3G3AA

Structure of a lamprey variable lymphocyte receptor in complex with a protein antigen
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
b'ACPSQCSCSGTTVDCSGKSLASVPTGIPTTTQVLYLYDNQITKLEPGVFDRLTQLTRLDLDNNQLTVLPAGVFDKLTQLTQLSLNDNQLKSIPRGAFDNLKSLTHIWLLNNPWDCACSDILYLSRWISQHPGLVFGYLNLDPDSARCSGTNTPVRAVTEASTSPSKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable lymphocyte receptor VLRB.2D
publication title Structure of a lamprey variable lymphocyte receptor in complex with a protein antigen.
pubmed doi rcsb
source organism Petromyzon marinus
molecule tags Hydrolase/immune system
total genus 42
structure length 167
sequence length 167
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF11921 DUF3439 Domain of unknown function (DUF3439)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3g3aA00
3WPFA 3RGXA 1P9AG 2BNHA 4Q62A 4NKGA 1OOKG 1K5GC 4P91A 4EZGA 4XOSA 3P72A 4QC0A 4G8AA 2OMUA 2ID5A 4Z64C 3WPGA 1K5DC 1OTNA 1FO1A 1FQVA 3UL9A 2P1OB 4Q3GA 2CA6A 3REZA 4ARRA 5B0TA 3CIYA 4M7EA 4XGOA 2ASSB 1G9UA 4B8CD 1P8VA 2Z7XA 4J4LA 3W3NA 2P1MB 4BSRA 2WQUA 4FS7A 4U08A 5AWBA 3G06A 4UFRA 3WPEA 1OTOA 3A79B 4XSQA 3RW7A 4Z79A 4FDWA 4I6JB 2WQVA 1H6UA 4BSSA 3ULAA 4LSAA 1OZNA 5AWDA 4KT1A 5CMNA 3C6NB 4V2DA 4AW4A 3G3BA 2Z66A 4ECNA 2RR6A 1LTXA 1YRGA 2XOTA 3W3MA 4K17A 1ZIWA 4PKIG 2WQWA 1DCEA 2IFGA 2UZXA 5GMFA 2OMZA 4CNCA 4LI1A 4FD0A 2V9SA 3W3LA 4J0MA 4GLPA 3KJ4A 4FMZA 2Z7XB 1QYYA 5AWCA 1M9SA 3C6PB 4BV4R 1DS9A 3RFSA 1GWBA 4QXEA 2P1NB 4R6GA 1WWLA 4M7EC 4R0AA 4RCAB 1FS2A 1W8AA 4P8SA 3SB4A 2WFHA 2Z63A 4R6FA 4FCGA 4TZHA 1OGQA 5IYXC 3PMHG 4MN8B 4FHOA 3RW6A 3OGMB 4U7LA 4MQWX 4LXRA 3ZYNA 4KNGA 3TSRE 1KOHA 4R5CA 3ZYIA 3CVRA 2ASTB 1O6SA 2RA8A 4R08A 2Y5QA 5GS2B 5A5CA 4LSXA 2WQXA 5GQRK 3G39A 2Z81A 3OGKB 5FTTB 2P1QB 4ECOA 2JE1A 5LFNA 3ZYOA 3WPIA 2BEXA 1IO0A 3OGLB 3ZYJA 2Z65A 3RFEA 4R6JA 2Z82A 5IJCA 1A9NA 3OJAB 5B0NA 2V9TB 4AY9X 5IJBA 4HQ1A 1OTMA 2P1PB 4OQTA 3ULVA 4CNMA 5HZLB 4WP6A 4Z8GA 3DZEA 5GMHA 5IJDA 3UL8A 3RJ0A 4LSCA 5CMPA 4GT6A 2ELLA 3UN9A 4C2BB 3OJAA 5AZ5A 2O6SA 3W3GA 3VQ1A 4CC4A 4Y61B 4R6AA 3RGZA 1O6TA 1P8TA 4U09A 3M19A 4R5DA 3ULUA 4H09A 3WPDA 2OMXA 3E3ZA 4LI2A 5HDHA 2R9UA 4PQ8A 4R58A 2FT3A 3G04C 4KXFB 3E6JA 4V2CA 1M0ZA 3W3JA 4L3FA 4LSXC 2JQDA 4QBZA 3RFJA 4R07A 3WPBA 3O6NA 4PERA 4Z61C 1M9LA 1DFJI 1O6VA 3FXIA 2O6QA 3VQ2A 2Q4GW 1XKUA 1H6TA 5GS0A 5B4PA 3E2JA 5AWAA 2JE0A 1D0BA 4BSUA 1U0ND 1FT8A 1PGVA 1Z7XW 4RWTC 3JB9j 3C6OB 4V2EA 4R09A 4IM6A 4Q3IA 2Z62A 2V70A 2O6RA 4CP6A 2XWTC 1JL5A 1XCDA 2OMYA 2OMTA 4U06A 3WPHA 4CILA 1XEUA 3GOZA 1SQ0B 3CIGA 5D3IA 4NKHA 3G3AA 2Z64A 3RIZA 4LXSA 4C2AB 2A0ZA 4CC4C 4RCWA 2OMWA 4Z94G 1A4YA 4PSJA 3M18A 2UZYA 2OMVA 3WPCA 4YEBB 4WYKA 1KOOA 3O53A 3UL7A 1XWDC 1M10B 4PEQB 3WN4A 3E4GA 1XECA 3W3KA 4ARNA 4L3AA 5GMGA 3BZ5A
chains in the Genus database with same CATH superfamily
3WPFA 3RGXA 4NZRM 1P9AG 2BNHA 4Q62A 4NKGA 1OOKG 1K5GC 4P91A 4EZGA 4XOSA 3P72A 4QC0A 4G8AA 2OMUA 2ID5A 4Z64C 3WPGA 1K5DC 1OTNA 1FO1A 1FQVA 3UL9A 2P1OB 4Q3GA 2CA6A 3REZA 4ARRA 5B0TA 3CIYA 4M7EA 4XGOA 2ASSB 1G9UA 4B8CD 1P8VA 2Z7XA 4J4LA 3W3NA 2P1MB 4BSRA 2WQUA 4FS7A 4U08A 5AWBA 3G06A 4UFRA 3WPEA 1OTOA 3A79B 4XSQA 3RW7A 4Z79A 4FDWA 4I6JB 2WQVA 1H6UA 4BSSA 3ULAA 4LSAA 1OZNA 5AWDA 4KT1A 5CMNA 3C6NB 4V2DA 4AW4A 3G3BA 2Z66A 4ECNA 2RR6A 1LTXA 1YRGA 2XOTA 3W3MA 4K17A 1ZIWA 4PKIG 2WQWA 1DCEA 2IFGA 2UZXA 5GMFA 2OMZA 4CNCA 4LI1A 4FD0A 2V9SA 3W3LA 4J0MA 4GLPA 3KJ4A 4FMZA 2Z7XB 1QYYA 5AWCA 1M9SA 3C6PB 4BV4R 1DS9A 3RFSA 1GWBA 4QXEA 2P1NB 4R6GA 1WWLA 4M7EC 4R0AA 4RCAB 1FS2A 1W8AA 4P8SA 3SB4A 2WFHA 2Z63A 4R6FA 4FCGA 4TZHA 1OGQA 5IYXC 3PMHG 4MN8B 4FHOA 3RW6A 3OGMB 4U7LA 4MQWX 4LXRA 3ZYNA 4KNGA 3TSRE 1KOHA 4R5CA 3ZYIA 3CVRA 2ASTB 1O6SA 2RA8A 4R08A 2Y5QA 5GS2B 5A5CA 4LSXA 2WQXA 5GQRK 3G39A 2Z81A 3OGKB 4NZTM 2P1QB 5FTTB 4ECOA 2JE1A 5LFNA 3ZYOA 3WPIA 2BEXA 1IO0A 3OGLB 3ZYJA 2Z65A 3RFEA 4R6JA 2Z82A 5IJCA 1A9NA 3OJAB 5B0NA 2V9TB 4AY9X 5IJBA 4HQ1A 1OTMA 2P1PB 4OQTA 3ULVA 4CNMA 5HZLB 4WP6A 4Z8GA 3DZEA 5GMHA 5IJDA 3UL8A 3RJ0A 4LSCA 5CMPA 4GT6A 2ELLA 3UN9A 4C2BB 3OJAA 5AZ5A 2O6SA 3W3GA 3VQ1A 4CC4A 4Y61B 4R6AA 3RGZA 1O6TA 1P8TA 4U09A 3M19A 4R5DA 3ULUA 4H09A 3WPDA 2OMXA 3E3ZA 4LI2A 5HDHA 2R9UA 4PQ8A 4R58A 2FT3A 3G04C 4KXFB 3E6JA 4V2CA 1M0ZA 3W3JA 4L3FA 4LSXC 2JQDA 4QBZA 3RFJA 4R07A 3WPBA 3O6NA 4PERA 4Z61C 1M9LA 1DFJI 1O6VA 3FXIA 2O6QA 3VQ2A 2Q4GW 1XKUA 1H6TA 5GS0A 5B4PA 3E2JA 5AWAA 2JE0A 1D0BA 4BSUA 1U0ND 1FT8A 1PGVA 1Z7XW 4RWTC 3JB9j 3C6OB 4V2EA 4R09A 4IM6A 4Q3IA 2Z62A 2V70A 2O6RA 4CP6A 2XWTC 1JL5A 1XCDA 2OMYA 2OMTA 4U06A 3WPHA 4CILA 1XEUA 3GOZA 1SQ0B 3CIGA 5D3IA 4NKHA 3G3AA 2Z64A 3RIZA 4LXSA 4C2AB 2A0ZA 4CC4C 4RCWA 2OMWA 4Z94G 1A4YA 4PSJA 3M18A 2UZYA 2OMVA 3WPCA 4YEBB 4WYKA 1KOOA 3O53A 3UL7A 1XWDC 1M10B 4PEQB 3WN4A 3E4GA 1XECA 3W3KA 4ARNA 4L3AA 5GMGA 3BZ5A
chains in the Genus database with same CATH topology
3WPFA 3RGXA 1P9AG 2BNHA 4Q62A 4NKGA 1OOKG 1K5GC 4P91A 4EZGA 4XOSA 3P72A 4QC0A 4G8AA 2OMUA 2ID5A 4Z64C 3WPGA 1K5DC 1OTNA 1FO1A 1FQVA 3UL9A 2P1OB 4Q3GA 2CA6A 3REZA 4ARRA 5B0TA 3CIYA 4M7EA 4XGOA 2ASSB 1G9UA 4B8CD 1P8VA 2Z7XA 4J4LA 3W3NA 2P1MB 4BSRA 2WQUA 4FS7A 4U08A 5AWBA 3G06A 4UFRA 3WPEA 1OTOA 3A79B 4XSQA 3RW7A 4Z79A 4FDWA 4I6JB 2WQVA 1H6UA 4BSSA 3ULAA 4LSAA 1OZNA 5AWDA 4KT1A 5CMNA 3C6NB 4V2DA 4AW4A 3G3BA 2Z66A 4ECNA 2RR6A 1LTXA 1YRGA 2XOTA 3W3MA 4K17A 1ZIWA 4PKIG 2WQWA 1DCEA 2IFGA 2UZXA 5GMFA 2OMZA 4CNCA 4LI1A 4FD0A 2V9SA 3W3LA 4J0MA 4GLPA 3KJ4A 4FMZA 2Z7XB 1QYYA 5AWCA 1M9SA 3C6PB 4BV4R 1DS9A 3RFSA 1GWBA 4QXEA 2P1NB 4R6GA 1WWLA 4M7EC 4R0AA 4RCAB 1FS2A 1W8AA 4P8SA 3SB4A 2WFHA 2Z63A 4R6FA 4FCGA 4TZHA 1OGQA 5IYXC 3PMHG 4MN8B 4FHOA 3RW6A 3OGMB 4U7LA 4MQWX 4LXRA 3ZYNA 4KNGA 3TSRE 1KOHA 4R5CA 3ZYIA 3CVRA 2ASTB 1O6SA 2RA8A 4R08A 2Y5QA 5GS2B 5A5CA 4LSXA 2WQXA 5GQRK 3G39A 2Z81A 3OGKB 5FTTB 2P1QB 4ECOA 2JE1A 5LFNA 3ZYOA 3WPIA 2BEXA 1IO0A 3OGLB 3ZYJA 2Z65A 3RFEA 4R6JA 2Z82A 5IJCA 1A9NA 3OJAB 5B0NA 2V9TB 4AY9X 5IJBA 4HQ1A 1OTMA 2P1PB 4OQTA 3ULVA 4CNMA 5HZLB 4WP6A 4Z8GA 3DZEA 5GMHA 5IJDA 3UL8A 3RJ0A 4LSCA 5CMPA 4GT6A 2ELLA 3UN9A 4C2BB 3OJAA 5AZ5A 2O6SA 3W3GA 3VQ1A 4CC4A 4Y61B 4R6AA 3RGZA 1O6TA 1P8TA 4U09A 3M19A 4R5DA 3ULUA 4H09A 3WPDA 2OMXA 3E3ZA 4LI2A 5HDHA 2R9UA 4PQ8A 4R58A 2FT3A 3G04C 4KXFB 3E6JA 4V2CA 1M0ZA 3W3JA 4L3FA 4LSXC 2JQDA 4QBZA 3RFJA 4R07A 3WPBA 3O6NA 4PERA 4Z61C 1M9LA 1DFJI 1O6VA 3FXIA 2O6QA 3VQ2A 2Q4GW 1XKUA 1H6TA 5GS0A 5B4PA 3E2JA 5AWAA 2JE0A 1D0BA 4BSUA 1U0ND 1FT8A 1PGVA 1Z7XW 4RWTC 3JB9j 3C6OB 4V2EA 4R09A 4IM6A 4Q3IA 2Z62A 2V70A 2O6RA 4CP6A 2XWTC 1JL5A 1XCDA 2OMYA 2OMTA 4U06A 3WPHA 4CILA 1XEUA 3GOZA 1SQ0B 3CIGA 5D3IA 4NKHA 3G3AA 2Z64A 3RIZA 4LXSA 4C2AB 2A0ZA 4CC4C 4RCWA 2OMWA 4Z94G 1A4YA 4PSJA 3M18A 2UZYA 2OMVA 3WPCA 4YEBB 4WYKA 1KOOA 3O53A 3UL7A 1XWDC 1M10B 4PEQB 3WN4A 3E4GA 1XECA 3W3KA 4ARNA 4L3AA 5GMGA 3BZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WPF A;  3RGX A;  1P9A G;  2BNH A;  4Q62 A;  4NKG A;  1OOK G;  1K5G C;  4P91 A;  4EZG A;  4XOS A;  3P72 A;  4QC0 A;  4G8A A;  2OMU A;  2ID5 A;  4Z64 C;  3WPG A;  1K5D C;  1OTN A;  1FO1 A;  1FQV A;  3UL9 A;  2P1O B;  4Q3G A;  2CA6 A;  3REZ A;  4ARR A;  5B0T A;  3CIY A;  4M7E A;  4XGO A;  2ASS B;  1G9U A;  4B8C D;  1P8V A;  2Z7X A;  4J4L A;  3W3N A;  2P1M B;  4BSR A;  2WQU A;  4FS7 A;  4U08 A;  5AWB A;  3G06 A;  4UFR A;  3WPE A;  1OTO A;  3A79 B;  4XSQ A;  3RW7 A;  4Z79 A;  4FDW A;  4I6J B;  2WQV A;  1H6U A;  4BSS A;  3ULA A;  4LSA A;  1OZN A;  5AWD A;  4KT1 A;  5CMN A;  3C6N B;  4V2D A;  4AW4 A;  3G3B A;  2Z66 A;  4ECN A;  2RR6 A;  1LTX A;  1YRG A;  2XOT A;  3W3M A;  4K17 A;  1ZIW A;  4PKI G;  2WQW A;  1DCE A;  2IFG A;  2UZX A;  5GMF A;  2OMZ A;  4CNC A;  4LI1 A;  4FD0 A;  2V9S A;  3W3L A;  4J0M A;  4GLP A;  3KJ4 A;  4FMZ A;  2Z7X B;  1QYY A;  5AWC A;  1M9S A;  3C6P B;  4BV4 R;  1DS9 A;  3RFS A;  1GWB A;  4QXE A;  2P1N B;  4R6G A;  1WWL A;  4M7E C;  4R0A A;  4RCA B;  1FS2 A;  1W8A A;  4P8S A;  3SB4 A;  2WFH A;  2Z63 A;  4R6F A;  4FCG A;  4TZH A;  1OGQ A;  5IYX C;  3PMH G;  4MN8 B;  4FHO A;  3RW6 A;  3OGM B;  4U7L A;  4MQW X;  4LXR A;  3ZYN A;  4KNG A;  3TSR E;  1KOH A;  4R5C A;  3ZYI A;  3CVR A;  2AST B;  1O6S A;  2RA8 A;  4R08 A;  2Y5Q A;  5GS2 B;  5A5C A;  4LSX A;  2WQX A;  5GQR K;  3G39 A;  2Z81 A;  3OGK B;  5FTT B;  2P1Q B;  4ECO A;  2JE1 A;  5LFN A;  3ZYO A;  3WPI A;  2BEX A;  1IO0 A;  3OGL B;  3ZYJ A;  2Z65 A;  3RFE A;  4R6J A;  2Z82 A;  5IJC A;  1A9N A;  3OJA B;  5B0N A;  2V9T B;  4AY9 X;  5IJB A;  4HQ1 A;  1OTM A;  2P1P B;  4OQT A;  3ULV A;  4CNM A;  5HZL B;  4WP6 A;  4Z8G A;  3DZE A;  5GMH A;  5IJD A;  3UL8 A;  3RJ0 A;  4LSC A;  5CMP A;  4GT6 A;  2ELL A;  3UN9 A;  4C2B B;  3OJA A;  5AZ5 A;  2O6S A;  3W3G A;  3VQ1 A;  4CC4 A;  4Y61 B;  4R6A A;  3RGZ A;  1O6T A;  1P8T A;  4U09 A;  3M19 A;  4R5D A;  3ULU A;  4H09 A;  3WPD A;  2OMX A;  3E3Z A;  4LI2 A;  5HDH A;  2R9U A;  4PQ8 A;  4R58 A;  2FT3 A;  3G04 C;  4KXF B;  3E6J A;  4V2C A;  1M0Z A;  3W3J A;  4L3F A;  4LSX C;  2JQD A;  4QBZ A;  3RFJ A;  4R07 A;  3WPB A;  3O6N A;  4PER A;  4Z61 C;  1M9L A;  1DFJ I;  1O6V A;  3FXI A;  2O6Q A;  3VQ2 A;  2Q4G W;  1XKU A;  1H6T A;  5GS0 A;  5B4P A;  3E2J A;  5AWA A;  2JE0 A;  1D0B A;  4BSU A;  1U0N D;  1FT8 A;  1PGV A;  1Z7X W;  4RWT C;  3JB9 j;  3C6O B;  4V2E A;  4R09 A;  4IM6 A;  4Q3I A;  2Z62 A;  2V70 A;  2O6R A;  4CP6 A;  2XWT C;  1JL5 A;  1XCD A;  2OMY A;  2OMT A;  4U06 A;  3WPH A;  4CIL A;  1XEU A;  3GOZ A;  1SQ0 B;  3CIG A;  5D3I A;  4NKH A;  3G3A A;  2Z64 A;  3RIZ A;  4LXS A;  4C2A B;  2A0Z A;  4CC4 C;  4RCW A;  2OMW A;  4Z94 G;  1A4Y A;  4PSJ A;  3M18 A;  2UZY A;  2OMV A;  3WPC A;  4YEB B;  4WYK A;  1KOO A;  3O53 A;  3UL7 A;  1XWD C;  1M10 B;  4PEQ B;  3WN4 A;  3E4G A;  1XEC A;  3W3K A;  4ARN A;  4L3A A;  5GMG A;  3BZ5 A; 
#chains in the Genus database with same CATH topology
 3WPF A;  3RGX A;  4NZR M;  1P9A G;  2BNH A;  4Q62 A;  4NKG A;  1OOK G;  1K5G C;  4P91 A;  4EZG A;  4XOS A;  3P72 A;  4QC0 A;  4G8A A;  2OMU A;  2ID5 A;  4Z64 C;  3WPG A;  1K5D C;  1OTN A;  1FO1 A;  1FQV A;  3UL9 A;  2P1O B;  4Q3G A;  2CA6 A;  3REZ A;  4ARR A;  5B0T A;  3CIY A;  4M7E A;  4XGO A;  2ASS B;  1G9U A;  4B8C D;  1P8V A;  2Z7X A;  4J4L A;  3W3N A;  2P1M B;  4BSR A;  2WQU A;  4FS7 A;  4U08 A;  5AWB A;  3G06 A;  4UFR A;  3WPE A;  1OTO A;  3A79 B;  4XSQ A;  3RW7 A;  4Z79 A;  4FDW A;  4I6J B;  2WQV A;  1H6U A;  4BSS A;  3ULA A;  4LSA A;  1OZN A;  5AWD A;  4KT1 A;  5CMN A;  3C6N B;  4V2D A;  4AW4 A;  3G3B A;  2Z66 A;  4ECN A;  2RR6 A;  1LTX A;  1YRG A;  2XOT A;  3W3M A;  4K17 A;  1ZIW A;  4PKI G;  2WQW A;  1DCE A;  2IFG A;  2UZX A;  5GMF A;  2OMZ A;  4CNC A;  4LI1 A;  4FD0 A;  2V9S A;  3W3L A;  4J0M A;  4GLP A;  3KJ4 A;  4FMZ A;  2Z7X B;  1QYY A;  5AWC A;  1M9S A;  3C6P B;  4BV4 R;  1DS9 A;  3RFS A;  1GWB A;  4QXE A;  2P1N B;  4R6G A;  1WWL A;  4M7E C;  4R0A A;  4RCA B;  1FS2 A;  1W8A A;  4P8S A;  3SB4 A;  2WFH A;  2Z63 A;  4R6F A;  4FCG A;  4TZH A;  1OGQ A;  5IYX C;  3PMH G;  4MN8 B;  4FHO A;  3RW6 A;  3OGM B;  4U7L A;  4MQW X;  4LXR A;  3ZYN A;  4KNG A;  3TSR E;  1KOH A;  4R5C A;  3ZYI A;  3CVR A;  2AST B;  1O6S A;  2RA8 A;  4R08 A;  2Y5Q A;  5GS2 B;  5A5C A;  4LSX A;  2WQX A;  5GQR K;  3G39 A;  2Z81 A;  3OGK B;  4NZT M;  2P1Q B;  5FTT B;  4ECO A;  2JE1 A;  5LFN A;  3ZYO A;  3WPI A;  2BEX A;  1IO0 A;  3OGL B;  3ZYJ A;  2Z65 A;  3RFE A;  4R6J A;  2Z82 A;  5IJC A;  1A9N A;  3OJA B;  5B0N A;  2V9T B;  4AY9 X;  5IJB A;  4HQ1 A;  1OTM A;  2P1P B;  4OQT A;  3ULV A;  4CNM A;  5HZL B;  4WP6 A;  4Z8G A;  3DZE A;  5GMH A;  5IJD A;  3UL8 A;  3RJ0 A;  4LSC A;  5CMP A;  4GT6 A;  2ELL A;  3UN9 A;  4C2B B;  3OJA A;  5AZ5 A;  2O6S A;  3W3G A;  3VQ1 A;  4CC4 A;  4Y61 B;  4R6A A;  3RGZ A;  1O6T A;  1P8T A;  4U09 A;  3M19 A;  4R5D A;  3ULU A;  4H09 A;  3WPD A;  2OMX A;  3E3Z A;  4LI2 A;  5HDH A;  2R9U A;  4PQ8 A;  4R58 A;  2FT3 A;  3G04 C;  4KXF B;  3E6J A;  4V2C A;  1M0Z A;  3W3J A;  4L3F A;  4LSX C;  2JQD A;  4QBZ A;  3RFJ A;  4R07 A;  3WPB A;  3O6N A;  4PER A;  4Z61 C;  1M9L A;  1DFJ I;  1O6V A;  3FXI A;  2O6Q A;  3VQ2 A;  2Q4G W;  1XKU A;  1H6T A;  5GS0 A;  5B4P A;  3E2J A;  5AWA A;  2JE0 A;  1D0B A;  4BSU A;  1U0N D;  1FT8 A;  1PGV A;  1Z7X W;  4RWT C;  3JB9 j;  3C6O B;  4V2E A;  4R09 A;  4IM6 A;  4Q3I A;  2Z62 A;  2V70 A;  2O6R A;  4CP6 A;  2XWT C;  1JL5 A;  1XCD A;  2OMY A;  2OMT A;  4U06 A;  3WPH A;  4CIL A;  1XEU A;  3GOZ A;  1SQ0 B;  3CIG A;  5D3I A;  4NKH A;  3G3A A;  2Z64 A;  3RIZ A;  4LXS A;  4C2A B;  2A0Z A;  4CC4 C;  4RCW A;  2OMW A;  4Z94 G;  1A4Y A;  4PSJ A;  3M18 A;  2UZY A;  2OMV A;  3WPC A;  4YEB B;  4WYK A;  1KOO A;  3O53 A;  3UL7 A;  1XWD C;  1M10 B;  4PEQ B;  3WN4 A;  3E4G A;  1XEC A;  3W3K A;  4ARN A;  4L3A A;  5GMG A;  3BZ5 A; 
#chains in the Genus database with same CATH homology
 3WPF A;  3RGX A;  1P9A G;  2BNH A;  4Q62 A;  4NKG A;  1OOK G;  1K5G C;  4P91 A;  4EZG A;  4XOS A;  3P72 A;  4QC0 A;  4G8A A;  2OMU A;  2ID5 A;  4Z64 C;  3WPG A;  1K5D C;  1OTN A;  1FO1 A;  1FQV A;  3UL9 A;  2P1O B;  4Q3G A;  2CA6 A;  3REZ A;  4ARR A;  5B0T A;  3CIY A;  4M7E A;  4XGO A;  2ASS B;  1G9U A;  4B8C D;  1P8V A;  2Z7X A;  4J4L A;  3W3N A;  2P1M B;  4BSR A;  2WQU A;  4FS7 A;  4U08 A;  5AWB A;  3G06 A;  4UFR A;  3WPE A;  1OTO A;  3A79 B;  4XSQ A;  3RW7 A;  4Z79 A;  4FDW A;  4I6J B;  2WQV A;  1H6U A;  4BSS A;  3ULA A;  4LSA A;  1OZN A;  5AWD A;  4KT1 A;  5CMN A;  3C6N B;  4V2D A;  4AW4 A;  3G3B A;  2Z66 A;  4ECN A;  2RR6 A;  1LTX A;  1YRG A;  2XOT A;  3W3M A;  4K17 A;  1ZIW A;  4PKI G;  2WQW A;  1DCE A;  2IFG A;  2UZX A;  5GMF A;  2OMZ A;  4CNC A;  4LI1 A;  4FD0 A;  2V9S A;  3W3L A;  4J0M A;  4GLP A;  3KJ4 A;  4FMZ A;  2Z7X B;  1QYY A;  5AWC A;  1M9S A;  3C6P B;  4BV4 R;  1DS9 A;  3RFS A;  1GWB A;  4QXE A;  2P1N B;  4R6G A;  1WWL A;  4M7E C;  4R0A A;  4RCA B;  1FS2 A;  1W8A A;  4P8S A;  3SB4 A;  2WFH A;  2Z63 A;  4R6F A;  4FCG A;  4TZH A;  1OGQ A;  5IYX C;  3PMH G;  4MN8 B;  4FHO A;  3RW6 A;  3OGM B;  4U7L A;  4MQW X;  4LXR A;  3ZYN A;  4KNG A;  3TSR E;  1KOH A;  4R5C A;  3ZYI A;  3CVR A;  2AST B;  1O6S A;  2RA8 A;  4R08 A;  2Y5Q A;  5GS2 B;  5A5C A;  4LSX A;  2WQX A;  5GQR K;  3G39 A;  2Z81 A;  3OGK B;  5FTT B;  2P1Q B;  4ECO A;  2JE1 A;  5LFN A;  3ZYO A;  3WPI A;  2BEX A;  1IO0 A;  3OGL B;  3ZYJ A;  2Z65 A;  3RFE A;  4R6J A;  2Z82 A;  5IJC A;  1A9N A;  3OJA B;  5B0N A;  2V9T B;  4AY9 X;  5IJB A;  4HQ1 A;  1OTM A;  2P1P B;  4OQT A;  3ULV A;  4CNM A;  5HZL B;  4WP6 A;  4Z8G A;  3DZE A;  5GMH A;  5IJD A;  3UL8 A;  3RJ0 A;  4LSC A;  5CMP A;  4GT6 A;  2ELL A;  3UN9 A;  4C2B B;  3OJA A;  5AZ5 A;  2O6S A;  3W3G A;  3VQ1 A;  4CC4 A;  4Y61 B;  4R6A A;  3RGZ A;  1O6T A;  1P8T A;  4U09 A;  3M19 A;  4R5D A;  3ULU A;  4H09 A;  3WPD A;  2OMX A;  3E3Z A;  4LI2 A;  5HDH A;  2R9U A;  4PQ8 A;  4R58 A;  2FT3 A;  3G04 C;  4KXF B;  3E6J A;  4V2C A;  1M0Z A;  3W3J A;  4L3F A;  4LSX C;  2JQD A;  4QBZ A;  3RFJ A;  4R07 A;  3WPB A;  3O6N A;  4PER A;  4Z61 C;  1M9L A;  1DFJ I;  1O6V A;  3FXI A;  2O6Q A;  3VQ2 A;  2Q4G W;  1XKU A;  1H6T A;  5GS0 A;  5B4P A;  3E2J A;  5AWA A;  2JE0 A;  1D0B A;  4BSU A;  1U0N D;  1FT8 A;  1PGV A;  1Z7X W;  4RWT C;  3JB9 j;  3C6O B;  4V2E A;  4R09 A;  4IM6 A;  4Q3I A;  2Z62 A;  2V70 A;  2O6R A;  4CP6 A;  2XWT C;  1JL5 A;  1XCD A;  2OMY A;  2OMT A;  4U06 A;  3WPH A;  4CIL A;  1XEU A;  3GOZ A;  1SQ0 B;  3CIG A;  5D3I A;  4NKH A;  3G3A A;  2Z64 A;  3RIZ A;  4LXS A;  4C2A B;  2A0Z A;  4CC4 C;  4RCW A;  2OMW A;  4Z94 G;  1A4Y A;  4PSJ A;  3M18 A;  2UZY A;  2OMV A;  3WPC A;  4YEB B;  4WYK A;  1KOO A;  3O53 A;  3UL7 A;  1XWD C;  1M10 B;  4PEQ B;  3WN4 A;  3E4G A;  1XEC A;  3W3K A;  4ARN A;  4L3A A;  5GMG A;  3BZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...