3G32A

Ctx-m-9 class a beta-lactamase complexed with compound 6 (3g3)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 94
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g32A00
5EVIC 5FAOA 4P0MA 5FDHA 4U3TA 2RCXA 3VOYA 2Y91A 3HVFA 4OVDA 1ERMA 3O86A 2ZC6B 1FR1A 3CJMA 3BRMA 1FSWA 5U47A 1BT5A 5TGFA 2C5WB 3VMAA 4D2OA 4QU3A 4UAAA 1K6RA 3N7WA 4S2LA 4OQHA 1IKGA 5DVAA 5F1FA 1BTLA 1GCEA 1KVMA 3N4IA 4FH2A 4ZTKA 5FATA 1IKIA 5I94A 1FCOA 3HLCA 4N1HA 1ZKJA 4DRTA 1ES2A 4LV2A 4RYEA 1XA1A 4GOGA 2A3UA 5KZHA 2Y4AA 3BM6A 1YLYA 2EXBA 4OP5A 2EXAA 3A3JA 4X56A 3MZFA 3UDXA 4WZ5C 1LHYA 1FCMA 4FCFA 2XFTA 1XGIA 2EFUA 4HESA 1KE0A 4E3IA 3HLDA 2Y2IA 2H10A 3IXHA 4GN2A 4K0XA 4X69A 4Y7PA 1K4FA 5GHZA 4LENA 3VP3A 1E3UA 4OQIA 3EQUA 4JXVA 5IHVA 2XD1A 2ZC7A 3SH7A 4GDBA 3RXWA 3C4OA 3UE0A 3WRTA 4ZBEA 2QPNA 1JWVA 1PI5A 4QY5A 3ZG8B 2DRWA 5CGSA 4ZDXA 4MBKA 4ZJ3A 2HP6A 3ZG9B 2A49A 1BLCA 1KGEA 4JLFA 4E3MA 3Q1FA 3ZNYA 4Y0UA 1W7FA 1FOFA 1K38A 3WS5A 1LL9A 1N4OA 3O88A 4JPMA 3BFDA 4LV1A 1BLHA 1JTDA 1ZG6A 2JCHA 1OMEA 4R3BA 1I2WA 2Y2KA 5HFOA 2IWCA 5J8XA 2JC7A 1MPLA 4PPRA 2ZQCA 1K55C 1BUEA 2Y2LA 2XH9A 3LY3A 1DJBA 3V39A 1PWGA 2XR0A 2P9VB 2WKEA 4EUZA 3ZVWA 1EWZA 4NK3A 3HUOA 3SS5A 1U60A 4OPZA 2Y2HA 3C4PA 3AGDA 3ITAA 4WBGA 3Q7VB 4IBXA 1HTZA 1ONHA 5FQMA 4JBFA 4KG5A 1Z6FA 3NBLA 3M6HA 2ZJ9A 5GLBA 3UPOA 1VM1A 1KDSA 3S22A 1H8YA 5TR7A 1PWCA 4CPKA 2Q9MA 3W4OA 4FD8A 1BSGA 3HREA 5F82A 1L0FA 3ZG0A 1BLPA 5AQBA 3AGEA 4C3QA 2WZXA 4OLDA 5EVIA 1LLBA 3BLSA 2J9PA 2Z2MB 2J7VA 3W8KA 2JE5A 2XQZA 2H0TA 3C5AA 1YLZA 4QHCA 3C7UA 3I7JA 3A3EA 1EI5A 4IBRA 4JF6A 5F83A 1ES4A 5G18A 5A91A 3VP1A 4EV4A 2V2FF 5HW3A 3HLWA 3PAGA 1JWZA 3HBRA 3IF6C 3UDFA 1LI9A 3P98A 4UHUA 4DF6A 1KGFA 4C6YA 3C7VA 4QY6A 4E3KA 1CEGA 3DTMA 2ZM8A 4OLGA 3G2YA 3NCKA 4B4ZA 5D3OA 4ZJ2A 3MXRA 3JYIA 4WZ5A 4BL2A 1IYOA 5GL9A 5KSCA 5FI6A 1LI0A 2WGVA 3TSGA 4EBLA 2OSUA 5EPHA 4WM9A 3V5MA 4BLMA 4LV3A 3MXSA 2FFYA 2G2WA 1KE4A 1MWTA 4WELA 4S2NC 3IWIA 1H5XA 2UWXA 4ID4A 4DDYA 4RA7A 3VSKA 3FKVA 4CJNA 1MKIA 2X02A 1ZG4A 3B3XA 4U0XA 3IH8A 3Q7ZA 1TEMA 1M40A 4Z9QA 3ZCZA 3IHBA 4XXRA 5CRFA 3GVBA 1K56A 1RGZA 3GR2A 1TDGA 3UPNA 5HX9A 1TVFA 2HDUA 3VFHA 4OOYA 4Y0OA 3PBNA 1ES5A 4K91A 1NZOA 3UE1A 5EUAA 3UNWA 1N9BA 3S4XA 3G30A 1K57C 2Y2NA 2ZC5B 5E43A 1K55A 5CERA 1G68A 2EX8A 3QHYA 1CEFA 2XK1A 1H8ZA 5CECA 1BZAA 1XPBA 4KQOA 4XUXA 3WRZA 3OPRA 1MWRA 1EROA 3BEBA 4EWFA 1L0DA 1YLWA 1MY8A 2HDQA 2C6WB 2Y59A 3QNCA 4OH0A 4S2PA 5FQQA 2ZQAA 3NC8A 1CI9A 1MBLA 3NI9A 3RJUA 3VP2A 4E3OA 2B5RA 2Y2MA 3IQAA 3BLMA 3G31A 1HVBA 1YQSA 3IXDA 4EBPA 3NDEA 4JF4A 4R1GA 4S2MA 2ZQ9A 4EQIA 2OLVA 1HZOA 4GNUA 3GMWA 1L2SA 3WS0A 4DE0A 1DJCA 4UA9A 1XKZA 3GQZA 4O7DA 5E2EA 1NJ4A 4MEZA 1PWDA 1YLTA 5CHJA 3NDGA 4JF5A 3UN7A 5GLDA 4N1XA 1NXYA 2IWBA 1SHVA 3OPHA 4QD4A 4P87A 4E3NA 2J9OA 4X53A 5DF9A 4BD0A 3IF6A 2EX2A 4PM5A 3WWXA 3OZHA 2H5SA 3N8SA 5EOEA 2H0YA 1IELA 1C3BA 3CMZA 5DTKA 3UY6A 3SS4A 3M2KA 4BD1A 1IYPA 1PIOA 1SKFA 2WADA 4DXBA 3HUNA 3W4QA 5FQIA 3LCEA 2HP9A 5CXWA 3N8RA 3OC2A 3UE3A 2Y2OA 5A92A 4X6TA 2WGWA 2ZM0A 5AQAA 1KGGA 5FSRA 2VGJA 3V3RA 4GZBA 1IEMA 4E3JA 2OV5A 1NRFA 3PBSA 3IF5A 5A93A 4JXWA 2EX9A 3A3FA 5GLCA 2IWDA 5FASA 1MWUA 5HAIA 3O3VA 1PW8A 1Q2QA 3BFCA 3WS4A 4S2NA 4KZ4A 5CHUA 1JWPA 2E8IA 2ZC3B 4PMAA 1NZUA 3G32A 1ONGA 3LEZA 1IYSA 4PM9A 3LY4A 1NYYA 4OONA 2V1ZA 3DWKA 3GTCA 1W5DA 1W8QA 1PZPA 4N9KA 2WZZA 1W8YA 4IVKA 5BOHA 4OPRA 3Q82A 3GSGA 1QMFA 3OPPA 3IXBA 5E2GA 4LCLA 1FCNA 4BJPA 3BFEA 4KZBA 3ZGAB 2WK0A 1K54C 4WZ4A 4JXSA 2GDNA 2ZMAA 1DY6A 5F1GA 1GA9A 3HL9A 4DDSA 1AXBA 1PZOA 2PU2A 3S1YA 3VOZA 4HEFA 4OOMA 3BFGA 3TOIA 1YM1A 4OQGA 4PM8A 3PBRA 3BYDA 5KSHA 4KG6A 2HPBA 3V50A 5CTMA 1SDEA 2ZQDA 1S0WA 1GHIA 4IEDA 4IVIA 5DF8A 1DJAA 5CTNA 4E6XA 2BG1A 3ZG5A 4UA6A 1ESUA 3BFFA 3GV9A 3ITBA 4GB7A 4MNRA 2QZ6A 2BLSA 4C75A 4K0WA 1JVJA 4GD6A 4E6WA 2Y55A 4MLLA 4ZAMA 3ZDJA 4MBHA 1L0EA 4DE2A 2R9XA 4X55A 5CHMA 5FAQA 3VP0A 3HLGA 4RX3A 2HP5A 2WGIA 2Y2JA 2XLNA 1WYCA 5E2FA 3PBQA 4BQMA 1E3UD 1JTGA 3IF6B 1NY0A 4QJGA 4S2IA 4R4SA 4RVAA 2QMIA 1FSYA 5HL1A 1WE4A 5FQ9A 1YT4A 2CC1A 4YFMA 2P9VA 5AQ9A 3UDIA 1MXOA 3VSLA 3ZVTA 4Y0TA 5JYOA 2Q9NA 2ZQ7A 4QB8A 4UA7A 3HLFA 2HDSA 1YLPA 4XUZA 3Q81A 4R3JA 3UO9A 3SH9A 4KZAA 4N9LA 2WGWB 3MZEA 3UPPA 1GHMA 3M6BA 5GHXA 1KE3A 4OPYA 2WAEA 5HAQA 3IT9A 3PBOA 1ALQA 5AQ7A 3V3SA 3FWLA 5M1AA 5FA7A 1KVLA 1GA0A 4LCMA 3ZHHA 2XF3A 1MWSA 4WEKA 2X01A 3G34A 2PBYA 3NIAA 2Z2LB 1O7EA 5EVIB 3ISGA 2J8YA 4WMCA 2Y2QA 2Y2GA 4JKTA 1RGYA 5HARA 1XA7A 1RP5A 1SCWA 2VGKA 3ZG7B 1NYMA 2JBFA 5HAPA 1SDNA 5DTTA 5A90A 3BECA 1QMEA 5FI2A 4BENA 2ZM2A 4S2OA 1WYBA 4BL3A 4R0QA 3E2KA 1CK3A 4KQQA 1O07A 2EFXA 2ZLYA 4HBUA 5FQKA 5FAPA 4DE1A 3TG9A 1BLSA 2DNSA 5GLAA 4OP8A 4F94A 2XDMA 1Y54A 3G4PA 1IYQA 1E4DA 4H8RA 4B88A 4KQRA 1K54A 5EVID 4PM7A 2V20A 1ERQA 4PM6A 4B4XA 4FH4A 1Q2PA 4WYYA 3A3IA 2RL3A 5FI7A 2R9WA 1XP4A 1G6AA 4KZ5A 1ES3A 1ZC2A 1S6RA 1ESIA 5CEDA 2XD5A 3ZNTA 1L0GA 1TDLA 3MKFA 3W4PA 3IWOA 4GKUA 1VQQA 1FQGA 3MFDA 3WS2A 4GD8A 2ZD8A 3N6IA 3FZCA 2Y2PA 3FKWA 4L0LA 3RXXA 5DTSA 4OOLA 4A5RA 1YMSA 3PTEA 5GHYA 3SS3A 4ZJ1A 1E25A 1CI8A 2EX6A 1J9MA 3HLBA 4KZ3A 4OKPA 4OPQA 3FYZA 3IXGA 1K4EA 2ZC4B 3O87A 5EVLA 5CGXA 3MKEA 4P85A 4DE3A 1I5QA 3NY4A 4DKIA 3VP4A 4S2JA 5E2HA 3DWZA 3WS1A 1LL5A 1K57A 5KMWA 3GRJA 4R23A 5DF7A 3OCNA 1K6SA 4KZ9A 2WYXA 5CEBA 1K56D 3PBTA 4MBFA 3CG5A 3SH8A 5CGWA 4R4RA 5EE8A 5M18A 2I72A 3MZDA 2X71A 1RCJA 5JYPA 4S2KA 2ZQ8A 4JXGA 3OCLA 3PAEA 3FV7A 2WKIA 4YINA 3AGFA 3HUMA 3EQVA 3D4FA 3OPLA 1YLJA 3A3DA 4NETA 4RX2A 3SOIA 1K25A 5M19A 3P09A 4M3KA 3IH9A 2P74A 3IHAA 4E3LA 3Q07A 1YMXA 1PW1A 3IWQA 1PI4A 3VFFA 3ZFZA 1BULA 4LV0A 4KZ6A 5FQJA 2XEPA 1XGJA 4KENB 4EBNA 4KZ7A 5EECA 1M6KA 3LO7A 4GDNA 3G35A 4KG2A 1PYYA 4U0TA 2FFFB 4HBTA 4Q8IA 2XGNA 3CZDA 1XXMA 1XX2A 2OLUA 2G2UA 2WAFA 3N8LA 3QNBA 2DCFA 3MBZA 4P6BA 4WEJA 1FR6A 1W79A 2HDRA 4WMCD 1KDWA 3E2LA 3HLEA 2WUQA 1I2SA 2XFSA 4DXCA 1HD8A 4FSFA 4KZ8A 3Q7VA 4OQ0A 3G2ZA 3M2JA 4N92A 5L2FA 2WKHA 5TFQA 4X68A 3DW0A 2PU4A 5EOOA 1GHPA
chains in the Genus database with same CATH superfamily
5EVIC 2RCXA 3HVFA 3CJMA 3LIBA 3MS6A 2LB5A 4I38A 5U47A 2OWJA 4QU3A 3N7WA 5DVAA 4OQHA 1IKGA 3HJIA 1KVMA 4FH2A 4N1HA 1ZKJA 4NXEA 4DJ3A 2PR5A 3E4QA 3UDXA 4X56A 2J3TD 3MZFA 1LHYA 3PHYA 1FCMA 4FCFA 3KO6A 4X69A 2O9CA 3VP3A 5IHVA 2XD1A 3RXWA 3UE0A 3KSGA 4ZBEA 2ZOHA 3ZG8B 3FC7A 4ZDXA 5J7EA 2O0YA 2XROA 2ZBBA 3TE8A 3Q1FA 3WS5A 1N4OA 1PNEA 3EGDC 4LV1A 1JTDA 2JCHA 4R3BA 5HFOA 2IWCA 1XJ2A 1BUEA 2XR0A 1BYWA 2WKEA 3SS5A 1DP6A 1U60A 3IX8A 1VEUA 3NBLA 3UPOA 1PWCA 3B42A 4CPKA 3ZG0A 5AQBA 4B93A 2V1AA 5J4EA 1J3WA 3C5AA 5F68A 1YLZA 3VP1A 4CLCC 1ES4A 1GSWA 4R6LA 4EV4A 3CI6A 3HLWA 5MC7A 3PAGA 4ARZB 3HBRA 3OOVA 4DN0A 3C7VA 4E3KA 4OLGA 3NCKA 3MXRA 4WZ5A 4BL2A 2JN7A 4H6JB 5HL6A 1LI0A 2IA2A 2WGVA 4CQHA 5EPHA 3V5MA 3SZTA 2FFYA 2A24B 2UWXA 4ID4A 3LR0A 2L1MA 2V1BA 5IU1A 1VHMA 2J80A 3IH8A 1TEMA 4Z9QA 5G4YA 4XXRA 5CRFA 5F5YA 3GR2A 3UPNA 2HDUA 2W3FA 2KLIA 2WKPA 1K55A 2L4RA 5CERA 1YPRA 1CEFA 2HJEA 1BZAA 2PDRA 2ZL1A 1EROA 1L0DA 2HDQA 2C6WB 3QNCA 1K0KA 4F3LA 4WF0A 3VP2A 3IQAA 2Y2MA 4EBPA 4JF4A 1XKZA 3H7WA 1CF0A 3G6OA 2ZOIA 3T4TA 1XFQA 3GECA 2M7VA 4X53A 4IUKA 3OZHA 3ICYA 2H5SA 2W27A 1AWIA 3R7WB 4DXBA 3LCEA 3A0SA 4WLAA 5A92A 2WGWA 3LI8A 5EM1A 4E3JA 1P0ZA 1GSXA 4G3KA 3PBSA 3IF5A 4JXWA 2EX9A 2IWDA 2QHKA 3DTKA 1PW8A 4I3AA 3KSHA 3LI9A 5CHUA 3UB5P 4PMAA 4PHTA 3G32A 4PM9A 3IX4A 1Z09A 2V1ZA 3DWKA 3FG8A 3BW6A 3GTCA 2JHEA 2ZMFA 4IVKA 2V8FA 5BOHA 1GSVA 3KSFA 1NLZA 1F5MA 5E2GA 4BJPA 3CUEC 3BFEA 2WK0A 4WZ4A 3T1QB 4JXSA 4P6ZS 4MCWA 4GLQA 4XT2B 3VOZA 4HEFA 4BWIA 2OAQ1 3T4KA 5FDSA 3V50A 5HD3A 1GHIA 4IVIA 4E6XA 3LYXA 4GB7A 2BLSA 3QP5A 3P7NA 3ZDJA 1L0EA 2R9XA 3T4SA 5FAQA 3B47A 4RX3A 4HNBA 1JTGA 1OT9A 2HZ5A 1FSYA 2CC1A 4YFMA 3VSLA 1MXOA 3ZVTA 5JYOA 3T1XA 3UO9A 1T1CA 3SH9A 3S7OA 3F1NA 3LEQA 4HY8A 2D01A 4HP4A 5AQ7A 5HDDA 2Z2LB 1RGYA 1RP5A 1NYMA 2JBFA 2W1TA 1IOUA 5FI2A 2ZM2A 1WYBA 3S7NA 3ZYTA 4HBUA 1ZTUA 2OAP1 2XDMA 3G4PA 2V8CA 2BASA 2V20A 3LGOA 3A3IA 1LL8A 5FI7A 2R9WA 4LPZA 1ZC2A 4EU0A 2P08A 3ZNTA 1TDLA 4L9FA 2I9VA 1VQQA 1FQGA 2K31A 2ZD8A 2Y2PA 3D9YA 4YOFA 2D02A 4OOLA 5TBMB 3SS3A 4Y15A 5CGXA 3LIFA 3NY4A 4DKIA 4S2JA 3WS1A 3MF0A 1NWZA 1P97A 5KMWA 3OCNA 4HH3A 2WYXA 1K56D 1NRJA 3SH8A 5M18A 3MZDA 4I39A 1RCJA 2ZQ8A 3OCLA 4PKYA 1YSPA 3EQVA 4RX2A 4NETA 3SOIA 5M19A 3Q07A 1PW1A 3ZFZA 1LT0A 3MQ0A 4KENB 3TJZC 3PXPA 3LO7A 4KG2A 1S4SA 1SKOB 3N8LA 5DTSA 2OLUA 2WAFA 2DCFA 5C5KA 4WMCD 1KDWA 2XFSA 1HD8A 4FSFA 4KZ8A 3T50A 5DFYA 4N92A 2HV1A 3UB9A 3VOYA 2Y91A 4OVDA 1FR1A 4KUKA 1GCEA 4ZTKA 5FATA 1FCOA 5FEGA 1XA1A 4GOGA 2A3UA 3BWLA 4OP5A 2EXAA 1XGIA 1KE0A 3HLDA 2Y2IA 4ESPA 1G28A 4LENA 3WRTA 4QY5A 2DRWA 5CGSA 2VA0A 3ZG9B 2A49A 2YKFA 1V9ZA 4Y0UA 1K38A 1LL9A 4JGQA 3BFDA 3UB7A 1BLHA 1ZG6A 4HJ4A 5J8XA 5HWWA 1T1BA 1DJBA 5KIZA 1PWGA 3IBRA 4EUZA 2XA7M 2Y2HA 3C4PA 3NECA 3ITAA 3Q7VB 4IBXA 4JBFA 5I5LA 1G6OA 4GS9A 5TR7A 4BMWA 2Q9MA 3W4OA 3HREA 1BLPA 3AGEA 2OOLA 5DKLA 4OLDA 3RFBA 1UWPX 2JKFA 3JVVA 5HPFA 2M1CA 3R4KA 3C7UA 4E3NA 5AVFA 5A91A 5HW3A 1KGFA 4C6YA 2B95A 1TF1A 3DTMA 4Y3IA 3G2YA 3PR6A 4EEUA 4B4ZA 2VV8A 5D3OA 3JVUA 3C8CA 1Y4OA 4I3IA 2VV6A 4WELA 4S2NC 4DJ2A 4DDYA 3VSKA 4X25A 4CJNA 3B3XA 3Q7ZA 3IHBA 1K56A 2H28A 4OOYA 1OTBA 5G4ZA 5A8BA 3UE1A 1VETA 4GCZA 2K7SA 1N9BA 4II7A 3G30A 4QPRA 3S4XA 3UNWA 2Y2NA 2ZC5B 2HF6A 2EX8A 3QHYA 1S4RA 3F1OB 4HQAA 4YNRA 3T4LA 2XK1A 5CECA 3T12B 4EWFA 1YLWA 4S2PA 4MN7A 1MBLA 3RJUA 3NI9A 5EFWA 3IXDA 1HVBA 3W2ZA 3NDEA 3JPUA 2ZQ9A 2OLVA 1HZOA 3GMWA 3HCYA 3WS0A 3GQZA 4MEZA 1F2KA 1PWDA 1YLTA 3CLOA 4N1XA 4EESA 3OPHA 4QD4A 5HZHA 4P87A 5DF9A 4BD0A 3IF6A 4PM5A 1SKOA 1N9OA 3H9WA 3N8SA 2R78A 1KOUA 2H0YA 5EOEA 1W63Q 3LIDA 3CMZA 5DTKA 3SS4A 1IYPA 3EWKA 5CXWA 3N8RA 2Y2OA 4PKYG 2XA7S 2OV5A 2WKQA 1UGUA 1NRFA 2VZWA 4MDZA 3L9KA 3OBFA 3D72A 4NXBA 2E8IA 1NZUA 3LIEA 3LEZA 1IYSA 3C38A 3LY4A 1NYYA 3KX0X 4OPRA 3OPPA 3V67A 2GJ3A 3NULA 1OJ5A 4FUWA 3QP2A 1L3LA 2ZMAA 1DY6A 5F1GA 1GA9A 1TS7A 4HOIA 5HDCA 5K5BA 1PZOA 2Z6CA 2PRFA 4ETXA 4OQGA 4KG6A 2HPBA 1HLUP 5LBRA 1S0WA 3MSHA 4IEDA 5DF8A 2W3GA 1LSVA 1ESUA 4UA6A 4MNRA 2QZ6A 4C75A 1JVJA 4GD6A 3F1PA 4R3AA 4NXFA 2VV7A 3KYZA 3O5YA 4IJGA 5J3WA 3HLGA 2Y2JA 2WGIA 3BQAA 2XLNA 3PBQA 3A0RA 4BQMA 1E3UD 3UB8A 4S2IA 2L0WA 2PR6A 5HL1A 4MN5A 4Y0TA 2WKRA 3C2WA 2Q9NA 4NKPA 4QB8A 3HLFA 2HDSA 1YLPA 4R3JA 4KZAA 4RQ9A 4Q0HA 2PBDP 4OPYA 1ALQA 3V3SA 2ZMVA 3QP8A 2XF3A 3FPWA 2X01A 3TW8A 3G34A 2PBYA 2VGLM 5EVIB 2J8YA 2Y2GA 1XA7A 1SCWA 5DTTA 1QMEA 4S2OA 4BL3A 3E2KA 4KQQA 1O07A 2ZLYA 2DNSA 5GLAA 1Y54A 1IYQA 2CMNA 4B88A 1K54A 5EVID 4PM7A 4B4XA 2EWVA 4FH4A 2O9BA 2FH5A 1XP4A 5CEDA 2XD5A 1L0GA 4X1LA 1JNUA 3IWOA 4GKUA 4Y5FA 4IHQA 4GD8A 3N6IA 4L0LA 3RXXA 4JGPA 5GHYA 1E25A 1CI8A 2EX6A 4KZ3A 2ZC4B 4Y13A 1LL5A 1K57A 3GRJA 4R23A 5DF7A 4R4RA 2X71A 1N9LA 4S2KA 2EWWA 3LR3A 5EM0A 3PAEA 2WKIA 3UMDA 3HUMA 1T19A 3A3DA 3P09A 2LB9A 3IH9A 3IHAA 4E3LA 4IUHA 4KZ6A 4JGOA 1XGJA 4CLCB 5EECA 3B33A 1M6KA 3G35A 2MJ6A 4HBTA 4Q8IA 2XGNA 3CZDA 1XXMA 2HDRA 3IS2B 4DXCA 4MN6A 5L2FA 2WKHA 1OTIA 3LR4A 2PU4A 5FAOA 4P0MA 4U3TA 2B18A 4CLCD 1ERMA 3O86A 2ZC6B 1BT5A 5TGFA 3UE6A 4D2OA 1K6RA 4S2LA 1BTLA 3N4IA 5HD5A 2NUPC 5I94A 2KDKA 2Y79A 5L8MA 4LV2A 4ARZA 4MMNA 5KZHA 3BM6A 1YLYA 3T4QA 4WZ5C 2XFTA 4GN2A 4K0XA 4Y7PA 5HDSA 5GHZA 1D1JA 1E3UA 5HPIA 4JXVA 3SH7A 4GDBA 3C4OA 4H6JA 3TRCA 2QPNA 4JGRA 4PAUA 4MBKA 2Z6DA 2QKPA 1OTAA 2HP6A 2A24A 5TJJA 1KGEA 4E3MA 1W7FA 1FOFA 3O88A 4X1MA 4JPMA 1I2WA 1MPLA 1K55C 2Y2LA 3LY3A 3V39A 2P9VB 1TS8A 3ZVWA 1EWZA 4NK3A 3HUOA 3AGDA 1TS6A 5HWVA 1HTZA 1ONHA 4CLCE 3E0YA 3M6HA 5GLBA 1VM1A 1H8YA 5F82A 5EVIA 3EEAA 3K3DA 5CX7A 2J9PA 2J7VA 1TS0A 3W8KA 2JE5A 2XQZA 1F98A 3BY9A 4QHCA 4JF6A 3A3EA 1EI5A 5F83A 3FPVA 1JWZA 3UDFA 1LI9A 3P98A 4QY6A 4UQIM 3P01A 4AFIA 2ZM8A 3S7QA 4ZJ2A 1UWNX 3JYIA 4ZRRA 1IYOA 3R7WA 5KSCA 1OPXA 3LUQA 1KE4A 1MWTA 3IWIA 1H5XA 1T1AA 4RA7A 2X02A 1ZG4A 1MZUA 3VE4A 3ZCZA 3KSIA 2XRNA 3GVBA 1RGZA 1TDGA 3PBNA 1ES5A 1K57C 5E43A 1LSXA 1G68A 1VEUB 1H8ZA 4KQOA 4XUXA 3OPRA 1SZVA 4XT2A 1CQAA 3BEBA 2O99A 1MY8A 1STZA 4OH0A 3HJKA 5FQQA 1Y28A 2ZQAA 4EQ1A 3BY8A 3NC8A 4E3OA 2B5RA 3BLMA 3G31A 3E98A 4R1GA 4S2MA 3QP4A 1YSQA 4LLOB 4DE0A 4UA9A 2PD8A 4FTXA 4JF5A 5GLDA 1NXYA 4WUJA 1SHVA 4CLCA 2J9OA 4Y17A 2UV0E 3WWXA 5L09A 1C3BA 3UY6A 1SKFA 3HUNA 3W4QA 5FQIA 2E8JA 4X6TA 2ZM0A 5AQAA 1WA9A 3EOIA 4BBUA 5IT5A 3V3RA 4I5SA 1OJGA 3VV4A 3A3FA 5GLCA 5FASA 5HAIA 3WS4A 4EW7A 4KZ4A 1JWPA 2ZC3B 4K08A 5F69A 2HJ9C 4OONA 1W5DA 4N9KA 1PZPA 3SW1A 2WZZA 4HJ6A 1S1ZA 1OTEA 3GSGA 1QMFA 1YKDA 3H82B 4LCLA 1FCNA 4KZBA 3ZGAB 2GDNA 4DDSA 2ZL1B 1AXBA 3S1YA 3BFGA 3TOIA 5KSHA 4F3LB 2QWSA 4EEPA 1DJAA 5CTNA 2BG1A 4R70A 3GV9A 3ITBA 3ULFA 4K0WA 1V9YA 2Y55A 4MLLA 4ZAMA 3H7WB 4DE2A 4X55A 4EUVA 3VP0A 4D60A 2HP5A 5DJTA 5E2FA 1NY0A 4QJGA 4RVAA 2QMIA 4YWZA 5FQ9A 1PFLA 1YT4A 2P9VA 5TBMA 5AVEA 2ZQ7A 4UA7A 3Q81A 4N9LA 2WGWB 3MZEA 5HWTA 3UPPA 1GHMA 3MR0A 1KE3A 2WAEA 2W0NA 3PBOA 3DAVA 3QP1A 3FWLA 4BBVA 5L10A 3U2AA 3ZHHA 1MWSA 4WEKA 3NJAA 4WMCA 4JKTA 2VGKA 5HAPA 1SDNA 1YAXA 2EFXA 5FQKA 5FAPA 4G3WA 4F94A 1X0OA 4HI4A 3CUEA 4KQRA 4PM6A 1Q2PA 4WYYA 2PD7A 5DFXA 1G6AA 4KZ5A 1S6RA 4DMZA 3E4PA 2W3HA 1DRMA 5L07A 3MKFA 4O0PA 3WS2A 3VE3A 1S67L 3CPTB 2OWHA 3FZCA 3FKWA 3LFVA 4M4XA 4A5RA 1XJ4A 1YMSA 3ZQ5A 4ZJ1A 4QWOA 4HP9A 4OPQA 2W3EA 3IXGA 1K4EA 1T18A 3DTEA 5EVLA 3F1NB 3MKEA 4P85A 5E2HA 4BBTA 1K6SA 4KZ9A 2VK3A 3GDIA 5CEBA 3PBTA 4MBFA 2GZAA 3KYEA 5CGWA 4HHDA 2I72A 3IBJA 5JYPA 4JXGA 3AGFA 3OPLA 2W1TB 1YLJA 4P6ZM 2K2NA 4I3JA 2P74A 3IX3A 3PYPA 4LRZE 1PRQA 1YMXA 3C30A 3VFFA 1BULA 1G5UA 5FQJA 1CJFA 4U0TA 2FFFB 3MMHA 4P6BA 1XX2A 1H3QA 3MBZA 3E2LA 3T4JA 2JKTM 4NG2A 3OLOA 3Q7VA 4OQ0A 3M2JA 4WN5A 1VB6A 3DW0A 5EOOA 4Q0JA 5FDHA 3MQQA 3BRMA 2V0WA 1FSWA 1EW0A 5DKKA 2C5WB 2VEAA 3VMAA 1S1YA 4UAAA 5F1FA 2EA9A 3K2NA 1IKIA 3HLCA 3H82A 4DRTA 1A0KA 2PAVP 1ES2A 2V0UA 4RYEA 4EERA 2Y4AA 2EXBA 3A3JA 2O9AA 5EVEA 2EFUA 4HESA 4E3IA 3IXHA 3K3CA 2H10A 4NEED 1K4FA 4B9OA 4OQIA 3EQUA 2ZC7A 2B02A 4EXOA 1JWVA 1PI5A 4ZJ3A 2JKRM 1W63M 3EGXC 3D3OA 1DP9A 1XFNA 1BLCA 4JLFA 3ZNYA 4FOFA 1ODVA 1OMEA 3L7HA 2Y2KA 5FEFA 2JC7A 1D7EA 4PPRA 2ZQCA 3DBAA 3T1RA 2XH9A 4OPZA 3F1OA 4WBGA 5FQMA 4KG5A 1Z6FA 2ZJ9A 1KDSA 3EEHA 3U4LP 2AVXA 1MKMA 3S22A 1DP8A 4FD8A 1BSGA 2NUTC 1L0FA 3MQOA 3CHWP 4C3QA 2WZXA 3VOLA 2XSSA 2PHYA 4L9EA 1LLBA 3BLSA 5IS1A 2Z2MB 2G7UA 2H0TA 4G3VA 1D06A 3I7JA 4IBRA 5G18A 3NOUC 2V2FF 4LRXC 3IF6C 2JKGA 4DF6A 4UHUA 1CEGA 3NOPC 5GL9A 5FI6A 3TSGA 3LR5A 4EBLA 2OSUA 1TD5A 4WM9A 4BLMA 3A0VA 4LV3A 3MXSA 2G2WA 4GHIB 1IFQA 2VKSA 3DTIA 3FKVA 4O8GA 1MKIA 4O01A 4U0XA 1M40A 4UEYA 1LSWA 2A2LA 3CPTA 5HX9A 1TVFA 1N9NA 3VFHA 2ACGA 4Y0OA 4K91A 2P7JA 1NZOA 2J3WA 5EUAA 2VGLS 1H8MA 3T4OA 1XPBA 3WRZA 4GS9B 1MWRA 2Y59A 2PYPA 4KQDA 1CI9A 1YQSA 4EQIA 4GNUA 4LFUA 1L2SA 3CWFA 1DJCA 5E2EA 4O7DA 1NJ4A 5CHJA 4ETZA 3NDGA 3UN7A 2IWBA 3T1SA 2EX2A 2GNXA 1IELA 1XJ6A 3M2KA 4BD1A 1PIOA 2WADA 2HP9A 2PT7A 3OC2A 3UE3A 4GJ4A 4R38A 1FILA 4HJ3A 1KGGA 5FSRA 3UB6A 3KYQA 2VGJA 4GZBA 1IEMA 5A93A 4KUOA 1MWUA 3O3VA 1Q2QA 3BFCA 5DJUA 4S2NA 2KOIA 2BTFP 4ME4A 4Y2FA 1S66L 1ONGA 1OT6A 5AJGA 4EETB 1W8QA 1VETB 1W8YA 3Q82A 2DMWA 3IXBA 3UMEA 2QYBA 1K54C 3HL9A 2PU2A 4L9GA 4OOMA 1YM1A 2YKHA 4PM8A 3PBRA 3BYDA 5CTMA 1SDEA 2ZQDA 2Q0OA 2J3TC 4GW9A 2HGVA 3ZG5A 3BFFA 2VLGA 4E6WA 2QJ5A 4MBHA 3S7PA 2INWA 5CHMA 2W3DA 2M7UA 5FL3A 1WYCA 3RTYA 3IF6B 4R4SA 1WE4A 5AQ9A 3UDIA 2W1RA 2GX5A 4XUZA 4LRYC 4Z1WA 3M6BA 5GHXA 3MXQA 5HAQA 3IT9A 3QP6A 1F9IA 5M1AA 5FA7A 1KVLA 1XJ3A 3LICA 1GA0A 4LCMA 5EV0A 3NIAA 1O7EA 3ISGA 2Y2QA 5HARA 1NLYA 3MFXA 3ZG7B 5A90A 2VJWA 3BECA 4BENA 3BQ8A 3RH8B 4R0QA 1CK3A 3NHQA 5HSQA 4DE1A 2KX6A 3TG9A 2Y8HA 1BLSA 4OP8A 1E4DA 4H8RA 1ERQA 2RL3A 3IS2A 3BJNA 3CAXA 4GHIA 2VX8A 3F1PB 1ES3A 3MJQA 4NXGA 1ESIA 2JKTI 3NOTC 1FIKA 3W4PA 3MFDA 4LGWA 1OTDA 2P04A 3PTEA 3HLBA 1J9MA 4OKPA 3FYZA 3O87A 4DE3A 1I5QA 1P9RA 3VP4A 3DWZA 2QJ7A 4Q0IA 4UQIS 3CG5A 2PYRA 5EE8A 1MC0A 1P9WA 3FV7A 4WL9A 4YINA 3D4FA 1K25A 4M3KA 4E04A 1ACFA 2JKRI 3IWQA 1PI4A 4LV0A 3E4OA 1ZHHB 2XEPA 4EBNA 4KZ7A 4HH2A 5F6AA 4GDNA 1PYYA 4WEJA 2G2UA 3QNBA 1FR6A 1W79A 2FZ0A 3HLEA 3CITA 2WUQA 1I2SA 4HIAA 1H0MA 3G2ZA 5TFQA 4X68A 3LIAA 2V9AA 1GHPA
chains in the Genus database with same CATH topology
5EVIC 5FAOA 4P0MA 5FDHA 4U3TA 2RCXA 3VOYA 2Y91A 3HVFA 4OVDA 1ERMA 3O86A 2ZC6B 1FR1A 3CJMA 3BRMA 1FSWA 5U47A 1BT5A 5TGFA 2C5WB 3VMAA 4D2OA 4QU3A 4UAAA 1K6RA 3N7WA 4S2LA 4OQHA 1IKGA 5DVAA 5F1FA 1BTLA 1GCEA 1KVMA 3N4IA 4FH2A 4ZTKA 5FATA 1IKIA 5I94A 1FCOA 3HLCA 4N1HA 1ZKJA 4DRTA 1ES2A 4LV2A 4RYEA 1XA1A 4GOGA 2A3UA 5KZHA 2Y4AA 3BM6A 1YLYA 2EXBA 4OP5A 2EXAA 3A3JA 4X56A 3MZFA 3UDXA 4WZ5C 1LHYA 1FCMA 4FCFA 2XFTA 1XGIA 2EFUA 4HESA 1KE0A 4E3IA 3HLDA 2Y2IA 2H10A 3IXHA 4GN2A 4K0XA 4X69A 4Y7PA 1K4FA 5GHZA 4LENA 3VP3A 1E3UA 4OQIA 3EQUA 4JXVA 5IHVA 2XD1A 2ZC7A 3SH7A 4GDBA 3RXWA 3C4OA 3UE0A 3WRTA 4ZBEA 2QPNA 1JWVA 1PI5A 4QY5A 3ZG8B 2DRWA 5CGSA 4ZDXA 4MBKA 4ZJ3A 2HP6A 3ZG9B 2A49A 1BLCA 1KGEA 4JLFA 4E3MA 3Q1FA 3ZNYA 4Y0UA 1W7FA 1FOFA 1K38A 3WS5A 1LL9A 1N4OA 3O88A 4JPMA 3BFDA 4LV1A 1BLHA 1JTDA 1ZG6A 2JCHA 1OMEA 4R3BA 1I2WA 2Y2KA 5HFOA 2IWCA 5J8XA 2JC7A 1MPLA 4PPRA 2ZQCA 1K55C 1BUEA 2Y2LA 2XH9A 3LY3A 1DJBA 3V39A 1PWGA 2XR0A 2P9VB 2WKEA 4EUZA 3ZVWA 1EWZA 4NK3A 3HUOA 3SS5A 1U60A 4OPZA 2Y2HA 3C4PA 3AGDA 3ITAA 4WBGA 3Q7VB 4IBXA 1HTZA 1ONHA 5FQMA 4JBFA 4KG5A 1Z6FA 3NBLA 3M6HA 2ZJ9A 5GLBA 3UPOA 1VM1A 1KDSA 3S22A 1H8YA 5TR7A 1PWCA 4CPKA 2Q9MA 3W4OA 4FD8A 1BSGA 3HREA 5F82A 1L0FA 3ZG0A 1BLPA 5AQBA 3AGEA 4C3QA 2WZXA 4OLDA 5EVIA 1LLBA 3BLSA 2J9PA 2Z2MB 2J7VA 3W8KA 2JE5A 2XQZA 2H0TA 3C5AA 1YLZA 4QHCA 3C7UA 3I7JA 3A3EA 1EI5A 4IBRA 4JF6A 5F83A 1ES4A 5G18A 5A91A 3VP1A 4EV4A 2V2FF 5HW3A 3HLWA 3PAGA 1JWZA 3HBRA 3IF6C 3UDFA 1LI9A 3P98A 4UHUA 4DF6A 1KGFA 4C6YA 3C7VA 4QY6A 4E3KA 1CEGA 3DTMA 2ZM8A 4OLGA 3G2YA 3NCKA 4B4ZA 5D3OA 4ZJ2A 3MXRA 3JYIA 4WZ5A 4BL2A 1IYOA 5GL9A 5KSCA 5FI6A 1LI0A 2WGVA 3TSGA 4EBLA 2OSUA 5EPHA 4WM9A 3V5MA 4BLMA 4LV3A 3MXSA 2FFYA 2G2WA 1KE4A 1MWTA 4WELA 4S2NC 3IWIA 1H5XA 2UWXA 4ID4A 4DDYA 4RA7A 3VSKA 3FKVA 4CJNA 1MKIA 2X02A 1ZG4A 3B3XA 4U0XA 3IH8A 3Q7ZA 1TEMA 1M40A 4Z9QA 3ZCZA 3IHBA 4XXRA 5CRFA 3GVBA 1K56A 1RGZA 3GR2A 1TDGA 3UPNA 5HX9A 1TVFA 2HDUA 3VFHA 4OOYA 4Y0OA 3PBNA 1ES5A 4K91A 1NZOA 3UE1A 5EUAA 3UNWA 1N9BA 3S4XA 3G30A 1K57C 2Y2NA 2ZC5B 5E43A 1K55A 5CERA 1G68A 2EX8A 3QHYA 1CEFA 2XK1A 1H8ZA 5CECA 1BZAA 1XPBA 4KQOA 4XUXA 3WRZA 3OPRA 1MWRA 1EROA 3BEBA 4EWFA 1L0DA 1YLWA 1MY8A 2HDQA 2C6WB 2Y59A 3QNCA 4OH0A 4S2PA 5FQQA 2ZQAA 3NC8A 1CI9A 1MBLA 3NI9A 3RJUA 3VP2A 4E3OA 2B5RA 2Y2MA 3IQAA 3BLMA 3G31A 1HVBA 1YQSA 3IXDA 4EBPA 3NDEA 4JF4A 4R1GA 4S2MA 2ZQ9A 4EQIA 2OLVA 1HZOA 4GNUA 3GMWA 1L2SA 3WS0A 4DE0A 1DJCA 4UA9A 1XKZA 3GQZA 4O7DA 5E2EA 1NJ4A 4MEZA 1PWDA 1YLTA 5CHJA 3NDGA 4JF5A 3UN7A 5GLDA 4N1XA 1NXYA 2IWBA 1SHVA 3OPHA 4QD4A 4P87A 4E3NA 2J9OA 4X53A 5DF9A 4BD0A 3IF6A 2EX2A 4PM5A 3WWXA 3OZHA 2H5SA 3N8SA 5EOEA 2H0YA 1IELA 1C3BA 3CMZA 5DTKA 3UY6A 3SS4A 3M2KA 4BD1A 1IYPA 1PIOA 1SKFA 2WADA 4DXBA 3HUNA 3W4QA 5FQIA 3LCEA 2HP9A 5CXWA 3N8RA 3OC2A 3UE3A 2Y2OA 5A92A 4X6TA 2WGWA 2ZM0A 5AQAA 1KGGA 5FSRA 2VGJA 3V3RA 4GZBA 1IEMA 4E3JA 2OV5A 1NRFA 3PBSA 3IF5A 5A93A 4JXWA 2EX9A 3A3FA 5GLCA 2IWDA 5FASA 1MWUA 5HAIA 3O3VA 1PW8A 1Q2QA 3BFCA 3WS4A 4S2NA 4KZ4A 5CHUA 1JWPA 2E8IA 2ZC3B 4PMAA 1NZUA 3G32A 1ONGA 3LEZA 1IYSA 4PM9A 3LY4A 1NYYA 4OONA 2V1ZA 3DWKA 3GTCA 1W5DA 1W8QA 1PZPA 4N9KA 2WZZA 1W8YA 4IVKA 5BOHA 4OPRA 3Q82A 3GSGA 1QMFA 3OPPA 3IXBA 5E2GA 4LCLA 1FCNA 4BJPA 3BFEA 4KZBA 3ZGAB 2WK0A 1K54C 4WZ4A 4JXSA 2GDNA 2ZMAA 1DY6A 5F1GA 1GA9A 3HL9A 4DDSA 1AXBA 1PZOA 2PU2A 3S1YA 3VOZA 4HEFA 4OOMA 3BFGA 3TOIA 1YM1A 4OQGA 4PM8A 3PBRA 3BYDA 5KSHA 4KG6A 2HPBA 3V50A 5CTMA 1SDEA 2ZQDA 1S0WA 1GHIA 4IEDA 4IVIA 5DF8A 1DJAA 5CTNA 4E6XA 2BG1A 3ZG5A 4UA6A 1ESUA 3BFFA 3GV9A 3ITBA 4GB7A 4MNRA 2QZ6A 2BLSA 4C75A 4K0WA 1JVJA 4GD6A 4E6WA 2Y55A 4MLLA 4ZAMA 3ZDJA 4MBHA 1L0EA 4DE2A 2R9XA 4X55A 5CHMA 5FAQA 3VP0A 3HLGA 4RX3A 2HP5A 2WGIA 2Y2JA 2XLNA 1WYCA 5E2FA 3PBQA 4BQMA 1E3UD 1JTGA 3IF6B 1NY0A 4QJGA 4S2IA 4R4SA 4RVAA 2QMIA 1FSYA 5HL1A 1WE4A 5FQ9A 1YT4A 2CC1A 4YFMA 2P9VA 5AQ9A 3UDIA 1MXOA 3VSLA 3ZVTA 4Y0TA 5JYOA 2Q9NA 2ZQ7A 4QB8A 4UA7A 3HLFA 2HDSA 1YLPA 4XUZA 3Q81A 4R3JA 3UO9A 3SH9A 4KZAA 4N9LA 2WGWB 3MZEA 3UPPA 1GHMA 3M6BA 5GHXA 1KE3A 4OPYA 2WAEA 5HAQA 3IT9A 3PBOA 1ALQA 5AQ7A 3V3SA 3FWLA 5M1AA 5FA7A 1KVLA 1GA0A 4LCMA 3ZHHA 2XF3A 1MWSA 4WEKA 2X01A 3G34A 2PBYA 3NIAA 2Z2LB 1O7EA 5EVIB 3ISGA 2J8YA 4WMCA 2Y2QA 2Y2GA 4JKTA 1RGYA 5HARA 1XA7A 1RP5A 1SCWA 2VGKA 3ZG7B 1NYMA 2JBFA 5HAPA 1SDNA 5DTTA 5A90A 3BECA 1QMEA 5FI2A 4BENA 2ZM2A 4S2OA 1WYBA 4BL3A 4R0QA 3E2KA 1CK3A 4KQQA 1O07A 2EFXA 2ZLYA 4HBUA 5FQKA 5FAPA 4DE1A 3TG9A 1BLSA 2DNSA 5GLAA 4OP8A 4F94A 2XDMA 1Y54A 3G4PA 1IYQA 1E4DA 4H8RA 4B88A 4KQRA 1K54A 5EVID 4PM7A 2V20A 1ERQA 4PM6A 4B4XA 4FH4A 1Q2PA 4WYYA 3A3IA 2RL3A 5FI7A 2R9WA 1XP4A 1G6AA 4KZ5A 1ES3A 1ZC2A 1S6RA 1ESIA 5CEDA 2XD5A 3ZNTA 1L0GA 1TDLA 3MKFA 3W4PA 3IWOA 4GKUA 1VQQA 1FQGA 3MFDA 3WS2A 4GD8A 2ZD8A 3N6IA 3FZCA 2Y2PA 3FKWA 4L0LA 3RXXA 5DTSA 4OOLA 4A5RA 1YMSA 3PTEA 5GHYA 3SS3A 4ZJ1A 1E25A 1CI8A 2EX6A 1J9MA 3HLBA 4KZ3A 4OKPA 4OPQA 3FYZA 3IXGA 1K4EA 2ZC4B 3O87A 5EVLA 5CGXA 3MKEA 4P85A 4DE3A 1I5QA 3NY4A 4DKIA 3VP4A 4S2JA 5E2HA 3DWZA 3WS1A 1LL5A 1K57A 5KMWA 3GRJA 4R23A 5DF7A 3OCNA 1K6SA 4KZ9A 2WYXA 5CEBA 1K56D 3PBTA 4MBFA 3CG5A 3SH8A 5CGWA 4R4RA 5EE8A 5M18A 2I72A 3MZDA 2X71A 1RCJA 5JYPA 4S2KA 2ZQ8A 4JXGA 3OCLA 3PAEA 3FV7A 2WKIA 4YINA 3AGFA 3HUMA 3EQVA 3D4FA 3OPLA 1YLJA 3A3DA 4NETA 4RX2A 3SOIA 1K25A 5M19A 3P09A 4M3KA 3IH9A 2P74A 3IHAA 4E3LA 3Q07A 1YMXA 1PW1A 3IWQA 1PI4A 3VFFA 3ZFZA 1BULA 4LV0A 4KZ6A 5FQJA 2XEPA 1XGJA 4KENB 4EBNA 4KZ7A 5EECA 1M6KA 3LO7A 4GDNA 3G35A 4KG2A 1PYYA 4U0TA 2FFFB 4HBTA 4Q8IA 2XGNA 3CZDA 1XXMA 1XX2A 2OLUA 2G2UA 2WAFA 3N8LA 3QNBA 2DCFA 3MBZA 4P6BA 4WEJA 1FR6A 1W79A 2HDRA 4WMCD 1KDWA 3E2LA 3HLEA 2WUQA 1I2SA 2XFSA 4DXCA 1HD8A 4FSFA 4KZ8A 3Q7VA 4OQ0A 3G2ZA 3M2JA 4N92A 5L2FA 2WKHA 5TFQA 4X68A 3DW0A 2PU4A 5EOOA 1GHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVI C;  5FAO A;  4P0M A;  5FDH A;  4U3T A;  2RCX A;  3VOY A;  2Y91 A;  3HVF A;  4OVD A;  1ERM A;  3O86 A;  2ZC6 B;  1FR1 A;  3CJM A;  3BRM A;  1FSW A;  5U47 A;  1BT5 A;  5TGF A;  2C5W B;  3VMA A;  4D2O A;  4QU3 A;  4UAA A;  1K6R A;  3N7W A;  4S2L A;  4OQH A;  1IKG A;  5DVA A;  5F1F A;  1BTL A;  1GCE A;  1KVM A;  3N4I A;  4FH2 A;  4ZTK A;  5FAT A;  1IKI A;  5I94 A;  1FCO A;  3HLC A;  4N1H A;  1ZKJ A;  4DRT A;  1ES2 A;  4LV2 A;  4RYE A;  1XA1 A;  4GOG A;  2A3U A;  5KZH A;  2Y4A A;  3BM6 A;  1YLY A;  2EXB A;  4OP5 A;  2EXA A;  3A3J A;  4X56 A;  3MZF A;  3UDX A;  4WZ5 C;  1LHY A;  1FCM A;  4FCF A;  2XFT A;  1XGI A;  2EFU A;  4HES A;  1KE0 A;  4E3I A;  3HLD A;  2Y2I A;  2H10 A;  3IXH A;  4GN2 A;  4K0X A;  4X69 A;  4Y7P A;  1K4F A;  5GHZ A;  4LEN A;  3VP3 A;  1E3U A;  4OQI A;  3EQU A;  4JXV A;  5IHV A;  2XD1 A;  2ZC7 A;  3SH7 A;  4GDB A;  3RXW A;  3C4O A;  3UE0 A;  3WRT A;  4ZBE A;  2QPN A;  1JWV A;  1PI5 A;  4QY5 A;  3ZG8 B;  2DRW A;  5CGS A;  4ZDX A;  4MBK A;  4ZJ3 A;  2HP6 A;  3ZG9 B;  2A49 A;  1BLC A;  1KGE A;  4JLF A;  4E3M A;  3Q1F A;  3ZNY A;  4Y0U A;  1W7F A;  1FOF A;  1K38 A;  3WS5 A;  1LL9 A;  1N4O A;  3O88 A;  4JPM A;  3BFD A;  4LV1 A;  1BLH A;  1JTD A;  1ZG6 A;  2JCH A;  1OME A;  4R3B A;  1I2W A;  2Y2K A;  5HFO A;  2IWC A;  5J8X A;  2JC7 A;  1MPL A;  4PPR A;  2ZQC A;  1K55 C;  1BUE A;  2Y2L A;  2XH9 A;  3LY3 A;  1DJB A;  3V39 A;  1PWG A;  2XR0 A;  2P9V B;  2WKE A;  4EUZ A;  3ZVW A;  1EWZ A;  4NK3 A;  3HUO A;  3SS5 A;  1U60 A;  4OPZ A;  2Y2H A;  3C4P A;  3AGD A;  3ITA A;  4WBG A;  3Q7V B;  4IBX A;  1HTZ A;  1ONH A;  5FQM A;  4JBF A;  4KG5 A;  1Z6F A;  3NBL A;  3M6H A;  2ZJ9 A;  5GLB A;  3UPO A;  1VM1 A;  1KDS A;  3S22 A;  1H8Y A;  5TR7 A;  1PWC A;  4CPK A;  2Q9M A;  3W4O A;  4FD8 A;  1BSG A;  3HRE A;  5F82 A;  1L0F A;  3ZG0 A;  1BLP A;  5AQB A;  3AGE A;  4C3Q A;  2WZX A;  4OLD A;  5EVI A;  1LLB A;  3BLS A;  2J9P A;  2Z2M B;  2J7V A;  3W8K A;  2JE5 A;  2XQZ A;  2H0T A;  3C5A A;  1YLZ A;  4QHC A;  3C7U A;  3I7J A;  3A3E A;  1EI5 A;  4IBR A;  4JF6 A;  5F83 A;  1ES4 A;  5G18 A;  5A91 A;  3VP1 A;  4EV4 A;  2V2F F;  5HW3 A;  3HLW A;  3PAG A;  1JWZ A;  3HBR A;  3IF6 C;  3UDF A;  1LI9 A;  3P98 A;  4UHU A;  4DF6 A;  1KGF A;  4C6Y A;  3C7V A;  4QY6 A;  4E3K A;  1CEG A;  3DTM A;  2ZM8 A;  4OLG A;  3G2Y A;  3NCK A;  4B4Z A;  5D3O A;  4ZJ2 A;  3MXR A;  3JYI A;  4WZ5 A;  4BL2 A;  1IYO A;  5GL9 A;  5KSC A;  5FI6 A;  1LI0 A;  2WGV A;  3TSG A;  4EBL A;  2OSU A;  5EPH A;  4WM9 A;  3V5M A;  4BLM A;  4LV3 A;  3MXS A;  2FFY A;  2G2W A;  1KE4 A;  1MWT A;  4WEL A;  4S2N C;  3IWI A;  1H5X A;  2UWX A;  4ID4 A;  4DDY A;  4RA7 A;  3VSK A;  3FKV A;  4CJN A;  1MKI A;  2X02 A;  1ZG4 A;  3B3X A;  4U0X A;  3IH8 A;  3Q7Z A;  1TEM A;  1M40 A;  4Z9Q A;  3ZCZ A;  3IHB A;  4XXR A;  5CRF A;  3GVB A;  1K56 A;  1RGZ A;  3GR2 A;  1TDG A;  3UPN A;  5HX9 A;  1TVF A;  2HDU A;  3VFH A;  4OOY A;  4Y0O A;  3PBN A;  1ES5 A;  4K91 A;  1NZO A;  3UE1 A;  5EUA A;  3UNW A;  1N9B A;  3S4X A;  3G30 A;  1K57 C;  2Y2N A;  2ZC5 B;  5E43 A;  1K55 A;  5CER A;  1G68 A;  2EX8 A;  3QHY A;  1CEF A;  2XK1 A;  1H8Z A;  5CEC A;  1BZA A;  1XPB A;  4KQO A;  4XUX A;  3WRZ A;  3OPR A;  1MWR A;  1ERO A;  3BEB A;  4EWF A;  1L0D A;  1YLW A;  1MY8 A;  2HDQ A;  2C6W B;  2Y59 A;  3QNC A;  4OH0 A;  4S2P A;  5FQQ A;  2ZQA A;  3NC8 A;  1CI9 A;  1MBL A;  3NI9 A;  3RJU A;  3VP2 A;  4E3O A;  2B5R A;  2Y2M A;  3IQA A;  3BLM A;  3G31 A;  1HVB A;  1YQS A;  3IXD A;  4EBP A;  3NDE A;  4JF4 A;  4R1G A;  4S2M A;  2ZQ9 A;  4EQI A;  2OLV A;  1HZO A;  4GNU A;  3GMW A;  1L2S A;  3WS0 A;  4DE0 A;  1DJC A;  4UA9 A;  1XKZ A;  3GQZ A;  4O7D A;  5E2E A;  1NJ4 A;  4MEZ A;  1PWD A;  1YLT A;  5CHJ A;  3NDG A;  4JF5 A;  3UN7 A;  5GLD A;  4N1X A;  1NXY A;  2IWB A;  1SHV A;  3OPH A;  4QD4 A;  4P87 A;  4E3N A;  2J9O A;  4X53 A;  5DF9 A;  4BD0 A;  3IF6 A;  2EX2 A;  4PM5 A;  3WWX A;  3OZH A;  2H5S A;  3N8S A;  5EOE A;  2H0Y A;  1IEL A;  1C3B A;  3CMZ A;  5DTK A;  3UY6 A;  3SS4 A;  3M2K A;  4BD1 A;  1IYP A;  1PIO A;  1SKF A;  2WAD A;  4DXB A;  3HUN A;  3W4Q A;  5FQI A;  3LCE A;  2HP9 A;  5CXW A;  3N8R A;  3OC2 A;  3UE3 A;  2Y2O A;  5A92 A;  4X6T A;  2WGW A;  2ZM0 A;  5AQA A;  1KGG A;  5FSR A;  2VGJ A;  3V3R A;  4GZB A;  1IEM A;  4E3J A;  2OV5 A;  1NRF A;  3PBS A;  3IF5 A;  5A93 A;  4JXW A;  2EX9 A;  3A3F A;  5GLC A;  2IWD A;  5FAS A;  1MWU A;  5HAI A;  3O3V A;  1PW8 A;  1Q2Q A;  3BFC A;  3WS4 A;  4S2N A;  4KZ4 A;  5CHU A;  1JWP A;  2E8I A;  2ZC3 B;  4PMA A;  1NZU A;  3G32 A;  1ONG A;  3LEZ A;  1IYS A;  4PM9 A;  3LY4 A;  1NYY A;  4OON A;  2V1Z A;  3DWK A;  3GTC A;  1W5D A;  1W8Q A;  1PZP A;  4N9K A;  2WZZ A;  1W8Y A;  4IVK A;  5BOH A;  4OPR A;  3Q82 A;  3GSG A;  1QMF A;  3OPP A;  3IXB A;  5E2G A;  4LCL A;  1FCN A;  4BJP A;  3BFE A;  4KZB A;  3ZGA B;  2WK0 A;  1K54 C;  4WZ4 A;  4JXS A;  2GDN A;  2ZMA A;  1DY6 A;  5F1G A;  1GA9 A;  3HL9 A;  4DDS A;  1AXB A;  1PZO A;  2PU2 A;  3S1Y A;  3VOZ A;  4HEF A;  4OOM A;  3BFG A;  3TOI A;  1YM1 A;  4OQG A;  4PM8 A;  3PBR A;  3BYD A;  5KSH A;  4KG6 A;  2HPB A;  3V50 A;  5CTM A;  1SDE A;  2ZQD A;  1S0W A;  1GHI A;  4IED A;  4IVI A;  5DF8 A;  1DJA A;  5CTN A;  4E6X A;  2BG1 A;  3ZG5 A;  4UA6 A;  1ESU A;  3BFF A;  3GV9 A;  3ITB A;  4GB7 A;  4MNR A;  2QZ6 A;  2BLS A;  4C75 A;  4K0W A;  1JVJ A;  4GD6 A;  4E6W A;  2Y55 A;  4MLL A;  4ZAM A;  3ZDJ A;  4MBH A;  1L0E A;  4DE2 A;  2R9X A;  4X55 A;  5CHM A;  5FAQ A;  3VP0 A;  3HLG A;  4RX3 A;  2HP5 A;  2WGI A;  2Y2J A;  2XLN A;  1WYC A;  5E2F A;  3PBQ A;  4BQM A;  1E3U D;  1JTG A;  3IF6 B;  1NY0 A;  4QJG A;  4S2I A;  4R4S A;  4RVA A;  2QMI A;  1FSY A;  5HL1 A;  1WE4 A;  5FQ9 A;  1YT4 A;  2CC1 A;  4YFM A;  2P9V A;  5AQ9 A;  3UDI A;  1MXO A;  3VSL A;  3ZVT A;  4Y0T A;  5JYO A;  2Q9N A;  2ZQ7 A;  4QB8 A;  4UA7 A;  3HLF A;  2HDS A;  1YLP A;  4XUZ A;  3Q81 A;  4R3J A;  3UO9 A;  3SH9 A;  4KZA A;  4N9L A;  2WGW B;  3MZE A;  3UPP A;  1GHM A;  3M6B A;  5GHX A;  1KE3 A;  4OPY A;  2WAE A;  5HAQ A;  3IT9 A;  3PBO A;  1ALQ A;  5AQ7 A;  3V3S A;  3FWL A;  5M1A A;  5FA7 A;  1KVL A;  1GA0 A;  4LCM A;  3ZHH A;  2XF3 A;  1MWS A;  4WEK A;  2X01 A;  3G34 A;  2PBY A;  3NIA A;  2Z2L B;  1O7E A;  5EVI B;  3ISG A;  2J8Y A;  4WMC A;  2Y2Q A;  2Y2G A;  4JKT A;  1RGY A;  5HAR A;  1XA7 A;  1RP5 A;  1SCW A;  2VGK A;  3ZG7 B;  1NYM A;  2JBF A;  5HAP A;  1SDN A;  5DTT A;  5A90 A;  3BEC A;  1QME A;  5FI2 A;  4BEN A;  2ZM2 A;  4S2O A;  1WYB A;  4BL3 A;  4R0Q A;  3E2K A;  1CK3 A;  4KQQ A;  1O07 A;  2EFX A;  2ZLY A;  4HBU A;  5FQK A;  5FAP A;  4DE1 A;  3TG9 A;  1BLS A;  2DNS A;  5GLA A;  4OP8 A;  4F94 A;  2XDM A;  1Y54 A;  3G4P A;  1IYQ A;  1E4D A;  4H8R A;  4B88 A;  4KQR A;  1K54 A;  5EVI D;  4PM7 A;  2V20 A;  1ERQ A;  4PM6 A;  4B4X A;  4FH4 A;  1Q2P A;  4WYY A;  3A3I A;  2RL3 A;  5FI7 A;  2R9W A;  1XP4 A;  1G6A A;  4KZ5 A;  1ES3 A;  1ZC2 A;  1S6R A;  1ESI A;  5CED A;  2XD5 A;  3ZNT A;  1L0G A;  1TDL A;  3MKF A;  3W4P A;  3IWO A;  4GKU A;  1VQQ A;  1FQG A;  3MFD A;  3WS2 A;  4GD8 A;  2ZD8 A;  3N6I A;  3FZC A;  2Y2P A;  3FKW A;  4L0L A;  3RXX A;  5DTS A;  4OOL A;  4A5R A;  1YMS A;  3PTE A;  5GHY A;  3SS3 A;  4ZJ1 A;  1E25 A;  1CI8 A;  2EX6 A;  1J9M A;  3HLB A;  4KZ3 A;  4OKP A;  4OPQ A;  3FYZ A;  3IXG A;  1K4E A;  2ZC4 B;  3O87 A;  5EVL A;  5CGX A;  3MKE A;  4P85 A;  4DE3 A;  1I5Q A;  3NY4 A;  4DKI A;  3VP4 A;  4S2J A;  5E2H A;  3DWZ A;  3WS1 A;  1LL5 A;  1K57 A;  5KMW A;  3GRJ A;  4R23 A;  5DF7 A;  3OCN A;  1K6S A;  4KZ9 A;  2WYX A;  5CEB A;  1K56 D;  3PBT A;  4MBF A;  3CG5 A;  3SH8 A;  5CGW A;  4R4R A;  5EE8 A;  5M18 A;  2I72 A;  3MZD A;  2X71 A;  1RCJ A;  5JYP A;  4S2K A;  2ZQ8 A;  4JXG A;  3OCL A;  3PAE A;  3FV7 A;  2WKI A;  4YIN A;  3AGF A;  3HUM A;  3EQV A;  3D4F A;  3OPL A;  1YLJ A;  3A3D A;  4NET A;  4RX2 A;  3SOI A;  1K25 A;  5M19 A;  3P09 A;  4M3K A;  3IH9 A;  2P74 A;  3IHA A;  4E3L A;  3Q07 A;  1YMX A;  1PW1 A;  3IWQ A;  1PI4 A;  3VFF A;  3ZFZ A;  1BUL A;  4LV0 A;  4KZ6 A;  5FQJ A;  2XEP A;  1XGJ A;  4KEN B;  4EBN A;  4KZ7 A;  5EEC A;  1M6K A;  3LO7 A;  4GDN A;  3G35 A;  4KG2 A;  1PYY A;  4U0T A;  2FFF B;  4HBT A;  4Q8I A;  2XGN A;  3CZD A;  1XXM A;  1XX2 A;  2OLU A;  2G2U A;  2WAF A;  3N8L A;  3QNB A;  2DCF A;  3MBZ A;  4P6B A;  4WEJ A;  1FR6 A;  1W79 A;  2HDR A;  4WMC D;  1KDW A;  3E2L A;  3HLE A;  2WUQ A;  1I2S A;  2XFS A;  4DXC A;  1HD8 A;  4FSF A;  4KZ8 A;  3Q7V A;  4OQ0 A;  3G2Z A;  3M2J A;  4N92 A;  5L2F A;  2WKH A;  5TFQ A;  4X68 A;  3DW0 A;  2PU4 A;  5EOO A;  1GHP A; 
#chains in the Genus database with same CATH topology
 5EVI C;  2RCX A;  3HVF A;  3CJM A;  3LIB A;  3MS6 A;  2LB5 A;  4I38 A;  5U47 A;  2OWJ A;  4QU3 A;  3N7W A;  5DVA A;  4OQH A;  1IKG A;  3HJI A;  1KVM A;  4FH2 A;  4N1H A;  1ZKJ A;  4NXE A;  4DJ3 A;  2PR5 A;  3E4Q A;  3UDX A;  4X56 A;  2J3T D;  3MZF A;  1LHY A;  3PHY A;  1FCM A;  4FCF A;  3KO6 A;  4X69 A;  2O9C A;  3VP3 A;  5IHV A;  2XD1 A;  3RXW A;  3UE0 A;  3KSG A;  4ZBE A;  2ZOH A;  3ZG8 B;  3FC7 A;  4ZDX A;  5J7E A;  2O0Y A;  2XRO A;  2ZBB A;  3TE8 A;  3Q1F A;  3WS5 A;  1N4O A;  1PNE A;  3EGD C;  4LV1 A;  1JTD A;  2JCH A;  4R3B A;  5HFO A;  2IWC A;  1XJ2 A;  1BUE A;  2XR0 A;  1BYW A;  2WKE A;  3SS5 A;  1DP6 A;  1U60 A;  3IX8 A;  1VEU A;  3NBL A;  3UPO A;  1PWC A;  3B42 A;  4CPK A;  3ZG0 A;  5AQB A;  4B93 A;  2V1A A;  5J4E A;  1J3W A;  3C5A A;  5F68 A;  1YLZ A;  3VP1 A;  4CLC C;  1ES4 A;  1GSW A;  4R6L A;  4EV4 A;  3CI6 A;  3HLW A;  5MC7 A;  3PAG A;  4ARZ B;  3HBR A;  3OOV A;  4DN0 A;  3C7V A;  4E3K A;  4OLG A;  3NCK A;  3MXR A;  4WZ5 A;  4BL2 A;  2JN7 A;  4H6J B;  5HL6 A;  1LI0 A;  2IA2 A;  2WGV A;  4CQH A;  5EPH A;  3V5M A;  3SZT A;  2FFY A;  2A24 B;  2UWX A;  4ID4 A;  3LR0 A;  2L1M A;  2V1B A;  5IU1 A;  1VHM A;  2J80 A;  3IH8 A;  1TEM A;  4Z9Q A;  5G4Y A;  4XXR A;  5CRF A;  5F5Y A;  3GR2 A;  3UPN A;  2HDU A;  2W3F A;  2KLI A;  2WKP A;  1K55 A;  2L4R A;  5CER A;  1YPR A;  1CEF A;  2HJE A;  1BZA A;  2PDR A;  2ZL1 A;  1ERO A;  1L0D A;  2HDQ A;  2C6W B;  3QNC A;  1K0K A;  4F3L A;  4WF0 A;  3VP2 A;  3IQA A;  2Y2M A;  4EBP A;  4JF4 A;  1XKZ A;  3H7W A;  1CF0 A;  3G6O A;  2ZOI A;  3T4T A;  1XFQ A;  3GEC A;  2M7V A;  4X53 A;  4IUK A;  3OZH A;  3ICY A;  2H5S A;  2W27 A;  1AWI A;  3R7W B;  4DXB A;  3LCE A;  3A0S A;  4WLA A;  5A92 A;  2WGW A;  3LI8 A;  5EM1 A;  4E3J A;  1P0Z A;  1GSX A;  4G3K A;  3PBS A;  3IF5 A;  4JXW A;  2EX9 A;  2IWD A;  2QHK A;  3DTK A;  1PW8 A;  4I3A A;  3KSH A;  3LI9 A;  5CHU A;  3UB5 P;  4PMA A;  4PHT A;  3G32 A;  4PM9 A;  3IX4 A;  1Z09 A;  2V1Z A;  3DWK A;  3FG8 A;  3BW6 A;  3GTC A;  2JHE A;  2ZMF A;  4IVK A;  2V8F A;  5BOH A;  1GSV A;  3KSF A;  1NLZ A;  1F5M A;  5E2G A;  4BJP A;  3CUE C;  3BFE A;  2WK0 A;  4WZ4 A;  3T1Q B;  4JXS A;  4P6Z S;  4MCW A;  4GLQ A;  4XT2 B;  3VOZ A;  4HEF A;  4BWI A;  2OAQ 1;  3T4K A;  5FDS A;  3V50 A;  5HD3 A;  1GHI A;  4IVI A;  4E6X A;  3LYX A;  4GB7 A;  2BLS A;  3QP5 A;  3P7N A;  3ZDJ A;  1L0E A;  2R9X A;  3T4S A;  5FAQ A;  3B47 A;  4RX3 A;  4HNB A;  1JTG A;  1OT9 A;  2HZ5 A;  1FSY A;  2CC1 A;  4YFM A;  3VSL A;  1MXO A;  3ZVT A;  5JYO A;  3T1X A;  3UO9 A;  1T1C A;  3SH9 A;  3S7O A;  3F1N A;  3LEQ A;  4HY8 A;  2D01 A;  4HP4 A;  5AQ7 A;  5HDD A;  2Z2L B;  1RGY A;  1RP5 A;  1NYM A;  2JBF A;  2W1T A;  1IOU A;  5FI2 A;  2ZM2 A;  1WYB A;  3S7N A;  3ZYT A;  4HBU A;  1ZTU A;  2OAP 1;  2XDM A;  3G4P A;  2V8C A;  2BAS A;  2V20 A;  3LGO A;  3A3I A;  1LL8 A;  5FI7 A;  2R9W A;  4LPZ A;  1ZC2 A;  4EU0 A;  2P08 A;  3ZNT A;  1TDL A;  4L9F A;  2I9V A;  1VQQ A;  1FQG A;  2K31 A;  2ZD8 A;  2Y2P A;  3D9Y A;  4YOF A;  2D02 A;  4OOL A;  5TBM B;  3SS3 A;  4Y15 A;  5CGX A;  3LIF A;  3NY4 A;  4DKI A;  4S2J A;  3WS1 A;  3MF0 A;  1NWZ A;  1P97 A;  5KMW A;  3OCN A;  4HH3 A;  2WYX A;  1K56 D;  1NRJ A;  3SH8 A;  5M18 A;  3MZD A;  4I39 A;  1RCJ A;  2ZQ8 A;  3OCL A;  4PKY A;  1YSP A;  3EQV A;  4RX2 A;  4NET A;  3SOI A;  5M19 A;  3Q07 A;  1PW1 A;  3ZFZ A;  1LT0 A;  3MQ0 A;  4KEN B;  3TJZ C;  3PXP A;  3LO7 A;  4KG2 A;  1S4S A;  1SKO B;  3N8L A;  5DTS A;  2OLU A;  2WAF A;  2DCF A;  5C5K A;  4WMC D;  1KDW A;  2XFS A;  1HD8 A;  4FSF A;  4KZ8 A;  3T50 A;  5DFY A;  4N92 A;  2HV1 A;  3UB9 A;  3VOY A;  2Y91 A;  4OVD A;  1FR1 A;  4KUK A;  1GCE A;  4ZTK A;  5FAT A;  1FCO A;  5FEG A;  1XA1 A;  4GOG A;  2A3U A;  3BWL A;  4OP5 A;  2EXA A;  1XGI A;  1KE0 A;  3HLD A;  2Y2I A;  4ESP A;  1G28 A;  4LEN A;  3WRT A;  4QY5 A;  2DRW A;  5CGS A;  2VA0 A;  3ZG9 B;  2A49 A;  2YKF A;  1V9Z A;  4Y0U A;  1K38 A;  1LL9 A;  4JGQ A;  3BFD A;  3UB7 A;  1BLH A;  1ZG6 A;  4HJ4 A;  5J8X A;  5HWW A;  1T1B A;  1DJB A;  5KIZ A;  1PWG A;  3IBR A;  4EUZ A;  2XA7 M;  2Y2H A;  3C4P A;  3NEC A;  3ITA A;  3Q7V B;  4IBX A;  4JBF A;  5I5L A;  1G6O A;  4GS9 A;  5TR7 A;  4BMW A;  2Q9M A;  3W4O A;  3HRE A;  1BLP A;  3AGE A;  2OOL A;  5DKL A;  4OLD A;  3RFB A;  1UWP X;  2JKF A;  3JVV A;  5HPF A;  2M1C A;  3R4K A;  3C7U A;  4E3N A;  5AVF A;  5A91 A;  5HW3 A;  1KGF A;  4C6Y A;  2B95 A;  1TF1 A;  3DTM A;  4Y3I A;  3G2Y A;  3PR6 A;  4EEU A;  4B4Z A;  2VV8 A;  5D3O A;  3JVU A;  3C8C A;  1Y4O A;  4I3I A;  2VV6 A;  4WEL A;  4S2N C;  4DJ2 A;  4DDY A;  3VSK A;  4X25 A;  4CJN A;  3B3X A;  3Q7Z A;  3IHB A;  1K56 A;  2H28 A;  4OOY A;  1OTB A;  5G4Z A;  5A8B A;  3UE1 A;  1VET A;  4GCZ A;  2K7S A;  1N9B A;  4II7 A;  3G30 A;  4QPR A;  3S4X A;  3UNW A;  2Y2N A;  2ZC5 B;  2HF6 A;  2EX8 A;  3QHY A;  1S4R A;  3F1O B;  4HQA A;  4YNR A;  3T4L A;  2XK1 A;  5CEC A;  3T12 B;  4EWF A;  1YLW A;  4S2P A;  4MN7 A;  1MBL A;  3RJU A;  3NI9 A;  5EFW A;  3IXD A;  1HVB A;  3W2Z A;  3NDE A;  3JPU A;  2ZQ9 A;  2OLV A;  1HZO A;  3GMW A;  3HCY A;  3WS0 A;  3GQZ A;  4MEZ A;  1F2K A;  1PWD A;  1YLT A;  3CLO A;  4N1X A;  4EES A;  3OPH A;  4QD4 A;  5HZH A;  4P87 A;  5DF9 A;  4BD0 A;  3IF6 A;  4PM5 A;  1SKO A;  1N9O A;  3H9W A;  3N8S A;  2R78 A;  1KOU A;  2H0Y A;  5EOE A;  1W63 Q;  3LID A;  3CMZ A;  5DTK A;  3SS4 A;  1IYP A;  3EWK A;  5CXW A;  3N8R A;  2Y2O A;  4PKY G;  2XA7 S;  2OV5 A;  2WKQ A;  1UGU A;  1NRF A;  2VZW A;  4MDZ A;  3L9K A;  3OBF A;  3D72 A;  4NXB A;  2E8I A;  1NZU A;  3LIE A;  3LEZ A;  1IYS A;  3C38 A;  3LY4 A;  1NYY A;  3KX0 X;  4OPR A;  3OPP A;  3V67 A;  2GJ3 A;  3NUL A;  1OJ5 A;  4FUW A;  3QP2 A;  1L3L A;  2ZMA A;  1DY6 A;  5F1G A;  1GA9 A;  1TS7 A;  4HOI A;  5HDC A;  5K5B A;  1PZO A;  2Z6C A;  2PRF A;  4ETX A;  4OQG A;  4KG6 A;  2HPB A;  1HLU P;  5LBR A;  1S0W A;  3MSH A;  4IED A;  5DF8 A;  2W3G A;  1LSV A;  1ESU A;  4UA6 A;  4MNR A;  2QZ6 A;  4C75 A;  1JVJ A;  4GD6 A;  3F1P A;  4R3A A;  4NXF A;  2VV7 A;  3KYZ A;  3O5Y A;  4IJG A;  5J3W A;  3HLG A;  2Y2J A;  2WGI A;  3BQA A;  2XLN A;  3PBQ A;  3A0R A;  4BQM A;  1E3U D;  3UB8 A;  4S2I A;  2L0W A;  2PR6 A;  5HL1 A;  4MN5 A;  4Y0T A;  2WKR A;  3C2W A;  2Q9N A;  4NKP A;  4QB8 A;  3HLF A;  2HDS A;  1YLP A;  4R3J A;  4KZA A;  4RQ9 A;  4Q0H A;  2PBD P;  4OPY A;  1ALQ A;  3V3S A;  2ZMV A;  3QP8 A;  2XF3 A;  3FPW A;  2X01 A;  3TW8 A;  3G34 A;  2PBY A;  2VGL M;  5EVI B;  2J8Y A;  2Y2G A;  1XA7 A;  1SCW A;  5DTT A;  1QME A;  4S2O A;  4BL3 A;  3E2K A;  4KQQ A;  1O07 A;  2ZLY A;  2DNS A;  5GLA A;  1Y54 A;  1IYQ A;  2CMN A;  4B88 A;  1K54 A;  5EVI D;  4PM7 A;  4B4X A;  2EWV A;  4FH4 A;  2O9B A;  2FH5 A;  1XP4 A;  5CED A;  2XD5 A;  1L0G A;  4X1L A;  1JNU A;  3IWO A;  4GKU A;  4Y5F A;  4IHQ A;  4GD8 A;  3N6I A;  4L0L A;  3RXX A;  4JGP A;  5GHY A;  1E25 A;  1CI8 A;  2EX6 A;  4KZ3 A;  2ZC4 B;  4Y13 A;  1LL5 A;  1K57 A;  3GRJ A;  4R23 A;  5DF7 A;  4R4R A;  2X71 A;  1N9L A;  4S2K A;  2EWW A;  3LR3 A;  5EM0 A;  3PAE A;  2WKI A;  3UMD A;  3HUM A;  1T19 A;  3A3D A;  3P09 A;  2LB9 A;  3IH9 A;  3IHA A;  4E3L A;  4IUH A;  4KZ6 A;  4JGO A;  1XGJ A;  4CLC B;  5EEC A;  3B33 A;  1M6K A;  3G35 A;  2MJ6 A;  4HBT A;  4Q8I A;  2XGN A;  3CZD A;  1XXM A;  2HDR A;  3IS2 B;  4DXC A;  4MN6 A;  5L2F A;  2WKH A;  1OTI A;  3LR4 A;  2PU4 A;  5FAO A;  4P0M A;  4U3T A;  2B18 A;  4CLC D;  1ERM A;  3O86 A;  2ZC6 B;  1BT5 A;  5TGF A;  3UE6 A;  4D2O A;  1K6R A;  4S2L A;  1BTL A;  3N4I A;  5HD5 A;  2NUP C;  5I94 A;  2KDK A;  2Y79 A;  5L8M A;  4LV2 A;  4ARZ A;  4MMN A;  5KZH A;  3BM6 A;  1YLY A;  3T4Q A;  4WZ5 C;  2XFT A;  4GN2 A;  4K0X A;  4Y7P A;  5HDS A;  5GHZ A;  1D1J A;  1E3U A;  5HPI A;  4JXV A;  3SH7 A;  4GDB A;  3C4O A;  4H6J A;  3TRC A;  2QPN A;  4JGR A;  4PAU A;  4MBK A;  2Z6D A;  2QKP A;  1OTA A;  2HP6 A;  2A24 A;  5TJJ A;  1KGE A;  4E3M A;  1W7F A;  1FOF A;  3O88 A;  4X1M A;  4JPM A;  1I2W A;  1MPL A;  1K55 C;  2Y2L A;  3LY3 A;  3V39 A;  2P9V B;  1TS8 A;  3ZVW A;  1EWZ A;  4NK3 A;  3HUO A;  3AGD A;  1TS6 A;  5HWV A;  1HTZ A;  1ONH A;  4CLC E;  3E0Y A;  3M6H A;  5GLB A;  1VM1 A;  1H8Y A;  5F82 A;  5EVI A;  3EEA A;  3K3D A;  5CX7 A;  2J9P A;  2J7V A;  1TS0 A;  3W8K A;  2JE5 A;  2XQZ A;  1F98 A;  3BY9 A;  4QHC A;  4JF6 A;  3A3E A;  1EI5 A;  5F83 A;  3FPV A;  1JWZ A;  3UDF A;  1LI9 A;  3P98 A;  4QY6 A;  4UQI M;  3P01 A;  4AFI A;  2ZM8 A;  3S7Q A;  4ZJ2 A;  1UWN X;  3JYI A;  4ZRR A;  1IYO A;  3R7W A;  5KSC A;  1OPX A;  3LUQ A;  1KE4 A;  1MWT A;  3IWI A;  1H5X A;  1T1A A;  4RA7 A;  2X02 A;  1ZG4 A;  1MZU A;  3VE4 A;  3ZCZ A;  3KSI A;  2XRN A;  3GVB A;  1RGZ A;  1TDG A;  3PBN A;  1ES5 A;  1K57 C;  5E43 A;  1LSX A;  1G68 A;  1VEU B;  1H8Z A;  4KQO A;  4XUX A;  3OPR A;  1SZV A;  4XT2 A;  1CQA A;  3BEB A;  2O99 A;  1MY8 A;  1STZ A;  4OH0 A;  3HJK A;  5FQQ A;  1Y28 A;  2ZQA A;  4EQ1 A;  3BY8 A;  3NC8 A;  4E3O A;  2B5R A;  3BLM A;  3G31 A;  3E98 A;  4R1G A;  4S2M A;  3QP4 A;  1YSQ A;  4LLO B;  4DE0 A;  4UA9 A;  2PD8 A;  4FTX A;  4JF5 A;  5GLD A;  1NXY A;  4WUJ A;  1SHV A;  4CLC A;  2J9O A;  4Y17 A;  2UV0 E;  3WWX A;  5L09 A;  1C3B A;  3UY6 A;  1SKF A;  3HUN A;  3W4Q A;  5FQI A;  2E8J A;  4X6T A;  2ZM0 A;  5AQA A;  1WA9 A;  3EOI A;  4BBU A;  5IT5 A;  3V3R A;  4I5S A;  1OJG A;  3VV4 A;  3A3F A;  5GLC A;  5FAS A;  5HAI A;  3WS4 A;  4EW7 A;  4KZ4 A;  1JWP A;  2ZC3 B;  4K08 A;  5F69 A;  2HJ9 C;  4OON A;  1W5D A;  4N9K A;  1PZP A;  3SW1 A;  2WZZ A;  4HJ6 A;  1S1Z A;  1OTE A;  3GSG A;  1QMF A;  1YKD A;  3H82 B;  4LCL A;  1FCN A;  4KZB A;  3ZGA B;  2GDN A;  4DDS A;  2ZL1 B;  1AXB A;  3S1Y A;  3BFG A;  3TOI A;  5KSH A;  4F3L B;  2QWS A;  4EEP A;  1DJA A;  5CTN A;  2BG1 A;  4R70 A;  3GV9 A;  3ITB A;  3ULF A;  4K0W A;  1V9Y A;  2Y55 A;  4MLL A;  4ZAM A;  3H7W B;  4DE2 A;  4X55 A;  4EUV A;  3VP0 A;  4D60 A;  2HP5 A;  5DJT A;  5E2F A;  1NY0 A;  4QJG A;  4RVA A;  2QMI A;  4YWZ A;  5FQ9 A;  1PFL A;  1YT4 A;  2P9V A;  5TBM A;  5AVE A;  2ZQ7 A;  4UA7 A;  3Q81 A;  4N9L A;  2WGW B;  3MZE A;  5HWT A;  3UPP A;  1GHM A;  3MR0 A;  1KE3 A;  2WAE A;  2W0N A;  3PBO A;  3DAV A;  3QP1 A;  3FWL A;  4BBV A;  5L10 A;  3U2A A;  3ZHH A;  1MWS A;  4WEK A;  3NJA A;  4WMC A;  4JKT A;  2VGK A;  5HAP A;  1SDN A;  1YAX A;  2EFX A;  5FQK A;  5FAP A;  4G3W A;  4F94 A;  1X0O A;  4HI4 A;  3CUE A;  4KQR A;  4PM6 A;  1Q2P A;  4WYY A;  2PD7 A;  5DFX A;  1G6A A;  4KZ5 A;  1S6R A;  4DMZ A;  3E4P A;  2W3H A;  1DRM A;  5L07 A;  3MKF A;  4O0P A;  3WS2 A;  3VE3 A;  1S67 L;  3CPT B;  2OWH A;  3FZC A;  3FKW A;  3LFV A;  4M4X A;  4A5R A;  1XJ4 A;  1YMS A;  3ZQ5 A;  4ZJ1 A;  4QWO A;  4HP9 A;  4OPQ A;  2W3E A;  3IXG A;  1K4E A;  1T18 A;  3DTE A;  5EVL A;  3F1N B;  3MKE A;  4P85 A;  5E2H A;  4BBT A;  1K6S A;  4KZ9 A;  2VK3 A;  3GDI A;  5CEB A;  3PBT A;  4MBF A;  2GZA A;  3KYE A;  5CGW A;  4HHD A;  2I72 A;  3IBJ A;  5JYP A;  4JXG A;  3AGF A;  3OPL A;  2W1T B;  1YLJ A;  4P6Z M;  2K2N A;  4I3J A;  2P74 A;  3IX3 A;  3PYP A;  4LRZ E;  1PRQ A;  1YMX A;  3C30 A;  3VFF A;  1BUL A;  1G5U A;  5FQJ A;  1CJF A;  4U0T A;  2FFF B;  3MMH A;  4P6B A;  1XX2 A;  1H3Q A;  3MBZ A;  3E2L A;  3T4J A;  2JKT M;  4NG2 A;  3OLO A;  3Q7V A;  4OQ0 A;  3M2J A;  4WN5 A;  1VB6 A;  3DW0 A;  5EOO A;  4Q0J A;  5FDH A;  3MQQ A;  3BRM A;  2V0W A;  1FSW A;  1EW0 A;  5DKK A;  2C5W B;  2VEA A;  3VMA A;  1S1Y A;  4UAA A;  5F1F A;  2EA9 A;  3K2N A;  1IKI A;  3HLC A;  3H82 A;  4DRT A;  1A0K A;  2PAV P;  1ES2 A;  2V0U A;  4RYE A;  4EER A;  2Y4A A;  2EXB A;  3A3J A;  2O9A A;  5EVE A;  2EFU A;  4HES A;  4E3I A;  3IXH A;  3K3C A;  2H10 A;  4NEE D;  1K4F A;  4B9O A;  4OQI A;  3EQU A;  2ZC7 A;  2B02 A;  4EXO A;  1JWV A;  1PI5 A;  4ZJ3 A;  2JKR M;  1W63 M;  3EGX C;  3D3O A;  1DP9 A;  1XFN A;  1BLC A;  4JLF A;  3ZNY A;  4FOF A;  1ODV A;  1OME A;  3L7H A;  2Y2K A;  5FEF A;  2JC7 A;  1D7E A;  4PPR A;  2ZQC A;  3DBA A;  3T1R A;  2XH9 A;  4OPZ A;  3F1O A;  4WBG A;  5FQM A;  4KG5 A;  1Z6F A;  2ZJ9 A;  1KDS A;  3EEH A;  3U4L P;  2AVX A;  1MKM A;  3S22 A;  1DP8 A;  4FD8 A;  1BSG A;  2NUT C;  1L0F A;  3MQO A;  3CHW P;  4C3Q A;  2WZX A;  3VOL A;  2XSS A;  2PHY A;  4L9E A;  1LLB A;  3BLS A;  5IS1 A;  2Z2M B;  2G7U A;  2H0T A;  4G3V A;  1D06 A;  3I7J A;  4IBR A;  5G18 A;  3NOU C;  2V2F F;  4LRX C;  3IF6 C;  2JKG A;  4DF6 A;  4UHU A;  1CEG A;  3NOP C;  5GL9 A;  5FI6 A;  3TSG A;  3LR5 A;  4EBL A;  2OSU A;  1TD5 A;  4WM9 A;  4BLM A;  3A0V A;  4LV3 A;  3MXS A;  2G2W A;  4GHI B;  1IFQ A;  2VKS A;  3DTI A;  3FKV A;  4O8G A;  1MKI A;  4O01 A;  4U0X A;  1M40 A;  4UEY A;  1LSW A;  2A2L A;  3CPT A;  5HX9 A;  1TVF A;  1N9N A;  3VFH A;  2ACG A;  4Y0O A;  4K91 A;  2P7J A;  1NZO A;  2J3W A;  5EUA A;  2VGL S;  1H8M A;  3T4O A;  1XPB A;  3WRZ A;  4GS9 B;  1MWR A;  2Y59 A;  2PYP A;  4KQD A;  1CI9 A;  1YQS A;  4EQI A;  4GNU A;  4LFU A;  1L2S A;  3CWF A;  1DJC A;  5E2E A;  4O7D A;  1NJ4 A;  5CHJ A;  4ETZ A;  3NDG A;  3UN7 A;  2IWB A;  3T1S A;  2EX2 A;  2GNX A;  1IEL A;  1XJ6 A;  3M2K A;  4BD1 A;  1PIO A;  2WAD A;  2HP9 A;  2PT7 A;  3OC2 A;  3UE3 A;  4GJ4 A;  4R38 A;  1FIL A;  4HJ3 A;  1KGG A;  5FSR A;  3UB6 A;  3KYQ A;  2VGJ A;  4GZB A;  1IEM A;  5A93 A;  4KUO A;  1MWU A;  3O3V A;  1Q2Q A;  3BFC A;  5DJU A;  4S2N A;  2KOI A;  2BTF P;  4ME4 A;  4Y2F A;  1S66 L;  1ONG A;  1OT6 A;  5AJG A;  4EET B;  1W8Q A;  1VET B;  1W8Y A;  3Q82 A;  2DMW A;  3IXB A;  3UME A;  2QYB A;  1K54 C;  3HL9 A;  2PU2 A;  4L9G A;  4OOM A;  1YM1 A;  2YKH A;  4PM8 A;  3PBR A;  3BYD A;  5CTM A;  1SDE A;  2ZQD A;  2Q0O A;  2J3T C;  4GW9 A;  2HGV A;  3ZG5 A;  3BFF A;  2VLG A;  4E6W A;  2QJ5 A;  4MBH A;  3S7P A;  2INW A;  5CHM A;  2W3D A;  2M7U A;  5FL3 A;  1WYC A;  3RTY A;  3IF6 B;  4R4S A;  1WE4 A;  5AQ9 A;  3UDI A;  2W1R A;  2GX5 A;  4XUZ A;  4LRY C;  4Z1W A;  3M6B A;  5GHX A;  3MXQ A;  5HAQ A;  3IT9 A;  3QP6 A;  1F9I A;  5M1A A;  5FA7 A;  1KVL A;  1XJ3 A;  3LIC A;  1GA0 A;  4LCM A;  5EV0 A;  3NIA A;  1O7E A;  3ISG A;  2Y2Q A;  5HAR A;  1NLY A;  3MFX A;  3ZG7 B;  5A90 A;  2VJW A;  3BEC A;  4BEN A;  3BQ8 A;  3RH8 B;  4R0Q A;  1CK3 A;  3NHQ A;  5HSQ A;  4DE1 A;  2KX6 A;  3TG9 A;  2Y8H A;  1BLS A;  4OP8 A;  1E4D A;  4H8R A;  1ERQ A;  2RL3 A;  3IS2 A;  3BJN A;  3CAX A;  4GHI A;  2VX8 A;  3F1P B;  1ES3 A;  3MJQ A;  4NXG A;  1ESI A;  2JKT I;  3NOT C;  1FIK A;  3W4P A;  3MFD A;  4LGW A;  1OTD A;  2P04 A;  3PTE A;  3HLB A;  1J9M A;  4OKP A;  3FYZ A;  3O87 A;  4DE3 A;  1I5Q A;  1P9R A;  3VP4 A;  3DWZ A;  2QJ7 A;  4Q0I A;  4UQI S;  3CG5 A;  2PYR A;  5EE8 A;  1MC0 A;  1P9W A;  3FV7 A;  4WL9 A;  4YIN A;  3D4F A;  1K25 A;  4M3K A;  4E04 A;  1ACF A;  2JKR I;  3IWQ A;  1PI4 A;  4LV0 A;  3E4O A;  1ZHH B;  2XEP A;  4EBN A;  4KZ7 A;  4HH2 A;  5F6A A;  4GDN A;  1PYY A;  4WEJ A;  2G2U A;  3QNB A;  1FR6 A;  1W79 A;  2FZ0 A;  3HLE A;  3CIT A;  2WUQ A;  1I2S A;  4HIA A;  1H0M A;  3G2Z A;  5TFQ A;  4X68 A;  3LIA A;  2V9A A;  1GHP A; 
#chains in the Genus database with same CATH homology
 5EVI C;  5FAO A;  4P0M A;  5FDH A;  4U3T A;  2RCX A;  3VOY A;  2Y91 A;  3HVF A;  4OVD A;  1ERM A;  3O86 A;  2ZC6 B;  1FR1 A;  3CJM A;  3BRM A;  1FSW A;  5U47 A;  1BT5 A;  5TGF A;  2C5W B;  3VMA A;  4D2O A;  4QU3 A;  4UAA A;  1K6R A;  3N7W A;  4S2L A;  4OQH A;  1IKG A;  5DVA A;  5F1F A;  1BTL A;  1GCE A;  1KVM A;  3N4I A;  4FH2 A;  4ZTK A;  5FAT A;  1IKI A;  5I94 A;  1FCO A;  3HLC A;  4N1H A;  1ZKJ A;  4DRT A;  1ES2 A;  4LV2 A;  4RYE A;  1XA1 A;  4GOG A;  2A3U A;  5KZH A;  2Y4A A;  3BM6 A;  1YLY A;  2EXB A;  4OP5 A;  2EXA A;  3A3J A;  4X56 A;  3MZF A;  3UDX A;  4WZ5 C;  1LHY A;  1FCM A;  4FCF A;  2XFT A;  1XGI A;  2EFU A;  4HES A;  1KE0 A;  4E3I A;  3HLD A;  2Y2I A;  2H10 A;  3IXH A;  4GN2 A;  4K0X A;  4X69 A;  4Y7P A;  1K4F A;  5GHZ A;  4LEN A;  3VP3 A;  1E3U A;  4OQI A;  3EQU A;  4JXV A;  5IHV A;  2XD1 A;  2ZC7 A;  3SH7 A;  4GDB A;  3RXW A;  3C4O A;  3UE0 A;  3WRT A;  4ZBE A;  2QPN A;  1JWV A;  1PI5 A;  4QY5 A;  3ZG8 B;  2DRW A;  5CGS A;  4ZDX A;  4MBK A;  4ZJ3 A;  2HP6 A;  3ZG9 B;  2A49 A;  1BLC A;  1KGE A;  4JLF A;  4E3M A;  3Q1F A;  3ZNY A;  4Y0U A;  1W7F A;  1FOF A;  1K38 A;  3WS5 A;  1LL9 A;  1N4O A;  3O88 A;  4JPM A;  3BFD A;  4LV1 A;  1BLH A;  1JTD A;  1ZG6 A;  2JCH A;  1OME A;  4R3B A;  1I2W A;  2Y2K A;  5HFO A;  2IWC A;  5J8X A;  2JC7 A;  1MPL A;  4PPR A;  2ZQC A;  1K55 C;  1BUE A;  2Y2L A;  2XH9 A;  3LY3 A;  1DJB A;  3V39 A;  1PWG A;  2XR0 A;  2P9V B;  2WKE A;  4EUZ A;  3ZVW A;  1EWZ A;  4NK3 A;  3HUO A;  3SS5 A;  1U60 A;  4OPZ A;  2Y2H A;  3C4P A;  3AGD A;  3ITA A;  4WBG A;  3Q7V B;  4IBX A;  1HTZ A;  1ONH A;  5FQM A;  4JBF A;  4KG5 A;  1Z6F A;  3NBL A;  3M6H A;  2ZJ9 A;  5GLB A;  3UPO A;  1VM1 A;  1KDS A;  3S22 A;  1H8Y A;  5TR7 A;  1PWC A;  4CPK A;  2Q9M A;  3W4O A;  4FD8 A;  1BSG A;  3HRE A;  5F82 A;  1L0F A;  3ZG0 A;  1BLP A;  5AQB A;  3AGE A;  4C3Q A;  2WZX A;  4OLD A;  5EVI A;  1LLB A;  3BLS A;  2J9P A;  2Z2M B;  2J7V A;  3W8K A;  2JE5 A;  2XQZ A;  2H0T A;  3C5A A;  1YLZ A;  4QHC A;  3C7U A;  3I7J A;  3A3E A;  1EI5 A;  4IBR A;  4JF6 A;  5F83 A;  1ES4 A;  5G18 A;  5A91 A;  3VP1 A;  4EV4 A;  2V2F F;  5HW3 A;  3HLW A;  3PAG A;  1JWZ A;  3HBR A;  3IF6 C;  3UDF A;  1LI9 A;  3P98 A;  4UHU A;  4DF6 A;  1KGF A;  4C6Y A;  3C7V A;  4QY6 A;  4E3K A;  1CEG A;  3DTM A;  2ZM8 A;  4OLG A;  3G2Y A;  3NCK A;  4B4Z A;  5D3O A;  4ZJ2 A;  3MXR A;  3JYI A;  4WZ5 A;  4BL2 A;  1IYO A;  5GL9 A;  5KSC A;  5FI6 A;  1LI0 A;  2WGV A;  3TSG A;  4EBL A;  2OSU A;  5EPH A;  4WM9 A;  3V5M A;  4BLM A;  4LV3 A;  3MXS A;  2FFY A;  2G2W A;  1KE4 A;  1MWT A;  4WEL A;  4S2N C;  3IWI A;  1H5X A;  2UWX A;  4ID4 A;  4DDY A;  4RA7 A;  3VSK A;  3FKV A;  4CJN A;  1MKI A;  2X02 A;  1ZG4 A;  3B3X A;  4U0X A;  3IH8 A;  3Q7Z A;  1TEM A;  1M40 A;  4Z9Q A;  3ZCZ A;  3IHB A;  4XXR A;  5CRF A;  3GVB A;  1K56 A;  1RGZ A;  3GR2 A;  1TDG A;  3UPN A;  5HX9 A;  1TVF A;  2HDU A;  3VFH A;  4OOY A;  4Y0O A;  3PBN A;  1ES5 A;  4K91 A;  1NZO A;  3UE1 A;  5EUA A;  3UNW A;  1N9B A;  3S4X A;  3G30 A;  1K57 C;  2Y2N A;  2ZC5 B;  5E43 A;  1K55 A;  5CER A;  1G68 A;  2EX8 A;  3QHY A;  1CEF A;  2XK1 A;  1H8Z A;  5CEC A;  1BZA A;  1XPB A;  4KQO A;  4XUX A;  3WRZ A;  3OPR A;  1MWR A;  1ERO A;  3BEB A;  4EWF A;  1L0D A;  1YLW A;  1MY8 A;  2HDQ A;  2C6W B;  2Y59 A;  3QNC A;  4OH0 A;  4S2P A;  5FQQ A;  2ZQA A;  3NC8 A;  1CI9 A;  1MBL A;  3NI9 A;  3RJU A;  3VP2 A;  4E3O A;  2B5R A;  2Y2M A;  3IQA A;  3BLM A;  3G31 A;  1HVB A;  1YQS A;  3IXD A;  4EBP A;  3NDE A;  4JF4 A;  4R1G A;  4S2M A;  2ZQ9 A;  4EQI A;  2OLV A;  1HZO A;  4GNU A;  3GMW A;  1L2S A;  3WS0 A;  4DE0 A;  1DJC A;  4UA9 A;  1XKZ A;  3GQZ A;  4O7D A;  5E2E A;  1NJ4 A;  4MEZ A;  1PWD A;  1YLT A;  5CHJ A;  3NDG A;  4JF5 A;  3UN7 A;  5GLD A;  4N1X A;  1NXY A;  2IWB A;  1SHV A;  3OPH A;  4QD4 A;  4P87 A;  4E3N A;  2J9O A;  4X53 A;  5DF9 A;  4BD0 A;  3IF6 A;  2EX2 A;  4PM5 A;  3WWX A;  3OZH A;  2H5S A;  3N8S A;  5EOE A;  2H0Y A;  1IEL A;  1C3B A;  3CMZ A;  5DTK A;  3UY6 A;  3SS4 A;  3M2K A;  4BD1 A;  1IYP A;  1PIO A;  1SKF A;  2WAD A;  4DXB A;  3HUN A;  3W4Q A;  5FQI A;  3LCE A;  2HP9 A;  5CXW A;  3N8R A;  3OC2 A;  3UE3 A;  2Y2O A;  5A92 A;  4X6T A;  2WGW A;  2ZM0 A;  5AQA A;  1KGG A;  5FSR A;  2VGJ A;  3V3R A;  4GZB A;  1IEM A;  4E3J A;  2OV5 A;  1NRF A;  3PBS A;  3IF5 A;  5A93 A;  4JXW A;  2EX9 A;  3A3F A;  5GLC A;  2IWD A;  5FAS A;  1MWU A;  5HAI A;  3O3V A;  1PW8 A;  1Q2Q A;  3BFC A;  3WS4 A;  4S2N A;  4KZ4 A;  5CHU A;  1JWP A;  2E8I A;  2ZC3 B;  4PMA A;  1NZU A;  3G32 A;  1ONG A;  3LEZ A;  1IYS A;  4PM9 A;  3LY4 A;  1NYY A;  4OON A;  2V1Z A;  3DWK A;  3GTC A;  1W5D A;  1W8Q A;  1PZP A;  4N9K A;  2WZZ A;  1W8Y A;  4IVK A;  5BOH A;  4OPR A;  3Q82 A;  3GSG A;  1QMF A;  3OPP A;  3IXB A;  5E2G A;  4LCL A;  1FCN A;  4BJP A;  3BFE A;  4KZB A;  3ZGA B;  2WK0 A;  1K54 C;  4WZ4 A;  4JXS A;  2GDN A;  2ZMA A;  1DY6 A;  5F1G A;  1GA9 A;  3HL9 A;  4DDS A;  1AXB A;  1PZO A;  2PU2 A;  3S1Y A;  3VOZ A;  4HEF A;  4OOM A;  3BFG A;  3TOI A;  1YM1 A;  4OQG A;  4PM8 A;  3PBR A;  3BYD A;  5KSH A;  4KG6 A;  2HPB A;  3V50 A;  5CTM A;  1SDE A;  2ZQD A;  1S0W A;  1GHI A;  4IED A;  4IVI A;  5DF8 A;  1DJA A;  5CTN A;  4E6X A;  2BG1 A;  3ZG5 A;  4UA6 A;  1ESU A;  3BFF A;  3GV9 A;  3ITB A;  4GB7 A;  4MNR A;  2QZ6 A;  2BLS A;  4C75 A;  4K0W A;  1JVJ A;  4GD6 A;  4E6W A;  2Y55 A;  4MLL A;  4ZAM A;  3ZDJ A;  4MBH A;  1L0E A;  4DE2 A;  2R9X A;  4X55 A;  5CHM A;  5FAQ A;  3VP0 A;  3HLG A;  4RX3 A;  2HP5 A;  2WGI A;  2Y2J A;  2XLN A;  1WYC A;  5E2F A;  3PBQ A;  4BQM A;  1E3U D;  1JTG A;  3IF6 B;  1NY0 A;  4QJG A;  4S2I A;  4R4S A;  4RVA A;  2QMI A;  1FSY A;  5HL1 A;  1WE4 A;  5FQ9 A;  1YT4 A;  2CC1 A;  4YFM A;  2P9V A;  5AQ9 A;  3UDI A;  1MXO A;  3VSL A;  3ZVT A;  4Y0T A;  5JYO A;  2Q9N A;  2ZQ7 A;  4QB8 A;  4UA7 A;  3HLF A;  2HDS A;  1YLP A;  4XUZ A;  3Q81 A;  4R3J A;  3UO9 A;  3SH9 A;  4KZA A;  4N9L A;  2WGW B;  3MZE A;  3UPP A;  1GHM A;  3M6B A;  5GHX A;  1KE3 A;  4OPY A;  2WAE A;  5HAQ A;  3IT9 A;  3PBO A;  1ALQ A;  5AQ7 A;  3V3S A;  3FWL A;  5M1A A;  5FA7 A;  1KVL A;  1GA0 A;  4LCM A;  3ZHH A;  2XF3 A;  1MWS A;  4WEK A;  2X01 A;  3G34 A;  2PBY A;  3NIA A;  2Z2L B;  1O7E A;  5EVI B;  3ISG A;  2J8Y A;  4WMC A;  2Y2Q A;  2Y2G A;  4JKT A;  1RGY A;  5HAR A;  1XA7 A;  1RP5 A;  1SCW A;  2VGK A;  3ZG7 B;  1NYM A;  2JBF A;  5HAP A;  1SDN A;  5DTT A;  5A90 A;  3BEC A;  1QME A;  5FI2 A;  4BEN A;  2ZM2 A;  4S2O A;  1WYB A;  4BL3 A;  4R0Q A;  3E2K A;  1CK3 A;  4KQQ A;  1O07 A;  2EFX A;  2ZLY A;  4HBU A;  5FQK A;  5FAP A;  4DE1 A;  3TG9 A;  1BLS A;  2DNS A;  5GLA A;  4OP8 A;  4F94 A;  2XDM A;  1Y54 A;  3G4P A;  1IYQ A;  1E4D A;  4H8R A;  4B88 A;  4KQR A;  1K54 A;  5EVI D;  4PM7 A;  2V20 A;  1ERQ A;  4PM6 A;  4B4X A;  4FH4 A;  1Q2P A;  4WYY A;  3A3I A;  2RL3 A;  5FI7 A;  2R9W A;  1XP4 A;  1G6A A;  4KZ5 A;  1ES3 A;  1ZC2 A;  1S6R A;  1ESI A;  5CED A;  2XD5 A;  3ZNT A;  1L0G A;  1TDL A;  3MKF A;  3W4P A;  3IWO A;  4GKU A;  1VQQ A;  1FQG A;  3MFD A;  3WS2 A;  4GD8 A;  2ZD8 A;  3N6I A;  3FZC A;  2Y2P A;  3FKW A;  4L0L A;  3RXX A;  5DTS A;  4OOL A;  4A5R A;  1YMS A;  3PTE A;  5GHY A;  3SS3 A;  4ZJ1 A;  1E25 A;  1CI8 A;  2EX6 A;  1J9M A;  3HLB A;  4KZ3 A;  4OKP A;  4OPQ A;  3FYZ A;  3IXG A;  1K4E A;  2ZC4 B;  3O87 A;  5EVL A;  5CGX A;  3MKE A;  4P85 A;  4DE3 A;  1I5Q A;  3NY4 A;  4DKI A;  3VP4 A;  4S2J A;  5E2H A;  3DWZ A;  3WS1 A;  1LL5 A;  1K57 A;  5KMW A;  3GRJ A;  4R23 A;  5DF7 A;  3OCN A;  1K6S A;  4KZ9 A;  2WYX A;  5CEB A;  1K56 D;  3PBT A;  4MBF A;  3CG5 A;  3SH8 A;  5CGW A;  4R4R A;  5EE8 A;  5M18 A;  2I72 A;  3MZD A;  2X71 A;  1RCJ A;  5JYP A;  4S2K A;  2ZQ8 A;  4JXG A;  3OCL A;  3PAE A;  3FV7 A;  2WKI A;  4YIN A;  3AGF A;  3HUM A;  3EQV A;  3D4F A;  3OPL A;  1YLJ A;  3A3D A;  4NET A;  4RX2 A;  3SOI A;  1K25 A;  5M19 A;  3P09 A;  4M3K A;  3IH9 A;  2P74 A;  3IHA A;  4E3L A;  3Q07 A;  1YMX A;  1PW1 A;  3IWQ A;  1PI4 A;  3VFF A;  3ZFZ A;  1BUL A;  4LV0 A;  4KZ6 A;  5FQJ A;  2XEP A;  1XGJ A;  4KEN B;  4EBN A;  4KZ7 A;  5EEC A;  1M6K A;  3LO7 A;  4GDN A;  3G35 A;  4KG2 A;  1PYY A;  4U0T A;  2FFF B;  4HBT A;  4Q8I A;  2XGN A;  3CZD A;  1XXM A;  1XX2 A;  2OLU A;  2G2U A;  2WAF A;  3N8L A;  3QNB A;  2DCF A;  3MBZ A;  4P6B A;  4WEJ A;  1FR6 A;  1W79 A;  2HDR A;  4WMC D;  1KDW A;  3E2L A;  3HLE A;  2WUQ A;  1I2S A;  2XFS A;  4DXC A;  1HD8 A;  4FSF A;  4KZ8 A;  3Q7V A;  4OQ0 A;  3G2Z A;  3M2J A;  4N92 A;  5L2F A;  2WKH A;  5TFQ A;  4X68 A;  3DW0 A;  2PU4 A;  5EOO A;  1GHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...