQOA 1K55A 2A49A 1PI4A 2HJ9C 2WKPA 1H8ZA 4EXOA 5DFYA 2A3UA 1VETA 2JKRM 4I3AA 1LSXA 1S1ZA 4HBUA 3M2KA 5DF7A 2QJ7A 2ZQ9A 3LIDA 3O3VA 2I9VA 5C5KA 3MQ0A 5TR7A 1TS7A 2W1TA 5A92A 3M6HA 3F1NB 2Y79A 1T1BA 1E3UD 3E4OA 4PKYG 4G3WA 1A0KA 3OPPA 2VLGA 5DF8A 4Y2FA 5U47A 1MWRA 3V67A 1FQGA 3VP3A 4QPRA 2M7UA 1DP9A 5IS1A 5CHUA 4E3NA 3GECA 3N8LA 2P04A 2ZLYA 2VV8A 4BENA 3Q82A 2XR0A 4GJ4A 4MN6A 3ZG9B 2EA9A 1IFQA 4IVKA 4QD4A 3MMHA 5D3OA 4BD0A 1YQSA 3HLGA 1XJ6A 1K38A 1DRMA 4EU0A 3H82B 1RCJA 4N92A 4BBUA 2PBYA 4LCLA 1I5QA 1XA7A 4BLMA 2ZMFA 1PW1A 3VOLA 5F1GA 2ZM0A 2O9CA 3MR0A 1SKOB 2PYRA 5KMWA 2WGWA 3ZGAB 1SDNA 3SS4A 3RXXA 1UWPX 5J8XA 3WRZA 5J4EA 5FQMA 1PI5A 3DWZA 3PTEA 3ZVTA 4YWZA 2BASA 2ZC5B 4IBXA 4IJGA 1YLWA 1IYSA 3AGFA 5DKKA 3Q7ZA 4ZBEA 1MWSA 3BY8A 2VEAA 2PAVP 2V1BA 5GHZA 2ZC3B 1S67L 4F94A 1GA9A 3FPWA 1N9LA 2WZZA 3UE6A 3LEZA 1FCNA 4X53A 4Z1WA 1FIKA 3IWIA 1T19A 3ZQ5A 2R9XA 3M6BA 5M18A 3BRMA 4K08A 4HH2A 3W4OA 3LI8A 4WZ5A 1N9OA 1STZA 1TVFA 1L3LA 3K3DA 3DTMA 2A2LA 3N6IA 2YKHA 3CUEA 3OCLA 2ZC6B 3EQUA 4F3LB 1K56A 1JTGA 4G3KA 3HCYA 2O9AA 3A0RA 4HH3A 4KZ3A 4R0QA 2PT7A 4UAAA 1GSWA 4I39A 4RVAA 1J3WA 3GVBA 3FKVA 2XK1A 4CQHA 4DE2A 1H8YA 5E2FA 3CZDA 3LR5A 3S1YA 5CEDA 4HJ3A 4PM9A 3C38A 3FV7A 3A0VA 3D3OA 3FZCA 2XH9A 3LIBA 4I5SA 1SCWA 2O99A 4KZ6A 4HHDA 1TF1A 4WEJA 3LIAA 4OPZA 5AQAA 3G4PA 3ZYTA 4KZ4A 1K6SA 5EOOA 3PBOA 3KSHA 1NWZA 4WL9A 2V20A 3KSFA 4E3JA 2ZQCA 1MKIA 4FOFA 4E3LA 1KGFA 1FCOA 2Y2JA 5HFOA 3T4JA 2XSSA 4B9OA 3IX4A 2HP5A 3VOYA 1BLSA 3LEQA 4GHIB 3HLCA 1F5MA 4X55A 3LGOA 2OOLA 1K54A 4S2JA 2VGLS 2BLSA 5HAIA 2VX8A 2E8IA 5EV0A 3OPLA 4DJ3A 3P98A 4DDYA 5CGSA 4KZBA 3UY6A 3ZG8B 3UB9A 3BLMA 3TG9A 1BYWA 3CUEC 4CLCD 2WZXA 2LB9A 2GZAA 2V1ZA 3HLWA 5GLCA 1W63Q 2W3HA 3BFFA 1S6RA 1W7FA 4PHTA 3RH8B 4DRTA 2C5WB 1TS8A 4LRZE 3WS5A 2Y55A 3OOVA 4NG2A 1OTBA 2ZM8A 4HJ4A 2J3TD 1RP5A 1IKIA 2ZJ9A 2XQZA 5HZHA 4I3IA 4P87A 4ZJ2A 1BZAA 4K91A 3S7OA 3F1PB 4KENB 5F6AA 3JPUA 3R7WB 2KDKA 1ERQA 3MXSA 3ICYA 1Q2QA 4I38A 2Y2MA 4Y0OA 5FATA 3OC2A 1ZG6A 4P85A 2EX6A 3NDGA 3JYIA 2ZM2A 3T1SA 4S2KA 4BQMA 3HBRA 1GHMA 5IT5A 5DTSA 1ZTUA 2EX9A 1XGJA 5GHXA 3LIFA 1NY0A 2X01A 4C3QA 2UV0E 3VOZA 2VJWA 4ZJ3A 3L9KA 1VM1A 3SOIA 4LV0A 2V8FA 4YOFA 3UE1A 1K4FA 4GD8A 4QHCA 4GZBA 3ZG5A 1P9WA 2Y2HA 4EBLA 1BSGA 1BT5A 2LB5A 1L0FA 1O07A 2B5RA 3LR3A 4B93A 5A91A 2INWA 1MWTA 3WS2A 4WUJA 4ARZB 3OPRA 3L7HA 4DJ2A 3LR4A 5A8BA 4M4XA 2XA7S 3IXHA 4L9FA 2QWSA 4WZ4A 3CPTB 3O88A 3HUNA 3F1OA 2VA0A 3VFHA 4K0WA 2P9VB 4D2OA 2Y2GA 1K0KA 5HDCA 2XRNA 3S22A 4WEKA 3K2NA 3FYZA 2PD8A 5E2HA 1GSXA 4B4XA 4GB7A 4GNUA 1KE4A 5DTKA 2E8JA 4JPMA 3IXDA 2WGVA 3NC8A 3UB5P 4WLAA 3NIAA 5JYPA 1LSVA 3ZVWA 4ESPA 1HZOA 3SH9A 3DBAA 5GL9A 4B88A 4JBFA 2JN7A 3HLEA 4MBFA 1BTLA 3NDEA 2Y2QA 3UB6A 4KG2A 1LT0A 1JWVA 2XD5A 3P09A 4S2IA 4R3JA 5LBRA 1NRJA 3LICA 4WF0A 1NXYA 4EEPA 4NETA 5IU1A 3UN7A 3HVFA
chains in the Genus database with same CATH topology
3UE3A 4LCMA 2XFSA 1CI9A 2ZQ8A 4KZ7A 5DF8A 3V3SA 3NCKA 1PIOA 1TEMA 3GR2A 5U47A 3V5MA 4CJNA 1MWRA 3G31A 5GLBA 1FQGA 1QMEA 2P9VA 3GQZA 2WUQA 4GKUA 3VP3A 1GHIA 1LI0A 3GTCA 2XDMA 1DJBA 5GHYA 4KG5A 1MBLA 3VSLA 1GHPA 1FR1A 4BL2A 4EQIA 5A93A 3BLSA 2FFFB 4OLDA 2OLUA 5CHUA 1ES2A 4P0MA 4E3NA 5DTTA 3C7VA 2JE5A 3HLDA 1GCEA 3N7WA 2G2WA 2IWCA 3N8LA 1IYQA 1KE3A 1O7EA 2ZLYA 3SS3A 1KDWA 2VGKA 2VGJA 4U3TA 2EFXA 3IXBA 4BENA 4C75A 3Q82A 2XR0A 1IEMA 4ID4A 5EUAA 5EVIA 1ZC2A 4JXVA 4KZ5A 3UPPA 3ZG9B 1YLZA 4IVKA 4QD4A 5D3OA 4BD0A 3ISGA 1YQSA 4RX2A 3HLGA 3MKFA 1KVMA 3UE0A 4LENA 4OH0A 1YT4A 1K38A 3RJUA 3BYDA 1RCJA 1RGYA 3G34A 4N92A 4OQGA 1VQQA 2Y4AA 5GLDA 1CEGA 2PBYA 4LCLA 2H5SA 5CRFA 1I5QA 3ZFZA 1XA7A 2X71A 4BLMA 3CMZA 4IVIA 4RA7A 5EVID 1PW1A 1Y54A 4HBTA 3FWLA 5F1GA 2ZM0A 3M2JA 4WMCD 3ZHHA 4EUZA 2RL3A 5KMWA 3BEBA 5AQ9A 2WGWA 4QY5A 3ZGAB 4RYEA 1SDNA 3SS4A 1N9BA 3RXXA 4GDBA 1IYPA 4OOYA 5FAPA 3WRTA 5J8XA 4FH4A 3WRZA 3UO9A 5FQMA 1PI5A 3DWZA 3PTEA 4E3OA 1LL9A 1K6RA 3ZVTA 2ZC5B 4IBXA 5E2EA 3IF6A 1Z6FA 2RCXA 1YLWA 4OPYA 5AQ7A 1IYSA 2C6WB 2HDQA 3AGFA 2FFYA 3PAEA 3Q7ZA 3DWKA 4ZBEA 2JCHA 1K57C 4LV1A 1MWSA 3Q1FA 5CXWA 1E3UA 4OP8A 3VSKA 2ZC4B 4PM6A 2J9OA 4PMAA 2ZC3B 5GHZA 1K25A 4F94A 4L0LA 1GA9A 1IELA 1K55C 4KG6A 1XP4A 5HAPA 2DNSA 3A3JA 2WADA 3GMWA 2HPBA 3IXGA 4MNRA 1ESIA 1FSWA 1XXMA 2WZZA 2ZQAA 2Y2NA 2H0YA 1FCNA 3LEZA 2OSUA 4GOGA 1PYYA 4X53A 4DKIA 3IWIA 1MPLA 5CERA 3S4XA 2JC7A 2BG1A 2R9XA 3M6BA 3I7JA 5M18A 3BRMA 4S2NA 3W4QA 4BL3A 1KE0A 3C7UA 3W4OA 3O86A 5KSCA 4WZ5A 2ZQDA 3OZHA 1L0GA 4DXCA 1TVFA 4HESA 1XA1A 4H8RA 2IWDA 3B3XA 3C4OA 4N1HA 1BLCA 4XUXA 5EVIC 3GRJA 3DTMA 4R4RA 4Q8IA 1SHVA 5CTMA 5FQIA 5FI2A 4KZAA 3N6IA 5FQJA 5HARA 3OCLA 3BM6A 3IF5A 4DF6A 1JTDA 2ZC6B 4NK3A 3EQUA 5FSRA 1K56A 3CJMA 3D4FA 1JTGA 2XFTA 4DE1A 5EECA 4R3BA 1KGGA 4BD1A 2Y2LA 5FQ9A 2JBFA 2QZ6A 3UPNA 3HUMA 5TGFA 1MY8A 4KQQA 3LCEA 3G2YA 1GA0A 1W8YA 1PW8A 4KZ3A 4R0QA 5CTNA 4UAAA 1U60A 2HDRA 2WKIA 3QNBA 4WELA 1YLYA 4OLGA 3WS0A 4Y0TA 3VP2A 5DF9A 5M1AA 5HL1A 3UDFA 4RVAA 4OQHA 3GVBA 3ITAA 3LY4A 1BLPA 2Q9MA 1ESUA 3FKVA 1BULA 2XK1A 4E6WA 2Y2IA 4DE2A 1H8YA 1FSYA 1TDGA 3CZDA 3IF6C 2EFUA 5E2FA 5HW3A 3S1YA 1OMEA 5CEDA 1NYMA 2P74A 4IEDA 4PM8A 4PM9A 3V3RA 4E3IA 3BFGA 3FV7A 5FAOA 3UDIA 2WYXA 3FZCA 3TOIA 4GD6A 1IKGA 1PWDA 2XH9A 3FKWA 3IWQA 3IF6B 3ZNTA 4E3KA 1SCWA 4K0XA 2EXAA 3BFCA 1EWZA 5GLAA 4KZ6A 3WWXA 1XX2A 3UNWA 5JYOA 3C5AA 1AXBA 4WEJA 5FI7A 1J9MA 1SKFA 2OLVA 4OPZA 3OCNA 1LL5A 1H5XA 3MXRA 5AQAA 3UDXA 4U0XA 1L0EA 3G4PA 4LV3A 1WYCA 3IQAA 1ONGA 4KZ4A 4QY6A 4DXBA 3CG5A 3BECA 1K6SA 5FI6A 5FQKA 5EOOA 3PBOA 3VP4A 1E25A 3OPHA 1XKZA 2V20A 3A3FA 4X69A 1XPBA 3O87A 4N9LA 4E3JA 2ZQCA 4ZAMA 1MKIA 1K54C 4E3LA 2Y91A 1KGFA 1FCOA 2Y2JA 5HFOA 4EBPA 5CHMA 2UWXA 3QHYA 2ZMAA 3VMAA 5E43A 4UHUA 2HP5A 2R9WA 1S0WA 1L2SA 3C4PA 3HL9A 1BLSA 2Y2KA 3VOYA 3HLCA 1L0DA 4JXSA 5EVIB 5HAQA 2QPNA 4X55A 3A3EA 5CEBA 1HVBA 5CGWA 2DRWA 4OKPA 1K54A 1MXOA 3HREA 4S2JA 4OONA 1M40A 1I2SA 2ZC7A 2BLSA 5HAIA 2QMIA 5F82A 2E8IA 4OP5A 4GDNA 3MZEA 2HDUA 4YFMA 3AGDA 4FSFA 3OPLA 1LI9A 3P98A 4DDYA 2ZD8A 3PBSA 3N4IA 3LY3A 5CGSA 2WAEA 4OVDA 1W5DA 2XLNA 1JVJA 1PZOA 4KZBA 3UY6A 3IWOA 3DW0A 3ZG8B 3PBNA 3BLMA 4E6XA 5DVAA 2HP6A 1PWGA 3TG9A 2Z2LB 4WYYA 4S2NC 1LHYA 2WZXA 3IT9A 2WKHA 4JXGA 1CK3A 4JKTA 2XF3A 3HUOA 4GN2A 4WM9A 2V1ZA 4P6BA 2HDSA 4ZDXA 4WBGA 3UPOA 3HLWA 3WS1A 5GLCA 2Y59A 4A5RA 1WE4A 4EV4A 3BFFA 4UA6A 5EE8A 4Z9QA 1BLHA 2J9PA 1S6RA 3BFEA 1W7FA 2XGNA 2WGIA 4IBRA 5CGXA 3ZCZA 1DJCA 4Y7PA 4DRTA 4PM7A 4KQRA 3NY4A 4X68A 4WZ5C 1FCMA 2C5WB 3E2KA 3IH9A 2Y55A 3WS5A 1XGIA 1ERMA 1E4DA 2PU4A 2ZM8A 1RP5A 3G35A 2CC1A 1KDSA 1JWZA 1IKIA 2ZJ9A 3A3IA 2XQZA 4MLLA 5AQBA 1WYBA 4S2LA 5FA7A 4P87A 4YINA 1BZAA 4ZJ2A 4QU3A 1NZOA 4K91A 3N8SA 1ONHA 4KENB 5TFQA 3NBLA 5A90A 1ES4A 4MEZA 4HEFA 3SS5A 2Q9NA 1EROA 2Y2PA 4OOMA 1MWUA 3V50A 1IYOA 1JWPA 1ERQA 3MXSA 4R23A 4S2OA 3Q81A 5HX9A 1ZKJA 4Y0UA 1W79A 4MBHA 1Q2QA 1ES5A 3V39A 2Y2MA 4Y0OA 1LLBA 5FATA 5FQQA 5IHVA 1C3BA 3OC2A 3ZNYA 3SH8A 1ALQA 1ZG6A 2Y2OA 4P85A 2EX6A 3QNCA 3NDGA 4N1XA 3HLBA 3JYIA 4JF4A 4O7DA 2ZM2A 4R1GA 4WMCA 4QB8A 4RX3A 1SDEA 1HD8A 4S2KA 4BQMA 3LO7A 3HBRA 3PAGA 4PM5A 1GHMA 1YLTA 1DJAA 2XD1A 5F1FA 5DTSA 4DE3A 3NI9A 2WKEA 5G18A 5BOHA 4EWFA 4XUZA 1K4EA 2EX9A 1XGJA 5GHXA 1K56D 4ZTKA 1NY0A 3W8KA 2IWBA 4LV2A 1BUEA 2X01A 4C3QA 3W4PA 5I94A 5L2FA 1FOFA 1W8QA 3RXWA 3VOZA 2WAFA 2OV5A 4C6YA 1QMFA 4JLFA 1I2WA 3HVFA 4OOLA 4E3MA 3SH7A 4ZJ3A 4XXRA 3Q7VB 2EX2A 3HLFA 1VM1A 5E2GA 3SOIA 1DY6A 3ZG0A 4LV0A 1YLJA 3ZDJA 4KZ9A 5CHJA 3A3DA 5M19A 5FAQA 4UA7A 1HTZA 4X6TA 3Q7VA 3UE1A 1K57A 1K4FA 4UA9A 4GD8A 4QHCA 2J8YA 4JF6A 1M6KA 4GZBA 3ZG7B 2PU2A 3ZG5A 4U0TA 4EBLA 2Y2HA 2DCFA 3PBRA 3G32A 1ES3A 1PZPA 3MZDA 1BSGA 1BT5A 4CPKA 1L0FA 1O07A 4X56A 1EI5A 2B5RA 4ZJ1A 5CECA 5A91A 1MWTA 3E2LA 4S2MA 3AGEA 3ITBA 3TSGA 3WS2A 3MFDA 4JXWA 4DE0A 2EXBA 1NYYA 3VP1A 2H10A 3OPRA 1YMXA 3IXHA 4WZ4A 4R4SA 3IHAA 3O88A 1TDLA 3BFDA 2GDNA 3GV9A 2Z2MB 1NJ4A 3HUNA 5EPHA 3VFHA 4K0WA 1RGZA 2P9VB 4D2OA 4DDSA 3PBQA 2Y2GA 5KSHA 5EOEA 3Q07A 1FR6A 1YMSA 1YM1A 4N9KA 4OQIA 3GSGA 2EX8A 3MKEA 3PBTA 4EBNA 3S22A 4WEKA 3FYZA 4OQ0A 4KQOA 4OPQA 3IHBA 1K55A 5E2HA 2V2FF 2A49A 4B4XA 1PI4A 2I72A 4GB7A 1KE4A 4GNUA 1ZG4A 5DTKA 4JPMA 5FDHA 4BJPA 3IXDA 2H0TA 2WGVA 2J7VA 3NC8A 1H8ZA 3WS4A 4FH2A 2A3UA 4FD8A 3IH8A 3NIAA 4QJGA 5JYPA 1G68A 5KZHA 1N4OA 4S2PA 5EVLA 4KZ8A 3ZVWA 1KVLA 3VFFA 3VP0A 1YLPA 1HZOA 4HBUA 3M2KA 3SH9A 5DF7A 2WGWB 5GL9A 4PPRA 4JBFA 2ZQ9A 4B88A 3HLEA 4MBFA 3MBZA 3O3VA 1KGEA 2X02A 4MBKA 1BTLA 3G30A 3NDEA 5TR7A 4JF5A 4B4ZA 1G6AA 1Q2PA 3N8RA 2Y2QA 1NZUA 5A92A 3M6HA 4KG2A 1JWVA 2XD5A 3P09A 3MZFA 5FASA 4OPRA 2HP9A 1CEFA 4S2IA 4R3JA 1E3UD 5F83A 2WK0A 4M3KA 3EQVA 1PWCA 1NXYA 2ZQ7A 3G2ZA 4NETA 1CI8A 2XEPA 2G2UA 3OPPA 4FCFA 3UN7A 1NRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UE3 A;  4LCM A;  2XFS A;  1CI9 A;  2ZQ8 A;  4KZ7 A;  5DF8 A;  3V3S A;  3NCK A;  1PIO A;  1TEM A;  3GR2 A;  5U47 A;  3V5M A;  4CJN A;  1MWR A;  3G31 A;  5GLB A;  1FQG A;  1QME A;  2P9V A;  3GQZ A;  2WUQ A;  4GKU A;  3VP3 A;  1GHI A;  1LI0 A;  3GTC A;  2XDM A;  1DJB A;  5GHY A;  4KG5 A;  1MBL A;  3VSL A;  1GHP A;  1FR1 A;  4BL2 A;  4EQI A;  5A93 A;  3BLS A;  2FFF B;  4OLD A;  2OLU A;  5CHU A;  1ES2 A;  4P0M A;  4E3N A;  5DTT A;  3C7V A;  2JE5 A;  3HLD A;  1GCE A;  3N7W A;  2G2W A;  2IWC A;  3N8L A;  1IYQ A;  1KE3 A;  1O7E A;  2ZLY A;  3SS3 A;  1KDW A;  2VGK A;  2VGJ A;  4U3T A;  2EFX A;  3IXB A;  4BEN A;  4C75 A;  3Q82 A;  2XR0 A;  1IEM A;  4ID4 A;  5EUA A;  5EVI A;  1ZC2 A;  4JXV A;  4KZ5 A;  3UPP A;  3ZG9 B;  1YLZ A;  4IVK A;  4QD4 A;  5D3O A;  4BD0 A;  3ISG A;  1YQS A;  4RX2 A;  3HLG A;  3MKF A;  1KVM A;  3UE0 A;  4LEN A;  4OH0 A;  1YT4 A;  1K38 A;  3RJU A;  3BYD A;  1RCJ A;  1RGY A;  3G34 A;  4N92 A;  4OQG A;  1VQQ A;  2Y4A A;  5GLD A;  1CEG A;  2PBY A;  4LCL A;  2H5S A;  5CRF A;  1I5Q A;  3ZFZ A;  1XA7 A;  2X71 A;  4BLM A;  3CMZ A;  4IVI A;  4RA7 A;  5EVI D;  1PW1 A;  1Y54 A;  4HBT A;  3FWL A;  5F1G A;  2ZM0 A;  3M2J A;  4WMC D;  3ZHH A;  4EUZ A;  2RL3 A;  5KMW A;  3BEB A;  5AQ9 A;  2WGW A;  4QY5 A;  3ZGA B;  4RYE A;  1SDN A;  3SS4 A;  1N9B A;  3RXX A;  4GDB A;  1IYP A;  4OOY A;  5FAP A;  3WRT A;  5J8X A;  4FH4 A;  3WRZ A;  3UO9 A;  5FQM A;  1PI5 A;  3DWZ A;  3PTE A;  4E3O A;  1LL9 A;  1K6R A;  3ZVT A;  2ZC5 B;  4IBX A;  5E2E A;  3IF6 A;  1Z6F A;  2RCX A;  1YLW A;  4OPY A;  5AQ7 A;  1IYS A;  2C6W B;  2HDQ A;  3AGF A;  2FFY A;  3PAE A;  3Q7Z A;  3DWK A;  4ZBE A;  2JCH A;  1K57 C;  4LV1 A;  1MWS A;  3Q1F A;  5CXW A;  1E3U A;  4OP8 A;  3VSK A;  2ZC4 B;  4PM6 A;  2J9O A;  4PMA A;  2ZC3 B;  5GHZ A;  1K25 A;  4F94 A;  4L0L A;  1GA9 A;  1IEL A;  1K55 C;  4KG6 A;  1XP4 A;  5HAP A;  2DNS A;  3A3J A;  2WAD A;  3GMW A;  2HPB A;  3IXG A;  4MNR A;  1ESI A;  1FSW A;  1XXM A;  2WZZ A;  2ZQA A;  2Y2N A;  2H0Y A;  1FCN A;  3LEZ A;  2OSU A;  4GOG A;  1PYY A;  4X53 A;  4DKI A;  3IWI A;  1MPL A;  5CER A;  3S4X A;  2JC7 A;  2BG1 A;  2R9X A;  3M6B A;  3I7J A;  5M18 A;  3BRM A;  4S2N A;  3W4Q A;  4BL3 A;  1KE0 A;  3C7U A;  3W4O A;  3O86 A;  5KSC A;  4WZ5 A;  2ZQD A;  3OZH A;  1L0G A;  4DXC A;  1TVF A;  4HES A;  1XA1 A;  4H8R A;  2IWD A;  3B3X A;  3C4O A;  4N1H A;  1BLC A;  4XUX A;  5EVI C;  3GRJ A;  3DTM A;  4R4R A;  4Q8I A;  1SHV A;  5CTM A;  5FQI A;  5FI2 A;  4KZA A;  3N6I A;  5FQJ A;  5HAR A;  3OCL A;  3BM6 A;  3IF5 A;  4DF6 A;  1JTD A;  2ZC6 B;  4NK3 A;  3EQU A;  5FSR A;  1K56 A;  3CJM A;  3D4F A;  1JTG A;  2XFT A;  4DE1 A;  5EEC A;  4R3B A;  1KGG A;  4BD1 A;  2Y2L A;  5FQ9 A;  2JBF A;  2QZ6 A;  3UPN A;  3HUM A;  5TGF A;  1MY8 A;  4KQQ A;  3LCE A;  3G2Y A;  1GA0 A;  1W8Y A;  1PW8 A;  4KZ3 A;  4R0Q A;  5CTN A;  4UAA A;  1U60 A;  2HDR A;  2WKI A;  3QNB A;  4WEL A;  1YLY A;  4OLG A;  3WS0 A;  4Y0T A;  3VP2 A;  5DF9 A;  5M1A A;  5HL1 A;  3UDF A;  4RVA A;  4OQH A;  3GVB A;  3ITA A;  3LY4 A;  1BLP A;  2Q9M A;  1ESU A;  3FKV A;  1BUL A;  2XK1 A;  4E6W A;  2Y2I A;  4DE2 A;  1H8Y A;  1FSY A;  1TDG A;  3CZD A;  3IF6 C;  2EFU A;  5E2F A;  5HW3 A;  3S1Y A;  1OME A;  5CED A;  1NYM A;  2P74 A;  4IED A;  4PM8 A;  4PM9 A;  3V3R A;  4E3I A;  3BFG A;  3FV7 A;  5FAO A;  3UDI A;  2WYX A;  3FZC A;  3TOI A;  4GD6 A;  1IKG A;  1PWD A;  2XH9 A;  3FKW A;  3IWQ A;  3IF6 B;  3ZNT A;  4E3K A;  1SCW A;  4K0X A;  2EXA A;  3BFC A;  1EWZ A;  5GLA A;  4KZ6 A;  3WWX A;  1XX2 A;  3UNW A;  5JYO A;  3C5A A;  1AXB A;  4WEJ A;  5FI7 A;  1J9M A;  1SKF A;  2OLV A;  4OPZ A;  3OCN A;  1LL5 A;  1H5X A;  3MXR A;  5AQA A;  3UDX A;  4U0X A;  1L0E A;  3G4P A;  4LV3 A;  1WYC A;  3IQA A;  1ONG A;  4KZ4 A;  4QY6 A;  4DXB A;  3CG5 A;  3BEC A;  1K6S A;  5FI6 A;  5FQK A;  5EOO A;  3PBO A;  3VP4 A;  1E25 A;  3OPH A;  1XKZ A;  2V20 A;  3A3F A;  4X69 A;  1XPB A;  3O87 A;  4N9L A;  4E3J A;  2ZQC A;  4ZAM A;  1MKI A;  1K54 C;  4E3L A;  2Y91 A;  1KGF A;  1FCO A;  2Y2J A;  5HFO A;  4EBP A;  5CHM A;  2UWX A;  3QHY A;  2ZMA A;  3VMA A;  5E43 A;  4UHU A;  2HP5 A;  2R9W A;  1S0W A;  1L2S A;  3C4P A;  3HL9 A;  1BLS A;  2Y2K A;  3VOY A;  3HLC A;  1L0D A;  4JXS A;  5EVI B;  5HAQ A;  2QPN A;  4X55 A;  3A3E A;  5CEB A;  1HVB A;  5CGW A;  2DRW A;  4OKP A;  1K54 A;  1MXO A;  3HRE A;  4S2J A;  4OON A;  1M40 A;  1I2S A;  2ZC7 A;  2BLS A;  5HAI A;  2QMI A;  5F82 A;  2E8I A;  4OP5 A;  4GDN A;  3MZE A;  2HDU A;  4YFM A;  3AGD A;  4FSF A;  3OPL A;  1LI9 A;  3P98 A;  4DDY A;  2ZD8 A;  3PBS A;  3N4I A;  3LY3 A;  5CGS A;  2WAE A;  4OVD A;  1W5D A;  2XLN A;  1JVJ A;  1PZO A;  4KZB A;  3UY6 A;  3IWO A;  3DW0 A;  3ZG8 B;  3PBN A;  3BLM A;  4E6X A;  5DVA A;  2HP6 A;  1PWG A;  3TG9 A;  2Z2L B;  4WYY A;  4S2N C;  1LHY A;  2WZX A;  3IT9 A;  2WKH A;  4JXG A;  1CK3 A;  4JKT A;  2XF3 A;  3HUO A;  4GN2 A;  4WM9 A;  2V1Z A;  4P6B A;  2HDS A;  4ZDX A;  4WBG A;  3UPO A;  3HLW A;  3WS1 A;  5GLC A;  2Y59 A;  4A5R A;  1WE4 A;  4EV4 A;  3BFF A;  4UA6 A;  5EE8 A;  4Z9Q A;  1BLH A;  2J9P A;  1S6R A;  3BFE A;  1W7F A;  2XGN A;  2WGI A;  4IBR A;  5CGX A;  3ZCZ A;  1DJC A;  4Y7P A;  4DRT A;  4PM7 A;  4KQR A;  3NY4 A;  4X68 A;  4WZ5 C;  1FCM A;  2C5W B;  3E2K A;  3IH9 A;  2Y55 A;  3WS5 A;  1XGI A;  1ERM A;  1E4D A;  2PU4 A;  2ZM8 A;  1RP5 A;  3G35 A;  2CC1 A;  1KDS A;  1JWZ A;  1IKI A;  2ZJ9 A;  3A3I A;  2XQZ A;  4MLL A;  5AQB A;  1WYB A;  4S2L A;  5FA7 A;  4P87 A;  4YIN A;  1BZA A;  4ZJ2 A;  4QU3 A;  1NZO A;  4K91 A;  3N8S A;  1ONH A;  4KEN B;  5TFQ A;  3NBL A;  5A90 A;  1ES4 A;  4MEZ A;  4HEF A;  3SS5 A;  2Q9N A;  1ERO A;  2Y2P A;  4OOM A;  1MWU A;  3V50 A;  1IYO A;  1JWP A;  1ERQ A;  3MXS A;  4R23 A;  4S2O A;  3Q81 A;  5HX9 A;  1ZKJ A;  4Y0U A;  1W79 A;  4MBH A;  1Q2Q A;  1ES5 A;  3V39 A;  2Y2M A;  4Y0O A;  1LLB A;  5FAT A;  5FQQ A;  5IHV A;  1C3B A;  3OC2 A;  3ZNY A;  3SH8 A;  1ALQ A;  1ZG6 A;  2Y2O A;  4P85 A;  2EX6 A;  3QNC A;  3NDG A;  4N1X A;  3HLB A;  3JYI A;  4JF4 A;  4O7D A;  2ZM2 A;  4R1G A;  4WMC A;  4QB8 A;  4RX3 A;  1SDE A;  1HD8 A;  4S2K A;  4BQM A;  3LO7 A;  3HBR A;  3PAG A;  4PM5 A;  1GHM A;  1YLT A;  1DJA A;  2XD1 A;  5F1F A;  5DTS A;  4DE3 A;  3NI9 A;  2WKE A;  5G18 A;  5BOH A;  4EWF A;  4XUZ A;  1K4E A;  2EX9 A;  1XGJ A;  5GHX A;  1K56 D;  4ZTK A;  1NY0 A;  3W8K A;  2IWB A;  4LV2 A;  1BUE A;  2X01 A;  4C3Q A;  3W4P A;  5I94 A;  5L2F A;  1FOF A;  1W8Q A;  3RXW A;  3VOZ A;  2WAF A;  2OV5 A;  4C6Y A;  1QMF A;  4JLF A;  1I2W A;  3HVF A;  4OOL A;  4E3M A;  3SH7 A;  4ZJ3 A;  4XXR A;  3Q7V B;  2EX2 A;  3HLF A;  1VM1 A;  5E2G A;  3SOI A;  1DY6 A;  3ZG0 A;  4LV0 A;  1YLJ A;  3ZDJ A;  4KZ9 A;  5CHJ A;  3A3D A;  5M19 A;  5FAQ A;  4UA7 A;  1HTZ A;  4X6T A;  3Q7V A;  3UE1 A;  1K57 A;  1K4F A;  4UA9 A;  4GD8 A;  4QHC A;  2J8Y A;  4JF6 A;  1M6K A;  4GZB A;  3ZG7 B;  2PU2 A;  3ZG5 A;  4U0T A;  4EBL A;  2Y2H A;  2DCF A;  3PBR A;  3G32 A;  1ES3 A;  1PZP A;  3MZD A;  1BSG A;  1BT5 A;  4CPK A;  1L0F A;  1O07 A;  4X56 A;  1EI5 A;  2B5R A;  4ZJ1 A;  5CEC A;  5A91 A;  1MWT A;  3E2L A;  4S2M A;  3AGE A;  3ITB A;  3TSG A;  3WS2 A;  3MFD A;  4JXW A;  4DE0 A;  2EXB A;  1NYY A;  3VP1 A;  2H10 A;  3OPR A;  1YMX A;  3IXH A;  4WZ4 A;  4R4S A;  3IHA A;  3O88 A;  1TDL A;  3BFD A;  2GDN A;  3GV9 A;  2Z2M B;  1NJ4 A;  3HUN A;  5EPH A;  3VFH A;  4K0W A;  1RGZ A;  2P9V B;  4D2O A;  4DDS A;  3PBQ A;  2Y2G A;  5KSH A;  5EOE A;  3Q07 A;  1FR6 A;  1YMS A;  1YM1 A;  4N9K A;  4OQI A;  3GSG A;  2EX8 A;  3MKE A;  3PBT A;  4EBN A;  3S22 A;  4WEK A;  3FYZ A;  4OQ0 A;  4KQO A;  4OPQ A;  3IHB A;  1K55 A;  5E2H A;  2V2F F;  2A49 A;  4B4X A;  1PI4 A;  2I72 A;  4GB7 A;  1KE4 A;  4GNU A;  1ZG4 A;  5DTK A;  4JPM A;  5FDH A;  4BJP A;  3IXD A;  2H0T A;  2WGV A;  2J7V A;  3NC8 A;  1H8Z A;  3WS4 A;  4FH2 A;  2A3U A;  4FD8 A;  3IH8 A;  3NIA A;  4QJG A;  5JYP A;  1G68 A;  5KZH A;  1N4O A;  4S2P A;  5EVL A;  4KZ8 A;  3ZVW A;  1KVL A;  3VFF A;  3VP0 A;  1YLP A;  1HZO A;  4HBU A;  3M2K A;  3SH9 A;  5DF7 A;  2WGW B;  5GL9 A;  4PPR A;  4JBF A;  2ZQ9 A;  4B88 A;  3HLE A;  4MBF A;  3MBZ A;  3O3V A;  1KGE A;  2X02 A;  4MBK A;  1BTL A;  3G30 A;  3NDE A;  5TR7 A;  4JF5 A;  4B4Z A;  1G6A A;  1Q2P A;  3N8R A;  2Y2Q A;  1NZU A;  5A92 A;  3M6H A;  4KG2 A;  1JWV A;  2XD5 A;  3P09 A;  3MZF A;  5FAS A;  4OPR A;  2HP9 A;  1CEF A;  4S2I A;  4R3J A;  1E3U D;  5F83 A;  2WK0 A;  4M3K A;  3EQV A;  1PWC A;  1NXY A;  2ZQ7 A;  3G2Z A;  4NET A;  1CI8 A;  2XEP A;  2G2U A;  3OPP A;  4FCF A;  3UN7 A;  1NRF A; 
#chains in the Genus database with same CATH topology
 5DJT A;  2XFS A;  2AVX A;  4R3A A;  3C2W A;  2L0W A;  2HZ5 A;  3NCK A;  1TEM A;  3V5M A;  1H8M A;  4GKU A;  4XT2 B;  1GHI A;  1LI0 A;  1GHP A;  1FR1 A;  2QYB A;  2J3T C;  3BLS A;  4LPZ A;  1XJ3 A;  5DTT A;  3ULF A;  3HLD A;  2IWC A;  1O7E A;  4JGQ A;  1KDW A;  2VGJ A;  3E4Q A;  2EFX A;  3BWL A;  2NUT C;  1S1Y A;  4C75 A;  5EM0 A;  1IEM A;  5EUA A;  5EVI A;  1ZC2 A;  4KZ5 A;  3UPP A;  5MC7 A;  3QP1 A;  3ISG A;  3MKF A;  4OH0 A;  1YT4 A;  5FL3 A;  3BYD A;  3G34 A;  5GLD A;  5CRF A;  3MFX A;  4IVI A;  4RA7 A;  4CLC B;  3BW6 A;  4HBT A;  3M2J A;  4LRX C;  1T1A A;  3ZHH A;  3T4L A;  4Y17 A;  4MMN A;  2B02 A;  4FH4 A;  3VE4 A;  2ZL1 A;  3G6O A;  1Z6F A;  3PAE A;  3DWK A;  2JCH A;  1K57 C;  4L9G A;  1D7E A;  4PM6 A;  4PMA A;  4DN0 A;  1YSP A;  5AVF A;  4I3J A;  5F5Y A;  3GMW A;  2HPB A;  3IXG A;  3UB8 A;  4D60 A;  1XXM A;  2Y2N A;  2JC7 A;  3I7J A;  4BBV A;  4II7 A;  3O86 A;  3OZH A;  2MJ6 A;  4BMW A;  4DXC A;  1YAX A;  4H8R A;  3CWF A;  4N1H A;  5HDD A;  2VK3 A;  5FQI A;  4KZA A;  5FQJ A;  5HAR A;  1ZHH B;  3BM6 A;  4DF6 A;  4NK3 A;  5FSR A;  3D4F A;  2XFT A;  1KGG A;  3PHY A;  2Y2L A;  5FQ9 A;  1Y28 A;  2JKG A;  3HUM A;  4KQQ A;  3E98 A;  3LCE A;  1KOU A;  5CTN A;  1U60 A;  2WKI A;  3QNB A;  4WEL A;  3VV4 A;  3KSG A;  1NLZ A;  4Y0T A;  3VP2 A;  3UDF A;  4OQH A;  4GLQ A;  1ESU A;  4H6J A;  1XFQ A;  2OAP 1;  1AWI A;  4BWI A;  2EFU A;  4JGO A;  5HW3 A;  2V0U A;  2D02 A;  4PM8 A;  4E3I A;  4NEE D;  2H28 A;  3UDI A;  3TOI A;  4GD6 A;  3IBR A;  1IKG A;  1PWD A;  3BY9 A;  1CQA A;  2D01 A;  3IF6 B;  3ZNT A;  3PR6 A;  1ODV A;  5GLA A;  1XX2 A;  5JYO A;  1ACF A;  1AXB A;  3MXR A;  3UDX A;  4IUK A;  1WYC A;  4QY6 A;  4DXB A;  5FI6 A;  2GNX A;  4F3L A;  3A3F A;  1XPB A;  4N9L A;  2KOI A;  4EBP A;  5CHM A;  5E43 A;  3HL9 A;  1L2S A;  3C4P A;  4CLC E;  5EVI B;  5CEB A;  1HVB A;  3CLO A;  5CGW A;  4OON A;  1M40 A;  1I2S A;  3EEH A;  2QMI A;  1LI9 A;  2HV1 A;  3N4I A;  2W3E A;  1W5D A;  1JVJ A;  3RFB A;  3DW0 A;  4CLC A;  5DVA A;  1VHM A;  4WYY A;  4JKT A;  3UPO A;  3NOP C;  1FIL A;  5EE8 A;  4QWO A;  2W27 A;  2V8C A;  1DJC A;  2PBD P;  5L10 A;  4Y7P A;  4PM7 A;  4KQR A;  5HWW A;  1XGI A;  4FUW A;  4MLL A;  4MCW A;  5FA7 A;  1OT6 A;  4QU3 A;  3N8S A;  3NBL A;  1ES4 A;  4HEF A;  2Q9N A;  3BQA A;  3V50 A;  3EGD C;  1IYO A;  2P08 A;  4Y5F A;  4S2O A;  3Q81 A;  4GS9 B;  4X25 A;  3F1P A;  3KYZ A;  5TJJ A;  3R7W A;  2O0Y A;  1ES5 A;  3V39 A;  2PYP A;  1LLB A;  5FQQ A;  3SH8 A;  3JVV A;  4WMC A;  3KO6 A;  2W0N A;  4JF4 A;  3NJA A;  1TD5 A;  2XD1 A;  3NI9 A;  1V9Y A;  4Y13 A;  5BOH A;  1YPR A;  3U2A A;  1MC0 A;  1BUE A;  5I94 A;  1FOF A;  1W8Q A;  3RXW A;  4BBT A;  2WAF A;  1QMF A;  4OOL A;  4MDZ A;  2WKQ A;  3Q7V B;  1Y4O A;  3HLF A;  4L9E A;  1JNU A;  4LGW A;  1YLJ A;  5CHJ A;  3MQQ A;  4X6T A;  2G7U A;  2QJ5 A;  2K7S A;  4JF6 A;  1M6K A;  4ETX A;  2DCF A;  2ZMV A;  3F1N A;  4ZJ1 A;  4S2M A;  4DE0 A;  3MFD A;  2EXB A;  2R78 A;  2VV7 A;  2PRF A;  3BFD A;  1VEU A;  5HDS A;  4EQ1 A;  1S66 L;  2GJ3 A;  5EOE A;  3Q07 A;  1YMS A;  1YM1 A;  4N9K A;  3FPV A;  3IS2 B;  1EW0 A;  2V2F F;  2I72 A;  5HPF A;  5FDH A;  1ZG4 A;  4GHI A;  3C30 A;  2H0T A;  4FD8 A;  3CIT A;  5EVL A;  5L07 A;  3IS2 A;  2EWW A;  3EOI A;  3VFF A;  1YLP A;  2WGW B;  3MBZ A;  1KGE A;  1OPX A;  4MBK A;  3MJQ A;  4JF5 A;  3LYX A;  1Q2P A;  3N8R A;  1NZU A;  3MZF A;  5FAS A;  1CEF A;  5F83 A;  4EER A;  2ZQ7 A;  1CI8 A;  3T4S A;  2G2U A;  1SKO A;  4FCF A;  1W63 M;  4LCM A;  3CPT A;  1CI9 A;  2ZQ8 A;  4KZ7 A;  3V3S A;  3NOT C;  3GR2 A;  3F1O B;  3G31 A;  1QME A;  2P9V A;  2WUQ A;  3H7W B;  3TRC A;  1DJB A;  3QP2 A;  4BL2 A;  1DP6 A;  1H3Q A;  4LFU A;  4OLD A;  3H7W A;  1ES2 A;  4XT2 A;  2DMW A;  3C7V A;  2JE5 A;  3SS3 A;  2G2W A;  1IYQ A;  3TE8 A;  2PD7 A;  4JXV A;  3LFV A;  1VB6 A;  2W3F A;  4RX2 A;  3FG8 A;  1LSW A;  2GX5 A;  4LEN A;  3QP4 A;  2W1T B;  4OQG A;  1VQQ A;  1CEG A;  2X71 A;  3CMZ A;  1XJ2 A;  5EVI D;  3FWL A;  4WMC D;  2RL3 A;  5AQ9 A;  4QY5 A;  2VZW A;  3K3C A;  4RYE A;  4JGR A;  1N9B A;  4GDB A;  3WRT A;  4OOY A;  2A24 A;  2P7J A;  3UO9 A;  3TJZ C;  1LL9 A;  1K6R A;  5E2E A;  3QP6 A;  2VGL M;  5AQ7 A;  2C6W B;  2HDQ A;  3Q1F A;  5CXW A;  5G4Y A;  4OP8 A;  2ZC4 B;  1IEL A;  1XP4 A;  4P6Z M;  3D72 A;  2WAD A;  4MNR A;  1ESI A;  1FSW A;  4OPR A;  2ZQA A;  4NXB A;  4GOG A;  3U4L P;  2OSU A;  4DKI A;  5CER A;  2BG1 A;  1OJ5 A;  2FH5 A;  4EEU A;  2OWJ A;  4S2N A;  3W4Q A;  1KE0 A;  5KSC A;  2JKT I;  2B95 A;  1XA1 A;  2IWD A;  2JKR I;  2V1A A;  1BLC A;  3GRJ A;  4Q8I A;  5CTM A;  3NOU C;  1JTD A;  3CJM A;  3E0Y A;  1XJ4 A;  4BD1 A;  2QKP A;  5HPI A;  2QZ6 A;  1SZV A;  4O0P A;  3UPN A;  5TGF A;  1GA0 A;  2HDR A;  2CMN A;  1TS0 A;  4OLG A;  3B47 A;  4MN5 A;  5M1A A;  3ITA A;  2JKT M;  3LY4 A;  2Q9M A;  3T1X A;  1BUL A;  1G5U A;  4E6W A;  1FSY A;  4IED A;  3V3R A;  3BFG A;  3T50 A;  3CHW P;  5FAO A;  2WYX A;  3O5Y A;  2Y8H A;  2K2N A;  3IWQ A;  4E3K A;  3S7N A;  3WWX A;  3C5A A;  2WKR A;  2XRO A;  1J9M A;  3T4Q A;  2OLV A;  4U0X A;  4LV3 A;  5TBM A;  3CG5 A;  5FQK A;  3VP4 A;  1S4R A;  1E25 A;  4X69 A;  3O87 A;  2Q0O A;  2Y91 A;  4HP4 A;  2UWX A;  2ZMA A;  1OJG A;  3VMA A;  4NXG A;  4UHU A;  2Y2K A;  1P0Z A;  4PAU A;  4JXS A;  5HAQ A;  2QPN A;  3A3E A;  1VET B;  5K5B A;  3HRE A;  5KIZ A;  5F82 A;  5CX7 A;  2HDU A;  4YFM A;  2ZD8 A;  2V9A A;  3LY3 A;  2WAE A;  5AVE A;  3IWO A;  2KX6 A;  4E6X A;  2HP6 A;  5DKL A;  1D06 A;  1LHY A;  3IT9 A;  4NXF A;  2WKH A;  3DTI A;  4GN2 A;  4ZDX A;  4WBG A;  1S4S A;  3WS1 A;  3LI9 A;  4Z9Q A;  1BLH A;  2J9P A;  3BFE A;  2XGN A;  4IBR A;  3ZCZ A;  3NY4 A;  4X68 A;  3E2K A;  3GDI A;  2PU4 A;  3DTK A;  2W1R A;  5EVE A;  1UGU A;  2CC1 A;  1KDS A;  5AQB A;  3A3I A;  5I5L A;  1WYB A;  4S2L A;  4YIN A;  4EUV A;  1ONH A;  5TFQ A;  5A90 A;  4MEZ A;  3SS5 A;  1Z09 A;  1PRQ A;  2Y2P A;  3FC7 A;  4R23 A;  5HX9 A;  1ZKJ A;  3IX3 A;  4UEY A;  3SZT A;  5IHV A;  1C3B A;  1ALQ A;  4HI4 A;  2Y2O A;  2YKF A;  3UNW A;  1N9N A;  3HLB A;  1H0M A;  4QB8 A;  1SDE A;  1HD8 A;  4HQA A;  3LO7 A;  4PM5 A;  1YLT A;  5F1F A;  3KYQ A;  3MQO A;  5G18 A;  1OTD A;  4XUZ A;  4Q0J A;  2O9B A;  1K56 D;  4ZTK A;  4UQI M;  2IWB A;  4UQI S;  2OV5 A;  4C6Y A;  4JLF A;  1NRF A;  1MKM A;  3SH7 A;  3A0S A;  4XXR A;  2EX2 A;  5E2G A;  1G28 A;  1DY6 A;  3ZG0 A;  4KZ9 A;  3QP8 A;  4Y3I A;  5FAQ A;  4UA7 A;  3T4O A;  3Q7V A;  3ZG7 B;  4ME4 A;  1XFN A;  5HWT A;  4X1M A;  4ZRR A;  1CF0 A;  1ES3 A;  1PZP A;  3MZD A;  3AGE A;  3ITB A;  1NYY A;  3VP1 A;  2H10 A;  1YMX A;  4ETZ A;  4Q0I A;  3IX8 A;  1TDL A;  2GDN A;  3GV9 A;  4HNB A;  2Z2M B;  3PYP A;  1NJ4 A;  5EPH A;  4DDS A;  2HF6 A;  2KLI A;  5HWV A;  5FDS A;  3PBT A;  4EBN A;  1VEU B;  2HGV A;  4OQ0 A;  2ZOH A;  5J7E A;  3IHB A;  1YKD A;  3PXP A;  4BJP A;  1OT9 A;  2J7V A;  3WS4 A;  4GW9 A;  4FH2 A;  4KUO A;  3IH8 A;  4QJG A;  1T1C A;  1G68 A;  5KZH A;  1N4O A;  4S2P A;  4KZ8 A;  1KVL A;  3VP0 A;  4PPR A;  3QP5 A;  4PKY A;  4NXE A;  1PNE A;  2X02 A;  1IOU A;  5F69 A;  1V9Z A;  3G30 A;  5HL6 A;  4R6L A;  3LR0 A;  1G6A A;  2A24 B;  4B4Z A;  4RQ9 A;  5L8M A;  2HP9 A;  3S7P A;  2WK0 A;  4HIA A;  4JGP A;  4M3K A;  3EQV A;  1PWC A;  2VKS A;  3G2Z A;  4ARZ A;  2XEP A;  2OWH A;  3BJN A;  3UE3 A;  1HLU P;  3B33 A;  1PIO A;  4CJN A;  5GLB A;  3GQZ A;  1OTI A;  5HD3 A;  2W3D A;  3H9W A;  2K31 A;  4GCZ A;  3GTC A;  2XDM A;  5GHY A;  4KG5 A;  1MBL A;  1OTA A;  3VSL A;  4R70 A;  3OBF A;  3EWK A;  4EQI A;  5A93 A;  2ACG A;  2FFF B;  2OLU A;  4AFI A;  2PDR A;  4P0M A;  2IA2 A;  1GCE A;  2L1M A;  3N7W A;  1KE3 A;  2VGK A;  4U3T A;  3RTY A;  3IXB A;  3T4K A;  4ID4 A;  3H82 A;  3T12 B;  1YLZ A;  5F68 A;  4HJ6 A;  1KVM A;  3UE0 A;  3DAV A;  2B18 A;  3RJU A;  1PFL A;  2M1C A;  1RGY A;  2Y4A A;  1F2K A;  2H5S A;  3ZFZ A;  1Y54 A;  3MS6 A;  1YSQ A;  4EUZ A;  3BEB A;  3HJK A;  1P9R A;  3C8C A;  5FAP A;  1IYP A;  4E3O A;  3IF6 A;  2RCX A;  4OPY A;  3B42 A;  2FFY A;  4LV1 A;  4HP9 A;  4EW7 A;  1E3U A;  3VSK A;  2ZBB A;  2J9O A;  1K25 A;  3VE3 A;  4L0L A;  1K55 C;  4KG6 A;  5HAP A;  2JHE A;  2DNS A;  3A3J A;  3CAX A;  2H0Y A;  1PYY A;  3S4X A;  1MPL A;  4LRY C;  4BL3 A;  3LIE A;  3C7U A;  3NUL A;  3R4K A;  2ZQD A;  1L0G A;  4HES A;  2VV6 A;  3B3X A;  3C4O A;  3CI6 A;  4EES A;  4XUX A;  5EVI C;  4R4R A;  1SHV A;  5FI2 A;  3IF5 A;  1UWN X;  3EEA A;  4DE1 A;  5EEC A;  4R3B A;  2JBF A;  3DTE A;  3HJI A;  1MY8 A;  5EM1 A;  3G2Y A;  1P97 A;  1W8Y A;  1PW8 A;  1YLY A;  1F98 A;  3WS0 A;  1WA9 A;  5DF9 A;  3SW1 A;  4EET B;  3E4P A;  5HL1 A;  4WN5 A;  1BLP A;  2Y2I A;  3JVU A;  3IF6 C;  1TDG A;  3UME A;  1OME A;  1NYM A;  2P74 A;  2Z6C A;  3LUQ A;  4MN7 A;  2OAQ 1;  4FTX A;  2ZL1 B;  2V0W A;  4O8G A;  3FKW A;  3KX0 X;  5DFX A;  4CLC C;  2W3G A;  4K0X A;  2EXA A;  3BFC A;  1EWZ A;  2PHY A;  3D9Y A;  5FI7 A;  4LLO B;  5HD5 A;  1SKF A;  3OCN A;  1LL5 A;  4X1L A;  1H5X A;  5AJG A;  1L0E A;  3BQ8 A;  3IQA A;  4GS9 A;  1ONG A;  4YNR A;  4P6Z S;  3BEC A;  3S7Q A;  3OLO A;  3MXQ A;  3OPH A;  1XKZ A;  3T4T A;  2FZ0 A;  4ZAM A;  4IUH A;  1K54 C;  3TW8 A;  1D1J A;  2M7V A;  3QHY A;  2R9W A;  3KSI A;  1S0W A;  1GSV A;  1L0D A;  2J80 A;  2PR6 A;  2DRW A;  4OKP A;  1MXO A;  2ZC7 A;  4OP5 A;  4GDN A;  3MZE A;  3AGD A;  4FSF A;  3PBS A;  4OVD A;  2XLN A;  3UB7 A;  1PZO A;  2JKF A;  1LL8 A;  3PBN A;  1PWG A;  2Z2L B;  4S2N C;  2XA7 M;  4JXG A;  1CK3 A;  2XF3 A;  3HUO A;  4WM9 A;  4P6B A;  2HDS A;  2Y59 A;  4A5R A;  5FEG A;  1WE4 A;  4EV4 A;  4UA6 A;  4HOI A;  4H6J B;  3NHQ A;  2WGI A;  5CGX A;  3IBJ A;  4WZ5 C;  5TBM B;  1FCM A;  3MF0 A;  3IH9 A;  3NEC A;  4HY8 A;  1ERM A;  1E4D A;  4DMZ A;  3G35 A;  4KUK A;  1JWZ A;  3T1R A;  1NZO A;  4Q0H A;  1CJF A;  3MSH A;  1G6O A;  1ERO A;  4OOM A;  1MWU A;  2QHK A;  1JWP A;  2ZOI A;  3P7N A;  2HJE A;  4NKP A;  4Y0U A;  1W79 A;  1X0O A;  4MBH A;  3EGX C;  4IHQ A;  3P01 A;  3ZNY A;  1NLY A;  1MZU A;  3QNC A;  4N1X A;  4R1G A;  4O7D A;  1TS6 A;  4RX3 A;  2L4R A;  3PAG A;  1DJA A;  4DE3 A;  4G3V A;  2WKE A;  4EWF A;  1K4E A;  3UMD A;  3W8K A;  4LV2 A;  5L2F A;  3W4P A;  3T1Q B;  1I2W A;  4E3M A;  5FEF A;  5G4Z A;  3ZDJ A;  3A3D A;  1OTE A;  5M19 A;  2J3W A;  3W2Z A;  1HTZ A;  1K57 A;  5L09 A;  4UA9 A;  1DP8 A;  2J8Y A;  5EFW A;  2PU2 A;  2BTF P;  4U0T A;  5HSQ A;  2Z6D A;  4R38 A;  2NUP C;  3PBR A;  1T18 A;  3G32 A;  2EWV A;  1F9I A;  4CPK A;  4X56 A;  1EI5 A;  5CEC A;  3E2L A;  3TSG A;  4JXW A;  4KQD A;  4R4S A;  3IHA A;  5DJU A;  2PR5 A;  3KYE A;  4E04 A;  1RGZ A;  3PBQ A;  4Y15 A;  5KSH A;  4O01 A;  1FR6 A;  4OQI A;  3GSG A;  2EX8 A;  3MKE A;  5J3W A;  4OPQ A;  4KQO A;  1K55 A;  2A49 A;  1PI4 A;  2HJ9 C;  2WKP A;  1H8Z A;  4EXO A;  5DFY A;  2A3U A;  1VET A;  2JKR M;  4I3A A;  1LSX A;  1S1Z A;  4HBU A;  3M2K A;  5DF7 A;  2QJ7 A;  2ZQ9 A;  3LID A;  3O3V A;  2I9V A;  5C5K A;  3MQ0 A;  5TR7 A;  1TS7 A;  2W1T A;  5A92 A;  3M6H A;  3F1N B;  2Y79 A;  1T1B A;  1E3U D;  3E4O A;  4PKY G;  4G3W A;  1A0K A;  3OPP A;  2VLG A;  5DF8 A;  4Y2F A;  5U47 A;  1MWR A;  3V67 A;  1FQG A;  3VP3 A;  4QPR A;  2M7U A;  1DP9 A;  5IS1 A;  5CHU A;  4E3N A;  3GEC A;  3N8L A;  2P04 A;  2ZLY A;  2VV8 A;  4BEN A;  3Q82 A;  2XR0 A;  4GJ4 A;  4MN6 A;  3ZG9 B;  2EA9 A;  1IFQ A;  4IVK A;  4QD4 A;  3MMH A;  5D3O A;  4BD0 A;  1YQS A;  3HLG A;  1XJ6 A;  1K38 A;  1DRM A;  4EU0 A;  3H82 B;  1RCJ A;  4N92 A;  4BBU A;  2PBY A;  4LCL A;  1I5Q A;  1XA7 A;  4BLM A;  2ZMF A;  1PW1 A;  3VOL A;  5F1G A;  2ZM0 A;  2O9C A;  3MR0 A;  1SKO B;  2PYR A;  5KMW A;  2WGW A;  3ZGA B;  1SDN A;  3SS4 A;  3RXX A;  1UWP X;  5J8X A;  3WRZ A;  5J4E A;  5FQM A;  1PI5 A;  3DWZ A;  3PTE A;  3ZVT A;  4YWZ A;  2BAS A;  2ZC5 B;  4IBX A;  4IJG A;  1YLW A;  1IYS A;  3AGF A;  5DKK A;  3Q7Z A;  4ZBE A;  1MWS A;  3BY8 A;  2VEA A;  2PAV P;  2V1B A;  5GHZ A;  2ZC3 B;  1S67 L;  4F94 A;  1GA9 A;  3FPW A;  1N9L A;  2WZZ A;  3UE6 A;  3LEZ A;  1FCN A;  4X53 A;  4Z1W A;  1FIK A;  3IWI A;  1T19 A;  3ZQ5 A;  2R9X A;  3M6B A;  5M18 A;  3BRM A;  4K08 A;  4HH2 A;  3W4O A;  3LI8 A;  4WZ5 A;  1N9O A;  1STZ A;  1TVF A;  1L3L A;  3K3D A;  3DTM A;  2A2L A;  3N6I A;  2YKH A;  3CUE A;  3OCL A;  2ZC6 B;  3EQU A;  4F3L B;  1K56 A;  1JTG A;  4G3K A;  3HCY A;  2O9A A;  3A0R A;  4HH3 A;  4KZ3 A;  4R0Q A;  2PT7 A;  4UAA A;  1GSW A;  4I39 A;  4RVA A;  1J3W A;  3GVB A;  3FKV A;  2XK1 A;  4CQH A;  4DE2 A;  1H8Y A;  5E2F A;  3CZD A;  3LR5 A;  3S1Y A;  5CED A;  4HJ3 A;  4PM9 A;  3C38 A;  3FV7 A;  3A0V A;  3D3O A;  3FZC A;  2XH9 A;  3LIB A;  4I5S A;  1SCW A;  2O99 A;  4KZ6 A;  4HHD A;  1TF1 A;  4WEJ A;  3LIA A;  4OPZ A;  5AQA A;  3G4P A;  3ZYT A;  4KZ4 A;  1K6S A;  5EOO A;  3PBO A;  3KSH A;  1NWZ A;  4WL9 A;  2V20 A;  3KSF A;  4E3J A;  2ZQC A;  1MKI A;  4FOF A;  4E3L A;  1KGF A;  1FCO A;  2Y2J A;  5HFO A;  3T4J A;  2XSS A;  4B9O A;  3IX4 A;  2HP5 A;  3VOY A;  1BLS A;  3LEQ A;  4GHI B;  3HLC A;  1F5M A;  4X55 A;  3LGO A;  2OOL A;  1K54 A;  4S2J A;  2VGL S;  2BLS A;  5HAI A;  2VX8 A;  2E8I A;  5EV0 A;  3OPL A;  4DJ3 A;  3P98 A;  4DDY A;  5CGS A;  4KZB A;  3UY6 A;  3ZG8 B;  3UB9 A;  3BLM A;  3TG9 A;  1BYW A;  3CUE C;  4CLC D;  2WZX A;  2LB9 A;  2GZA A;  2V1Z A;  3HLW A;  5GLC A;  1W63 Q;  2W3H A;  3BFF A;  1S6R A;  1W7F A;  4PHT A;  3RH8 B;  4DRT A;  2C5W B;  1TS8 A;  4LRZ E;  3WS5 A;  2Y55 A;  3OOV A;  4NG2 A;  1OTB A;  2ZM8 A;  4HJ4 A;  2J3T D;  1RP5 A;  1IKI A;  2ZJ9 A;  2XQZ A;  5HZH A;  4I3I A;  4P87 A;  4ZJ2 A;  1BZA A;  4K91 A;  3S7O A;  3F1P B;  4KEN B;  5F6A A;  3JPU A;  3R7W B;  2KDK A;  1ERQ A;  3MXS A;  3ICY A;  1Q2Q A;  4I38 A;  2Y2M A;  4Y0O A;  5FAT A;  3OC2 A;  1ZG6 A;  4P85 A;  2EX6 A;  3NDG A;  3JYI A;  2ZM2 A;  3T1S A;  4S2K A;  4BQM A;  3HBR A;  1GHM A;  5IT5 A;  5DTS A;  1ZTU A;  2EX9 A;  1XGJ A;  5GHX A;  3LIF A;  1NY0 A;  2X01 A;  4C3Q A;  2UV0 E;  3VOZ A;  2VJW A;  4ZJ3 A;  3L9K A;  1VM1 A;  3SOI A;  4LV0 A;  2V8F A;  4YOF A;  3UE1 A;  1K4F A;  4GD8 A;  4QHC A;  4GZB A;  3ZG5 A;  1P9W A;  2Y2H A;  4EBL A;  1BSG A;  1BT5 A;  2LB5 A;  1L0F A;  1O07 A;  2B5R A;  3LR3 A;  4B93 A;  5A91 A;  2INW A;  1MWT A;  3WS2 A;  4WUJ A;  4ARZ B;  3OPR A;  3L7H A;  4DJ2 A;  3LR4 A;  5A8B A;  4M4X A;  2XA7 S;  3IXH A;  4L9F A;  2QWS A;  4WZ4 A;  3CPT B;  3O88 A;  3HUN A;  3F1O A;  2VA0 A;  3VFH A;  4K0W A;  2P9V B;  4D2O A;  2Y2G A;  1K0K A;  5HDC A;  2XRN A;  3S22 A;  4WEK A;  3K2N A;  3FYZ A;  2PD8 A;  5E2H A;  1GSX A;  4B4X A;  4GB7 A;  4GNU A;  1KE4 A;  5DTK A;  2E8J A;  4JPM A;  3IXD A;  2WGV A;  3NC8 A;  3UB5 P;  4WLA A;  3NIA A;  5JYP A;  1LSV A;  3ZVW A;  4ESP A;  1HZO A;  3SH9 A;  3DBA A;  5GL9 A;  4B88 A;  4JBF A;  2JN7 A;  3HLE A;  4MBF A;  1BTL A;  3NDE A;  2Y2Q A;  3UB6 A;  4KG2 A;  1LT0 A;  1JWV A;  2XD5 A;  3P09 A;  4S2I A;  4R3J A;  5LBR A;  1NRJ A;  3LIC A;  4WF0 A;  1NXY A;  4EEP A;  4NET A;  5IU1 A;  3UN7 A;  3HVF A; 
#chains in the Genus database with same CATH homology
 3UE3 A;  4LCM A;  2XFS A;  1CI9 A;  2ZQ8 A;  4KZ7 A;  5DF8 A;  3V3S A;  3NCK A;  1PIO A;  1TEM A;  3GR2 A;  5U47 A;  3V5M A;  4CJN A;  1MWR A;  3G31 A;  5GLB A;  1FQG A;  1QME A;  2P9V A;  3GQZ A;  2WUQ A;  4GKU A;  3VP3 A;  1GHI A;  1LI0 A;  3GTC A;  2XDM A;  1DJB A;  5GHY A;  4KG5 A;  1MBL A;  3VSL A;  1GHP A;  1FR1 A;  4BL2 A;  4EQI A;  5A93 A;  3BLS A;  2FFF B;  4OLD A;  2OLU A;  5CHU A;  1ES2 A;  4P0M A;  4E3N A;  5DTT A;  3C7V A;  2JE5 A;  3HLD A;  1GCE A;  3N7W A;  2G2W A;  2IWC A;  3N8L A;  1IYQ A;  1KE3 A;  1O7E A;  2ZLY A;  3SS3 A;  1KDW A;  2VGK A;  2VGJ A;  4U3T A;  2EFX A;  3IXB A;  4BEN A;  4C75 A;  3Q82 A;  2XR0 A;  1IEM A;  4ID4 A;  5EUA A;  5EVI A;  1ZC2 A;  4JXV A;  4KZ5 A;  3UPP A;  3ZG9 B;  1YLZ A;  4IVK A;  4QD4 A;  5D3O A;  4BD0 A;  3ISG A;  1YQS A;  4RX2 A;  3HLG A;  3MKF A;  1KVM A;  3UE0 A;  4LEN A;  4OH0 A;  1YT4 A;  1K38 A;  3RJU A;  3BYD A;  1RCJ A;  1RGY A;  3G34 A;  4N92 A;  4OQG A;  1VQQ A;  2Y4A A;  5GLD A;  1CEG A;  2PBY A;  4LCL A;  2H5S A;  5CRF A;  1I5Q A;  3ZFZ A;  1XA7 A;  2X71 A;  4BLM A;  3CMZ A;  4IVI A;  4RA7 A;  5EVI D;  1PW1 A;  1Y54 A;  4HBT A;  3FWL A;  5F1G A;  2ZM0 A;  3M2J A;  4WMC D;  3ZHH A;  4EUZ A;  2RL3 A;  5KMW A;  3BEB A;  5AQ9 A;  2WGW A;  4QY5 A;  3ZGA B;  4RYE A;  1SDN A;  3SS4 A;  1N9B A;  3RXX A;  4GDB A;  1IYP A;  4OOY A;  5FAP A;  3WRT A;  5J8X A;  4FH4 A;  3WRZ A;  3UO9 A;  5FQM A;  1PI5 A;  3DWZ A;  3PTE A;  4E3O A;  1LL9 A;  1K6R A;  3ZVT A;  2ZC5 B;  4IBX A;  5E2E A;  3IF6 A;  1Z6F A;  2RCX A;  1YLW A;  4OPY A;  5AQ7 A;  1IYS A;  2C6W B;  2HDQ A;  3AGF A;  2FFY A;  3PAE A;  3Q7Z A;  3DWK A;  4ZBE A;  2JCH A;  1K57 C;  4LV1 A;  1MWS A;  3Q1F A;  5CXW A;  1E3U A;  4OP8 A;  3VSK A;  2ZC4 B;  4PM6 A;  2J9O A;  4PMA A;  2ZC3 B;  5GHZ A;  1K25 A;  4F94 A;  4L0L A;  1GA9 A;  1IEL A;  1K55 C;  4KG6 A;  1XP4 A;  5HAP A;  2DNS A;  3A3J A;  2WAD A;  3GMW A;  2HPB A;  3IXG A;  4MNR A;  1ESI A;  1FSW A;  1XXM A;  2WZZ A;  2ZQA A;  2Y2N A;  2H0Y A;  1FCN A;  3LEZ A;  2OSU A;  4GOG A;  1PYY A;  4X53 A;  4DKI A;  3IWI A;  1MPL A;  5CER A;  3S4X A;  2JC7 A;  2BG1 A;  2R9X A;  3M6B A;  3I7J A;  5M18 A;  3BRM A;  4S2N A;  3W4Q A;  4BL3 A;  1KE0 A;  3C7U A;  3W4O A;  3O86 A;  5KSC A;  4WZ5 A;  2ZQD A;  3OZH A;  1L0G A;  4DXC A;  1TVF A;  4HES A;  1XA1 A;  4H8R A;  2IWD A;  3B3X A;  3C4O A;  4N1H A;  1BLC A;  4XUX A;  5EVI C;  3GRJ A;  3DTM A;  4R4R A;  4Q8I A;  1SHV A;  5CTM A;  5FQI A;  5FI2 A;  4KZA A;  3N6I A;  5FQJ A;  5HAR A;  3OCL A;  3BM6 A;  3IF5 A;  4DF6 A;  1JTD A;  2ZC6 B;  4NK3 A;  3EQU A;  5FSR A;  1K56 A;  3CJM A;  3D4F A;  1JTG A;  2XFT A;  4DE1 A;  5EEC A;  4R3B A;  1KGG A;  4BD1 A;  2Y2L A;  5FQ9 A;  2JBF A;  2QZ6 A;  3UPN A;  3HUM A;  5TGF A;  1MY8 A;  4KQQ A;  3LCE A;  3G2Y A;  1GA0 A;  1W8Y A;  1PW8 A;  4KZ3 A;  4R0Q A;  5CTN A;  4UAA A;  1U60 A;  2HDR A;  2WKI A;  3QNB A;  4WEL A;  1YLY A;  4OLG A;  3WS0 A;  4Y0T A;  3VP2 A;  5DF9 A;  5M1A A;  5HL1 A;  3UDF A;  4RVA A;  4OQH A;  3GVB A;  3ITA A;  3LY4 A;  1BLP A;  2Q9M A;  1ESU A;  3FKV A;  1BUL A;  2XK1 A;  4E6W A;  2Y2I A;  4DE2 A;  1H8Y A;  1FSY A;  1TDG A;  3CZD A;  3IF6 C;  2EFU A;  5E2F A;  5HW3 A;  3S1Y A;  1OME A;  5CED A;  1NYM A;  2P74 A;  4IED A;  4PM8 A;  4PM9 A;  3V3R A;  4E3I A;  3BFG A;  3FV7 A;  5FAO A;  3UDI A;  2WYX A;  3FZC A;  3TOI A;  4GD6 A;  1IKG A;  1PWD A;  2XH9 A;  3FKW A;  3IWQ A;  3IF6 B;  3ZNT A;  4E3K A;  1SCW A;  4K0X A;  2EXA A;  3BFC A;  1EWZ A;  5GLA A;  4KZ6 A;  3WWX A;  1XX2 A;  3UNW A;  5JYO A;  3C5A A;  1AXB A;  4WEJ A;  5FI7 A;  1J9M A;  1SKF A;  2OLV A;  4OPZ A;  3OCN A;  1LL5 A;  1H5X A;  3MXR A;  5AQA A;  3UDX A;  4U0X A;  1L0E A;  3G4P A;  4LV3 A;  1WYC A;  3IQA A;  1ONG A;  4KZ4 A;  4QY6 A;  4DXB A;  3CG5 A;  3BEC A;  1K6S A;  5FI6 A;  5FQK A;  5EOO A;  3PBO A;  3VP4 A;  1E25 A;  3OPH A;  1XKZ A;  2V20 A;  3A3F A;  4X69 A;  1XPB A;  3O87 A;  4N9L A;  4E3J A;  2ZQC A;  4ZAM A;  1MKI A;  1K54 C;  4E3L A;  2Y91 A;  1KGF A;  1FCO A;  2Y2J A;  5HFO A;  4EBP A;  5CHM A;  2UWX A;  3QHY A;  2ZMA A;  3VMA A;  5E43 A;  4UHU A;  2HP5 A;  2R9W A;  1S0W A;  1L2S A;  3C4P A;  3HL9 A;  1BLS A;  2Y2K A;  3VOY A;  3HLC A;  1L0D A;  4JXS A;  5EVI B;  5HAQ A;  2QPN A;  4X55 A;  3A3E A;  5CEB A;  1HVB A;  5CGW A;  2DRW A;  4OKP A;  1K54 A;  1MXO A;  3HRE A;  4S2J A;  4OON A;  1M40 A;  1I2S A;  2ZC7 A;  2BLS A;  5HAI A;  2QMI A;  5F82 A;  2E8I A;  4OP5 A;  4GDN A;  3MZE A;  2HDU A;  4YFM A;  3AGD A;  4FSF A;  3OPL A;  1LI9 A;  3P98 A;  4DDY A;  2ZD8 A;  3PBS A;  3N4I A;  3LY3 A;  5CGS A;  2WAE A;  4OVD A;  1W5D A;  2XLN A;  1JVJ A;  1PZO A;  4KZB A;  3UY6 A;  3IWO A;  3DW0 A;  3ZG8 B;  3PBN A;  3BLM A;  4E6X A;  5DVA A;  2HP6 A;  1PWG A;  3TG9 A;  2Z2L B;  4WYY A;  4S2N C;  1LHY A;  2WZX A;  3IT9 A;  2WKH A;  4JXG A;  1CK3 A;  4JKT A;  2XF3 A;  3HUO A;  4GN2 A;  4WM9 A;  2V1Z A;  4P6B A;  2HDS A;  4ZDX A;  4WBG A;  3UPO A;  3HLW A;  3WS1 A;  5GLC A;  2Y59 A;  4A5R A;  1WE4 A;  4EV4 A;  3BFF A;  4UA6 A;  5EE8 A;  4Z9Q A;  1BLH A;  2J9P A;  1S6R A;  3BFE A;  1W7F A;  2XGN A;  2WGI A;  4IBR A;  5CGX A;  3ZCZ A;  1DJC A;  4Y7P A;  4DRT A;  4PM7 A;  4KQR A;  3NY4 A;  4X68 A;  4WZ5 C;  1FCM A;  2C5W B;  3E2K A;  3IH9 A;  2Y55 A;  3WS5 A;  1XGI A;  1ERM A;  1E4D A;  2PU4 A;  2ZM8 A;  1RP5 A;  3G35 A;  2CC1 A;  1KDS A;  1JWZ A;  1IKI A;  2ZJ9 A;  3A3I A;  2XQZ A;  4MLL A;  5AQB A;  1WYB A;  4S2L A;  5FA7 A;  4P87 A;  4YIN A;  1BZA A;  4ZJ2 A;  4QU3 A;  1NZO A;  4K91 A;  3N8S A;  1ONH A;  4KEN B;  5TFQ A;  3NBL A;  5A90 A;  1ES4 A;  4MEZ A;  4HEF A;  3SS5 A;  2Q9N A;  1ERO A;  2Y2P A;  4OOM A;  1MWU A;  3V50 A;  1IYO A;  1JWP A;  1ERQ A;  3MXS A;  4R23 A;  4S2O A;  3Q81 A;  5HX9 A;  1ZKJ A;  4Y0U A;  1W79 A;  4MBH A;  1Q2Q A;  1ES5 A;  3V39 A;  2Y2M A;  4Y0O A;  1LLB A;  5FAT A;  5FQQ A;  5IHV A;  1C3B A;  3OC2 A;  3ZNY A;  3SH8 A;  1ALQ A;  1ZG6 A;  2Y2O A;  4P85 A;  2EX6 A;  3QNC A;  3NDG A;  4N1X A;  3HLB A;  3JYI A;  4JF4 A;  4O7D A;  2ZM2 A;  4R1G A;  4WMC A;  4QB8 A;  4RX3 A;  1SDE A;  1HD8 A;  4S2K A;  4BQM A;  3LO7 A;  3HBR A;  3PAG A;  4PM5 A;  1GHM A;  1YLT A;  1DJA A;  2XD1 A;  5F1F A;  5DTS A;  4DE3 A;  3NI9 A;  2WKE A;  5G18 A;  5BOH A;  4EWF A;  4XUZ A;  1K4E A;  2EX9 A;  1XGJ A;  5GHX A;  1K56 D;  4ZTK A;  1NY0 A;  3W8K A;  2IWB A;  4LV2 A;  1BUE A;  2X01 A;  4C3Q A;  3W4P A;  5I94 A;  5L2F A;  1FOF A;  1W8Q A;  3RXW A;  3VOZ A;  2WAF A;  2OV5 A;  4C6Y A;  1QMF A;  4JLF A;  1I2W A;  3HVF A;  4OOL A;  4E3M A;  3SH7 A;  4ZJ3 A;  4XXR A;  3Q7V B;  2EX2 A;  3HLF A;  1VM1 A;  5E2G A;  3SOI A;  1DY6 A;  3ZG0 A;  4LV0 A;  1YLJ A;  3ZDJ A;  4KZ9 A;  5CHJ A;  3A3D A;  5M19 A;  5FAQ A;  4UA7 A;  1HTZ A;  4X6T A;  3Q7V A;  3UE1 A;  1K57 A;  1K4F A;  4UA9 A;  4GD8 A;  4QHC A;  2J8Y A;  4JF6 A;  1M6K A;  4GZB A;  3ZG7 B;  2PU2 A;  3ZG5 A;  4U0T A;  4EBL A;  2Y2H A;  2DCF A;  3PBR A;  3G32 A;  1ES3 A;  1PZP A;  3MZD A;  1BSG A;  1BT5 A;  4CPK A;  1L0F A;  1O07 A;  4X56 A;  1EI5 A;  2B5R A;  4ZJ1 A;  5CEC A;  5A91 A;  1MWT A;  3E2L A;  4S2M A;  3AGE A;  3ITB A;  3TSG A;  3WS2 A;  3MFD A;  4JXW A;  4DE0 A;  2EXB A;  1NYY A;  3VP1 A;  2H10 A;  3OPR A;  1YMX A;  3IXH A;  4WZ4 A;  4R4S A;  3IHA A;  3O88 A;  1TDL A;  3BFD A;  2GDN A;  3GV9 A;  2Z2M B;  1NJ4 A;  3HUN A;  5EPH A;  3VFH A;  4K0W A;  1RGZ A;  2P9V B;  4D2O A;  4DDS A;  3PBQ A;  2Y2G A;  5KSH A;  5EOE A;  3Q07 A;  1FR6 A;  1YMS A;  1YM1 A;  4N9K A;  4OQI A;  3GSG A;  2EX8 A;  3MKE A;  3PBT A;  4EBN A;  3S22 A;  4WEK A;  3FYZ A;  4OQ0 A;  4KQO A;  4OPQ A;  3IHB A;  1K55 A;  5E2H A;  2V2F F;  2A49 A;  4B4X A;  1PI4 A;  2I72 A;  4GB7 A;  1KE4 A;  4GNU A;  1ZG4 A;  5DTK A;  4JPM A;  5FDH A;  4BJP A;  3IXD A;  2H0T A;  2WGV A;  2J7V A;  3NC8 A;  1H8Z A;  3WS4 A;  4FH2 A;  2A3U A;  4FD8 A;  3IH8 A;  3NIA A;  4QJG A;  5JYP A;  1G68 A;  5KZH A;  1N4O A;  4S2P A;  5EVL A;  4KZ8 A;  3ZVW A;  1KVL A;  3VFF A;  3VP0 A;  1YLP A;  1HZO A;  4HBU A;  3M2K A;  3SH9 A;  5DF7 A;  2WGW B;  5GL9 A;  4PPR A;  4JBF A;  2ZQ9 A;  4B88 A;  3HLE A;  4MBF A;  3MBZ A;  3O3V A;  1KGE A;  2X02 A;  4MBK A;  1BTL A;  3G30 A;  3NDE A;  5TR7 A;  4JF5 A;  4B4Z A;  1G6A A;  1Q2P A;  3N8R A;  2Y2Q A;  1NZU A;  5A92 A;  3M6H A;  4KG2 A;  1JWV A;  2XD5 A;  3P09 A;  3MZF A;  5FAS A;  4OPR A;  2HP9 A;  1CEF A;  4S2I A;  4R3J A;  1E3U D;  5F83 A;  2WK0 A;  4M3K A;  3EQV A;  1PWC A;  1NXY A;  2ZQ7 A;  3G2Z A;  4NET A;  1CI8 A;  2XEP A;  2G2U A;  3OPP A;  4FCF A;  3UN7 A;  1NRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...