3G3AA

Structure of a lamprey variable lymphocyte receptor in complex with a protein antigen
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
ACPSQCSCSGTTVDCSGKSLASVPTGIPTTTQVLYLYDNQITKLEPGVFDRLTQLTRLDLDNNQLTVLPAGVFDKLTQLTQLSLNDNQLKSIPRGAFDNLKSLTHIWLLNNPWDCACSDILYLSRWISQHPGLVFGYLNLDPDSARCSGTNTPVRAVTEASTSPSKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable lymphocyte receptor VLRB.2D
publication title Structure of a lamprey variable lymphocyte receptor in complex with a protein antigen.
pubmed doi rcsb
source organism Petromyzon marinus
molecule tags Hydrolase/immune system
total genus 42
structure length 167
sequence length 167
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF11921 DUF3439 Domain of unknown function (DUF3439)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3g3aA00
4Y61B 2WQUA 3WN4A 2O6QA 1P8TA 1H6TA 2Z7XB 2XWTC 4L3AA 3OGLB 2UZYA 2V9TB 4M7EA 4RCWA 1FO1A 4R0AA 4ARNA 2Y5QA 4KT1A 1GWBA 4CP6A 3G3AA 3E2JA 4P8SA 1O6TA 1XECA 3E6JA 4WP6A 3RGXA 2ASSB 4FMZA 4NKGA 4Z79A 4U09A 5IJBA 4GLPA 2BNHA 1JL5A 3M18A 3WPEA 5B0NA 2IFGA 3G3BA 1ZIWA 4LSCA 4FHOA 1XKUA 2R9UA 2ELLA 1OZNA 1OTOA 1OTMA 3WPGA 4V2DA 4QC0A 3O6NA 4XGOA 3W3LA 1A4YA 4Q3GA 4R5DA 2WQVA 3WPBA 5GS0A 4Z64C 3OGKB 5CMPA 4AY9X 5AWCA 3ULUA 4K17A 4G8AA 1M10B 4R58A 1A9NA 5LFNA 1O6VA 4QXEA 4B8CD 1KOOA 3RFSA 4C2AB 3O53A 1XCDA 2P1OB 4H09A 4V2CA 2BEXA 1W8AA 4J4LA 4BSUA 4LI1A 2OMVA 4BSRA 2P1QB 4U06A 1PGVA 3BZ5A 4R6FA 4XSQA 5HDHA 1G9UA 3RFJA 4RWTC 2P1PB 1KOHA 1P8VA 1M9SA 3W3JA 3E4GA 3GOZA 3A79B 4R5CA 4AW4A 4FD0A 4LXSA 3OGMB 1O6SA 4KNGA 3CIGA 3SB4A 1DFJI 4WYKA 2WQWA 4ARRA 3RFEA 4P91A 5AWBA 1M0ZA 2FT3A 2OMTA 4PSJA 4MN8B 1FQVA 3WPDA 1FT8A 2OMZA 1OTNA 4LSAA 1U0ND 3CIYA 3G39A 1XWDC 5IJDA 2XOTA 5FTTB 3VQ1A 3OJAB 4NKHA 3TSRE 2ID5A 3OJAA 3WPHA 3ZYOA 3M19A 1DS9A 4UFRA 3W3NA 3C6PB 1IO0A 1OGQA 3RGZA 4Q3IA 3DZEA 4R6AA 1H6UA 4Z8GA 3E3ZA 2A0ZA 4U7LA 2RA8A 3ULVA 3KJ4A 4FCGA 4FDWA 2OMYA 2WQXA 2RR6A 3UN9A 5B4PA 4KXFB 4Q62A 3WPFA 4R07A 3ZYNA 4C2BB 4J0MA 3UL7A 5AZ5A 1WWLA 3VQ2A 2JE0A 4LXRA 2Z65A 4BV4R 4CNMA 1DCEA 1D0BA 4RCAB 2CA6A 2OMWA 4TZHA 4R6JA 3P72A 2OMUA 3G04C 4CILA 3RIZA 2UZXA 5AWAA 4XOSA 4PQ8A 5B0TA 2ASTB 4QBZA 4R08A 2Z7XA 4I6JB 4IM6A 4V2EA 5GQRK 2Z82A 1Z7XW 5AWDA 5D3IA 2V9SA 4MQWX 3REZA 1OOKG 4ECNA 1M9LA 1YRGA 4FS7A 2Z66A 4R09A 3ZYJA 3ZYIA 4BSSA 2P1MB 3WPCA 4Z61C 1SQ0B 3W3KA 3WPIA 4R6GA 5CMNA 4LI2A 1QYYA 1K5GC 2O6SA 5IYXC 2P1NB 5A5CA 4EZGA 1FS2A 3FXIA 4LSXC 2V70A 5IJCA 2Q4GW 5GMGA 3PMHG 1K5DC 5HZLB 2Z81A 5GS2B 3CVRA 2WFHA 5GMHA 3C6NB 4CNCA 4U08A 4OQTA 1LTXA 4PKIG 4GT6A 4YEBB 5GMFA 4LSXA 3W3GA 2JQDA 4Z94G 4CC4C 3RJ0A 4PERA 3G06A 2OMXA 3UL9A 2JE1A 4PEQB 3JB9j 1XEUA 3RW6A 2Z64A 4M7EC 2Z63A 4L3FA 3C6OB 4HQ1A 3UL8A 1P9AG 3RW7A 3W3MA 3ULAA 2O6RA 4CC4A 2Z62A 4ECOA
chains in the Genus database with same CATH superfamily
4Y61B 2WQUA 3WN4A 2O6QA 1P8TA 1H6TA 2Z7XB 2XWTC 4L3AA 3OGLB 2UZYA 2V9TB 4M7EA 4RCWA 1FO1A 4R0AA 4ARNA 2Y5QA 4KT1A 1GWBA 4CP6A 3G3AA 3E2JA 4P8SA 1O6TA 1XECA 3E6JA 4WP6A 3RGXA 2ASSB 4FMZA 4NKGA 4Z79A 4U09A 5IJBA 4GLPA 2BNHA 1JL5A 3M18A 3WPEA 5B0NA 2IFGA 3G3BA 1ZIWA 4LSCA 4FHOA 1XKUA 2R9UA 2ELLA 1OZNA 1OTOA 1OTMA 3WPGA 4V2DA 4QC0A 3O6NA 4XGOA 3W3LA 1A4YA 4Q3GA 4R5DA 2WQVA 3WPBA 5GS0A 4Z64C 3OGKB 5CMPA 4AY9X 5AWCA 3ULUA 4K17A 4G8AA 1M10B 4R58A 1A9NA 5LFNA 1O6VA 4QXEA 4B8CD 1KOOA 3RFSA 4C2AB 3O53A 1XCDA 2P1OB 4H09A 4V2CA 2BEXA 1W8AA 4J4LA 4BSUA 4LI1A 2OMVA 4BSRA 2P1QB 4U06A 1PGVA 3BZ5A 4R6FA 4XSQA 5HDHA 1G9UA 3RFJA 4RWTC 2P1PB 1KOHA 1P8VA 1M9SA 3W3JA 3E4GA 3GOZA 3A79B 4R5CA 4AW4A 4FD0A 4LXSA 3OGMB 1O6SA 4KNGA 3CIGA 3SB4A 1DFJI 4WYKA 2WQWA 4ARRA 3RFEA 4P91A 5AWBA 1M0ZA 2FT3A 2OMTA 4PSJA 4MN8B 1FQVA 3WPDA 1FT8A 2OMZA 1OTNA 4LSAA 1U0ND 3CIYA 3G39A 1XWDC 5IJDA 2XOTA 5FTTB 3VQ1A 3OJAB 4NKHA 3TSRE 2ID5A 3OJAA 3WPHA 3ZYOA 3M19A 1DS9A 4UFRA 3W3NA 3C6PB 1IO0A 1OGQA 3RGZA 4Q3IA 3DZEA 4R6AA 1H6UA 4Z8GA 3E3ZA 2A0ZA 4U7LA 2RA8A 3ULVA 3KJ4A 4FCGA 4FDWA 2OMYA 2WQXA 2RR6A 3UN9A 5B4PA 4KXFB 4Q62A 3WPFA 4R07A 3ZYNA 4C2BB 4J0MA 3UL7A 5AZ5A 1WWLA 3VQ2A 2JE0A 4LXRA 2Z65A 4BV4R 4CNMA 1DCEA 1D0BA 4RCAB 2CA6A 2OMWA 4TZHA 4R6JA 3P72A 2OMUA 3G04C 4CILA 3RIZA 2UZXA 5AWAA 4XOSA 4PQ8A 5B0TA 2ASTB 4QBZA 4R08A 2Z7XA 4I6JB 4IM6A 4V2EA 5GQRK 2Z82A 1Z7XW 5AWDA 5D3IA 2V9SA 4MQWX 3REZA 1OOKG 4ECNA 1M9LA 1YRGA 4FS7A 2Z66A 4R09A 3ZYJA 3ZYIA 4BSSA 2P1MB 3WPCA 4Z61C 1SQ0B 3W3KA 3WPIA 4R6GA 5CMNA 4LI2A 1QYYA 1K5GC 2O6SA 5IYXC 2P1NB 5A5CA 4EZGA 1FS2A 3FXIA 4LSXC 2V70A 5IJCA 2Q4GW 5GMGA 3PMHG 1K5DC 5HZLB 2Z81A 5GS2B 3CVRA 2WFHA 5GMHA 3C6NB 4CNCA 4U08A 4OQTA 1LTXA 4PKIG 4GT6A 4YEBB 5GMFA 4LSXA 3W3GA 2JQDA 4Z94G 4CC4C 3RJ0A 4PERA 3G06A 2OMXA 3UL9A 2JE1A 4PEQB 4NZRM 3JB9j 1XEUA 3RW6A 2Z64A 4M7EC 2Z63A 4L3FA 3C6OB 4HQ1A 3UL8A 1P9AG 3RW7A 3W3MA 3ULAA 2O6RA 4CC4A 2Z62A 4NZTM 4ECOA
chains in the Genus database with same CATH topology
4Y61B 2WQUA 3WN4A 2O6QA 1P8TA 1H6TA 2Z7XB 2XWTC 4L3AA 3OGLB 2UZYA 2V9TB 4M7EA 4RCWA 1FO1A 4R0AA 4ARNA 2Y5QA 4KT1A 1GWBA 4CP6A 3G3AA 3E2JA 4P8SA 1O6TA 1XECA 3E6JA 4WP6A 3RGXA 2ASSB 4FMZA 4NKGA 4Z79A 4U09A 5IJBA 4GLPA 2BNHA 1JL5A 3M18A 3WPEA 5B0NA 2IFGA 3G3BA 1ZIWA 4LSCA 4FHOA 1XKUA 2R9UA 2ELLA 1OZNA 1OTOA 1OTMA 3WPGA 4V2DA 4QC0A 3O6NA 4XGOA 3W3LA 1A4YA 4Q3GA 4R5DA 2WQVA 3WPBA 5GS0A 4Z64C 3OGKB 5CMPA 4AY9X 5AWCA 3ULUA 4K17A 4G8AA 1M10B 4R58A 1A9NA 5LFNA 1O6VA 4QXEA 4B8CD 1KOOA 3RFSA 4C2AB 3O53A 1XCDA 2P1OB 4H09A 4V2CA 2BEXA 1W8AA 4J4LA 4BSUA 4LI1A 2OMVA 4BSRA 2P1QB 4U06A 1PGVA 3BZ5A 4R6FA 4XSQA 5HDHA 1G9UA 3RFJA 4RWTC 2P1PB 1KOHA 1P8VA 1M9SA 3W3JA 3E4GA 3GOZA 3A79B 4R5CA 4AW4A 4FD0A 4LXSA 3OGMB 1O6SA 4KNGA 3CIGA 3SB4A 1DFJI 4WYKA 2WQWA 4ARRA 3RFEA 4P91A 5AWBA 1M0ZA 2FT3A 2OMTA 4PSJA 4MN8B 1FQVA 3WPDA 1FT8A 2OMZA 1OTNA 4LSAA 1U0ND 3CIYA 3G39A 1XWDC 5IJDA 2XOTA 5FTTB 3VQ1A 3OJAB 4NKHA 3TSRE 2ID5A 3OJAA 3WPHA 3ZYOA 3M19A 1DS9A 4UFRA 3W3NA 3C6PB 1IO0A 1OGQA 3RGZA 4Q3IA 3DZEA 4R6AA 1H6UA 4Z8GA 3E3ZA 2A0ZA 4U7LA 2RA8A 3ULVA 3KJ4A 4FCGA 4FDWA 2OMYA 2WQXA 2RR6A 3UN9A 5B4PA 4KXFB 4Q62A 3WPFA 4R07A 3ZYNA 4C2BB 4J0MA 3UL7A 5AZ5A 1WWLA 3VQ2A 2JE0A 4LXRA 2Z65A 4BV4R 4CNMA 1DCEA 1D0BA 4RCAB 2CA6A 2OMWA 4TZHA 4R6JA 3P72A 2OMUA 3G04C 4CILA 3RIZA 2UZXA 5AWAA 4XOSA 4PQ8A 5B0TA 2ASTB 4QBZA 4R08A 2Z7XA 4I6JB 4IM6A 4V2EA 5GQRK 2Z82A 1Z7XW 5AWDA 5D3IA 2V9SA 4MQWX 3REZA 1OOKG 4ECNA 1M9LA 1YRGA 4FS7A 2Z66A 4R09A 3ZYJA 3ZYIA 4BSSA 2P1MB 3WPCA 4Z61C 1SQ0B 3W3KA 3WPIA 4R6GA 5CMNA 4LI2A 1QYYA 1K5GC 2O6SA 5IYXC 2P1NB 5A5CA 4EZGA 1FS2A 3FXIA 4LSXC 2V70A 5IJCA 2Q4GW 5GMGA 3PMHG 1K5DC 5HZLB 2Z81A 5GS2B 3CVRA 2WFHA 5GMHA 3C6NB 4CNCA 4U08A 4OQTA 1LTXA 4PKIG 4GT6A 4YEBB 5GMFA 4LSXA 3W3GA 2JQDA 4Z94G 4CC4C 3RJ0A 4PERA 3G06A 2OMXA 3UL9A 2JE1A 4PEQB 3JB9j 1XEUA 3RW6A 2Z64A 4M7EC 2Z63A 4L3FA 3C6OB 4HQ1A 3UL8A 1P9AG 3RW7A 3W3MA 3ULAA 2O6RA 4CC4A 2Z62A 4ECOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y61 B;  2WQU A;  3WN4 A;  2O6Q A;  1P8T A;  1H6T A;  2Z7X B;  2XWT C;  4L3A A;  3OGL B;  2UZY A;  2V9T B;  4M7E A;  4RCW A;  1FO1 A;  4R0A A;  4ARN A;  2Y5Q A;  4KT1 A;  1GWB A;  4CP6 A;  3G3A A;  3E2J A;  4P8S A;  1O6T A;  1XEC A;  3E6J A;  4WP6 A;  3RGX A;  2ASS B;  4FMZ A;  4NKG A;  4Z79 A;  4U09 A;  5IJB A;  4GLP A;  2BNH A;  1JL5 A;  3M18 A;  3WPE A;  5B0N A;  2IFG A;  3G3B A;  1ZIW A;  4LSC A;  4FHO A;  1XKU A;  2R9U A;  2ELL A;  1OZN A;  1OTO A;  1OTM A;  3WPG A;  4V2D A;  4QC0 A;  3O6N A;  4XGO A;  3W3L A;  1A4Y A;  4Q3G A;  4R5D A;  2WQV A;  3WPB A;  5GS0 A;  4Z64 C;  3OGK B;  5CMP A;  4AY9 X;  5AWC A;  3ULU A;  4K17 A;  4G8A A;  1M10 B;  4R58 A;  1A9N A;  5LFN A;  1O6V A;  4QXE A;  4B8C D;  1KOO A;  3RFS A;  4C2A B;  3O53 A;  1XCD A;  2P1O B;  4H09 A;  4V2C A;  2BEX A;  1W8A A;  4J4L A;  4BSU A;  4LI1 A;  2OMV A;  4BSR A;  2P1Q B;  4U06 A;  1PGV A;  3BZ5 A;  4R6F A;  4XSQ A;  5HDH A;  1G9U A;  3RFJ A;  4RWT C;  2P1P B;  1KOH A;  1P8V A;  1M9S A;  3W3J A;  3E4G A;  3GOZ A;  3A79 B;  4R5C A;  4AW4 A;  4FD0 A;  4LXS A;  3OGM B;  1O6S A;  4KNG A;  3CIG A;  3SB4 A;  1DFJ I;  4WYK A;  2WQW A;  4ARR A;  3RFE A;  4P91 A;  5AWB A;  1M0Z A;  2FT3 A;  2OMT A;  4PSJ A;  4MN8 B;  1FQV A;  3WPD A;  1FT8 A;  2OMZ A;  1OTN A;  4LSA A;  1U0N D;  3CIY A;  3G39 A;  1XWD C;  5IJD A;  2XOT A;  5FTT B;  3VQ1 A;  3OJA B;  4NKH A;  3TSR E;  2ID5 A;  3OJA A;  3WPH A;  3ZYO A;  3M19 A;  1DS9 A;  4UFR A;  3W3N A;  3C6P B;  1IO0 A;  1OGQ A;  3RGZ A;  4Q3I A;  3DZE A;  4R6A A;  1H6U A;  4Z8G A;  3E3Z A;  2A0Z A;  4U7L A;  2RA8 A;  3ULV A;  3KJ4 A;  4FCG A;  4FDW A;  2OMY A;  2WQX A;  2RR6 A;  3UN9 A;  5B4P A;  4KXF B;  4Q62 A;  3WPF A;  4R07 A;  3ZYN A;  4C2B B;  4J0M A;  3UL7 A;  5AZ5 A;  1WWL A;  3VQ2 A;  2JE0 A;  4LXR A;  2Z65 A;  4BV4 R;  4CNM A;  1DCE A;  1D0B A;  4RCA B;  2CA6 A;  2OMW A;  4TZH A;  4R6J A;  3P72 A;  2OMU A;  3G04 C;  4CIL A;  3RIZ A;  2UZX A;  5AWA A;  4XOS A;  4PQ8 A;  5B0T A;  2AST B;  4QBZ A;  4R08 A;  2Z7X A;  4I6J B;  4IM6 A;  4V2E A;  5GQR K;  2Z82 A;  1Z7X W;  5AWD A;  5D3I A;  2V9S A;  4MQW X;  3REZ A;  1OOK G;  4ECN A;  1M9L A;  1YRG A;  4FS7 A;  2Z66 A;  4R09 A;  3ZYJ A;  3ZYI A;  4BSS A;  2P1M B;  3WPC A;  4Z61 C;  1SQ0 B;  3W3K A;  3WPI A;  4R6G A;  5CMN A;  4LI2 A;  1QYY A;  1K5G C;  2O6S A;  5IYX C;  2P1N B;  5A5C A;  4EZG A;  1FS2 A;  3FXI A;  4LSX C;  2V70 A;  5IJC A;  2Q4G W;  5GMG A;  3PMH G;  1K5D C;  5HZL B;  2Z81 A;  5GS2 B;  3CVR A;  2WFH A;  5GMH A;  3C6N B;  4CNC A;  4U08 A;  4OQT A;  1LTX A;  4PKI G;  4GT6 A;  4YEB B;  5GMF A;  4LSX A;  3W3G A;  2JQD A;  4Z94 G;  4CC4 C;  3RJ0 A;  4PER A;  3G06 A;  2OMX A;  3UL9 A;  2JE1 A;  4PEQ B;  3JB9 j;  1XEU A;  3RW6 A;  2Z64 A;  4M7E C;  2Z63 A;  4L3F A;  3C6O B;  4HQ1 A;  3UL8 A;  1P9A G;  3RW7 A;  3W3M A;  3ULA A;  2O6R A;  4CC4 A;  2Z62 A;  4ECO A; 
#chains in the Genus database with same CATH topology
 4Y61 B;  2WQU A;  3WN4 A;  2O6Q A;  1P8T A;  1H6T A;  2Z7X B;  2XWT C;  4L3A A;  3OGL B;  2UZY A;  2V9T B;  4M7E A;  4RCW A;  1FO1 A;  4R0A A;  4ARN A;  2Y5Q A;  4KT1 A;  1GWB A;  4CP6 A;  3G3A A;  3E2J A;  4P8S A;  1O6T A;  1XEC A;  3E6J A;  4WP6 A;  3RGX A;  2ASS B;  4FMZ A;  4NKG A;  4Z79 A;  4U09 A;  5IJB A;  4GLP A;  2BNH A;  1JL5 A;  3M18 A;  3WPE A;  5B0N A;  2IFG A;  3G3B A;  1ZIW A;  4LSC A;  4FHO A;  1XKU A;  2R9U A;  2ELL A;  1OZN A;  1OTO A;  1OTM A;  3WPG A;  4V2D A;  4QC0 A;  3O6N A;  4XGO A;  3W3L A;  1A4Y A;  4Q3G A;  4R5D A;  2WQV A;  3WPB A;  5GS0 A;  4Z64 C;  3OGK B;  5CMP A;  4AY9 X;  5AWC A;  3ULU A;  4K17 A;  4G8A A;  1M10 B;  4R58 A;  1A9N A;  5LFN A;  1O6V A;  4QXE A;  4B8C D;  1KOO A;  3RFS A;  4C2A B;  3O53 A;  1XCD A;  2P1O B;  4H09 A;  4V2C A;  2BEX A;  1W8A A;  4J4L A;  4BSU A;  4LI1 A;  2OMV A;  4BSR A;  2P1Q B;  4U06 A;  1PGV A;  3BZ5 A;  4R6F A;  4XSQ A;  5HDH A;  1G9U A;  3RFJ A;  4RWT C;  2P1P B;  1KOH A;  1P8V A;  1M9S A;  3W3J A;  3E4G A;  3GOZ A;  3A79 B;  4R5C A;  4AW4 A;  4FD0 A;  4LXS A;  3OGM B;  1O6S A;  4KNG A;  3CIG A;  3SB4 A;  1DFJ I;  4WYK A;  2WQW A;  4ARR A;  3RFE A;  4P91 A;  5AWB A;  1M0Z A;  2FT3 A;  2OMT A;  4PSJ A;  4MN8 B;  1FQV A;  3WPD A;  1FT8 A;  2OMZ A;  1OTN A;  4LSA A;  1U0N D;  3CIY A;  3G39 A;  1XWD C;  5IJD A;  2XOT A;  5FTT B;  3VQ1 A;  3OJA B;  4NKH A;  3TSR E;  2ID5 A;  3OJA A;  3WPH A;  3ZYO A;  3M19 A;  1DS9 A;  4UFR A;  3W3N A;  3C6P B;  1IO0 A;  1OGQ A;  3RGZ A;  4Q3I A;  3DZE A;  4R6A A;  1H6U A;  4Z8G A;  3E3Z A;  2A0Z A;  4U7L A;  2RA8 A;  3ULV A;  3KJ4 A;  4FCG A;  4FDW A;  2OMY A;  2WQX A;  2RR6 A;  3UN9 A;  5B4P A;  4KXF B;  4Q62 A;  3WPF A;  4R07 A;  3ZYN A;  4C2B B;  4J0M A;  3UL7 A;  5AZ5 A;  1WWL A;  3VQ2 A;  2JE0 A;  4LXR A;  2Z65 A;  4BV4 R;  4CNM A;  1DCE A;  1D0B A;  4RCA B;  2CA6 A;  2OMW A;  4TZH A;  4R6J A;  3P72 A;  2OMU A;  3G04 C;  4CIL A;  3RIZ A;  2UZX A;  5AWA A;  4XOS A;  4PQ8 A;  5B0T A;  2AST B;  4QBZ A;  4R08 A;  2Z7X A;  4I6J B;  4IM6 A;  4V2E A;  5GQR K;  2Z82 A;  1Z7X W;  5AWD A;  5D3I A;  2V9S A;  4MQW X;  3REZ A;  1OOK G;  4ECN A;  1M9L A;  1YRG A;  4FS7 A;  2Z66 A;  4R09 A;  3ZYJ A;  3ZYI A;  4BSS A;  2P1M B;  3WPC A;  4Z61 C;  1SQ0 B;  3W3K A;  3WPI A;  4R6G A;  5CMN A;  4LI2 A;  1QYY A;  1K5G C;  2O6S A;  5IYX C;  2P1N B;  5A5C A;  4EZG A;  1FS2 A;  3FXI A;  4LSX C;  2V70 A;  5IJC A;  2Q4G W;  5GMG A;  3PMH G;  1K5D C;  5HZL B;  2Z81 A;  5GS2 B;  3CVR A;  2WFH A;  5GMH A;  3C6N B;  4CNC A;  4U08 A;  4OQT A;  1LTX A;  4PKI G;  4GT6 A;  4YEB B;  5GMF A;  4LSX A;  3W3G A;  2JQD A;  4Z94 G;  4CC4 C;  3RJ0 A;  4PER A;  3G06 A;  2OMX A;  3UL9 A;  2JE1 A;  4PEQ B;  4NZR M;  3JB9 j;  1XEU A;  3RW6 A;  2Z64 A;  4M7E C;  2Z63 A;  4L3F A;  3C6O B;  4HQ1 A;  3UL8 A;  1P9A G;  3RW7 A;  3W3M A;  3ULA A;  2O6R A;  4CC4 A;  2Z62 A;  4NZT M;  4ECO A; 
#chains in the Genus database with same CATH homology
 4Y61 B;  2WQU A;  3WN4 A;  2O6Q A;  1P8T A;  1H6T A;  2Z7X B;  2XWT C;  4L3A A;  3OGL B;  2UZY A;  2V9T B;  4M7E A;  4RCW A;  1FO1 A;  4R0A A;  4ARN A;  2Y5Q A;  4KT1 A;  1GWB A;  4CP6 A;  3G3A A;  3E2J A;  4P8S A;  1O6T A;  1XEC A;  3E6J A;  4WP6 A;  3RGX A;  2ASS B;  4FMZ A;  4NKG A;  4Z79 A;  4U09 A;  5IJB A;  4GLP A;  2BNH A;  1JL5 A;  3M18 A;  3WPE A;  5B0N A;  2IFG A;  3G3B A;  1ZIW A;  4LSC A;  4FHO A;  1XKU A;  2R9U A;  2ELL A;  1OZN A;  1OTO A;  1OTM A;  3WPG A;  4V2D A;  4QC0 A;  3O6N A;  4XGO A;  3W3L A;  1A4Y A;  4Q3G A;  4R5D A;  2WQV A;  3WPB A;  5GS0 A;  4Z64 C;  3OGK B;  5CMP A;  4AY9 X;  5AWC A;  3ULU A;  4K17 A;  4G8A A;  1M10 B;  4R58 A;  1A9N A;  5LFN A;  1O6V A;  4QXE A;  4B8C D;  1KOO A;  3RFS A;  4C2A B;  3O53 A;  1XCD A;  2P1O B;  4H09 A;  4V2C A;  2BEX A;  1W8A A;  4J4L A;  4BSU A;  4LI1 A;  2OMV A;  4BSR A;  2P1Q B;  4U06 A;  1PGV A;  3BZ5 A;  4R6F A;  4XSQ A;  5HDH A;  1G9U A;  3RFJ A;  4RWT C;  2P1P B;  1KOH A;  1P8V A;  1M9S A;  3W3J A;  3E4G A;  3GOZ A;  3A79 B;  4R5C A;  4AW4 A;  4FD0 A;  4LXS A;  3OGM B;  1O6S A;  4KNG A;  3CIG A;  3SB4 A;  1DFJ I;  4WYK A;  2WQW A;  4ARR A;  3RFE A;  4P91 A;  5AWB A;  1M0Z A;  2FT3 A;  2OMT A;  4PSJ A;  4MN8 B;  1FQV A;  3WPD A;  1FT8 A;  2OMZ A;  1OTN A;  4LSA A;  1U0N D;  3CIY A;  3G39 A;  1XWD C;  5IJD A;  2XOT A;  5FTT B;  3VQ1 A;  3OJA B;  4NKH A;  3TSR E;  2ID5 A;  3OJA A;  3WPH A;  3ZYO A;  3M19 A;  1DS9 A;  4UFR A;  3W3N A;  3C6P B;  1IO0 A;  1OGQ A;  3RGZ A;  4Q3I A;  3DZE A;  4R6A A;  1H6U A;  4Z8G A;  3E3Z A;  2A0Z A;  4U7L A;  2RA8 A;  3ULV A;  3KJ4 A;  4FCG A;  4FDW A;  2OMY A;  2WQX A;  2RR6 A;  3UN9 A;  5B4P A;  4KXF B;  4Q62 A;  3WPF A;  4R07 A;  3ZYN A;  4C2B B;  4J0M A;  3UL7 A;  5AZ5 A;  1WWL A;  3VQ2 A;  2JE0 A;  4LXR A;  2Z65 A;  4BV4 R;  4CNM A;  1DCE A;  1D0B A;  4RCA B;  2CA6 A;  2OMW A;  4TZH A;  4R6J A;  3P72 A;  2OMU A;  3G04 C;  4CIL A;  3RIZ A;  2UZX A;  5AWA A;  4XOS A;  4PQ8 A;  5B0T A;  2AST B;  4QBZ A;  4R08 A;  2Z7X A;  4I6J B;  4IM6 A;  4V2E A;  5GQR K;  2Z82 A;  1Z7X W;  5AWD A;  5D3I A;  2V9S A;  4MQW X;  3REZ A;  1OOK G;  4ECN A;  1M9L A;  1YRG A;  4FS7 A;  2Z66 A;  4R09 A;  3ZYJ A;  3ZYI A;  4BSS A;  2P1M B;  3WPC A;  4Z61 C;  1SQ0 B;  3W3K A;  3WPI A;  4R6G A;  5CMN A;  4LI2 A;  1QYY A;  1K5G C;  2O6S A;  5IYX C;  2P1N B;  5A5C A;  4EZG A;  1FS2 A;  3FXI A;  4LSX C;  2V70 A;  5IJC A;  2Q4G W;  5GMG A;  3PMH G;  1K5D C;  5HZL B;  2Z81 A;  5GS2 B;  3CVR A;  2WFH A;  5GMH A;  3C6N B;  4CNC A;  4U08 A;  4OQT A;  1LTX A;  4PKI G;  4GT6 A;  4YEB B;  5GMF A;  4LSX A;  3W3G A;  2JQD A;  4Z94 G;  4CC4 C;  3RJ0 A;  4PER A;  3G06 A;  2OMX A;  3UL9 A;  2JE1 A;  4PEQ B;  3JB9 j;  1XEU A;  3RW6 A;  2Z64 A;  4M7E C;  2Z63 A;  4L3F A;  3C6O B;  4HQ1 A;  3UL8 A;  1P9A G;  3RW7 A;  3W3M A;  3ULA A;  2O6R A;  4CC4 A;  2Z62 A;  4ECO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...