3G3JA

Crystal structure of the glur6 ligand binding domain dimer i442h k494e k665r i749l q753k mutant with glutamate and nacl at 1.32 angstrom resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
255
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTHLGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKRSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITLAILKLQEEGKLHMMKEKWWRGCPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 80
structure length 255
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3jA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3jA02
3FGSA 3ZKLA 2HAUA 4FEBA 2F97A 4EUOA 1IEJA 1A54A 1LLSA 3PUWE 4PP0A 4R72A 4H5FA 4IY5A 4RK9A 4U4SA 3PD8A 4IO2A 2UVGA 1MY3A 4OETA 4ZEKA 4G8HA 1URDA 1PBPA 3TYHA 1LFHA 2Y7KA 2RCBA 5CBRA 4Z0IA 1JEUA 2HEUA 1BIYA 3OENA 4KI0E 3T96B 2YLNA 3C4MA 2E0SA 2I3VA 4XKPA 1AH5A 1AMFA 2F78A 3SERA 4OFLA 1PB9A 1A8FA 3FJGA 4X1BA 4ZEIA 1A8EA 4G8MA 1P1WA 1FQFA 2O7IA 4R2BA 5DT6A 3V83A 3A3CA 4BDNA 4ZZAA 4F3SA 1D9YA 3JV9A 3OSRA 4F18A 1B2HA 4C1TA 3R7XA 2UYFA 4FIMA 4NF6B 4R73A 3TCGA 4R9FA 4NF8B 3C36A 1J1NA 2DWJA 4KFQA 3S9EA 3TCHA 1WODA 4IB2A 3P7IA 2Z8DA 4JXIA 3H6VA 1DTGA 2Q9TA 1N7WA 2D5WA 4ZE9A 2Y84A 2OBGA 1M5FA 3QXMA 1I6QA 4DCYA 1B5HA 2FA7A 2NXOA 2A5SA 3HCQA 2R6GE 1MY0A 3B6QA 1ELJA 1POY1 1Y4CA 2F35A 5BUUA 4G2ZA 5AA2A 1JETA 3K1MA 4GXAA 3S9MC 4E0XA 3G3GA 1B05A 3VXBA 4K3FA 5JTYA 4MLVA 4DZ1A 5K2XA 4ZE8A 4U22A 3AXFA 3KSJA 2QMWA 2I58A 4ELQA 1H43A 1ZJLA 5H8HB 1B3FA 4YB6A 2XXTA 2Q88A 3OO6A 2ZXTA 2H5YA 4GL8A 3ZKKA 4NWCA 2ZNSA 3O29A 1Y1MA 1A7LA 1B51A 3RLFE 4TLLB 4LP2B 4OESA 1N0TA 2X7PA 3N6UA 4LZ8A 3KGCA 1LAHE 1QVSA 4YKKA 3CG1A 1MPCA 1OQGA 2A5TA 3CSBA 3LC8A 4F22A 3H03A 1JNFA 4AB6A 4ISUA 1F9BA 4JDFA 4IGRA 1Z7ME 3KOSA 3MPLA 5JEIA 4TLMB 5JK4A 3SETA 2V3UA 3HPIA 3N94A 2YJPA 5I56A 2DVZA 5FTHA 2THIA 2O7UA 3KBRA 3IOTA 3K0VA 2DE2A 5B7DA 3IB0A 3TCFA 1HSLA 3KN3A 3T9VA 2NWJA 4QFKA 2RKMA 5HPQA 3U72A 1PC3A 2HXWA 3RTWB 4DCXA 1N84A 1ZIUA 2UXAA 1URSA 4NF6A 2H9BA 4ND9A 3C32A 1TT1A 3S2VA 3E4RA 4NF8A 2AL5A 4HW8A 5KCJA 4F39A 1MDQA 1PB7A 1D4NA 2F36A 1R9QA 1EU8A 4G8NA 2X7QA 2REJA 4XKRA 3VVFA 4RA1A 4LA9A 3R26A 4BDQA 1B1XA 4LATA 3B7DA 1FQDA 3MBPA 4POXA 3G3KA 1UTBA 1FQEA 3SEWA 3O6HA 4LZ5A 2GHBA 1IXHA 4P11A 4KQPA 1XVXA 5HBCA 4NF5B 3F11A 4R6HA 4F29A 1DOTA 2W7YA 2I0BA 1MH3A 4FECA 1SDXA 2NUVA 4FEDA 3EHSA 1OVBA 2XX9A 2PYYA 3TKDA 5KDTB 3H06B 3IK6B 3MAMA 4O3CA 5A5XA 1D9VA 2OWTA 3EQ1A 2O68A 4PFWA 1MPBA 5CMBA 4QFPA 4YKPA 3W9WA 1NL5A 3KG2A 2UVJA 4GOTA 1N04A 1M5DA 4ELPA 2XXIA 3TTMA 4I9DA 3RNNA 2CMOA 1SYIA 1MS7A 3PUZE 5DVIA 3QUJA 4OTEA 3FIRA 1O7TA 3W9VA 4YKJA 1NH8A 3RQTA 4E0WA 3FVGA 3MC2A 4RPNA 3T22A 1XS5A 3V5AA 1Q35A 3JZJA 4RPOA 1MDP1 1FTOA 3CR9A 3MVXA 2DYXA 4IO4A 3D4GA 2DE4A 1MRPA 2VP1A 3MW0A 2O1LA 2PX1A 3I3VA 1CB6A 3PUVE 5L8DA 1VFEA 1VSOA 5I58B 1YPNA 4EXKA 2Z22A 4MF3A 3OO9A 3IL1B 2ANJA 4QSCA 3KJTA 3RY3A 4HS7A 1ZMGA 5EHMA 1MXUA 2V84A 4Q8RA 2ABHA 2DVCA 4LZ7A 4OFOA 4OYVA 2IEEA 3SEUA 2REGA 2HZKA 4OEVA 4ELRA 1MQIA 4F2QA 3UORA 1B1HA 3FZVA 4U21A 3ONMA 3CFXA 4OEUA 1LSTA 4H0WA 2R9JA 4G4PA 4YB7A 2F6PA 1NNFA 4KYSA 3HHFA 3LBSA 3T66A 1I6AA 5CM6A 5KDTA 1BP5A 3RTFB 3H6WA 5TPAB 3IOWA 4WEPA 2RF1A 2B3BA 1MG1A 3EN3A 3HN0A 3PPQA 3LR1A 2F34A 3CVGA 1NH7A 1DTZA 3MVZA 2IA4A 4FAJA 3K1NA 3GLBA 2XXPA 2NOOA 5AA3A 3H6UA 2HQ0A 5DYHA 2VGQA 3K1PA 4IGTA 4GD5A 2Z8FA 4THIA 4GLIA 1H3DA 4H8JA 2I4CA 4U4XA 3A3UA 4UA8A 3C35A 2XD3A 3FXQA 5AA1A 1SW5A 2XXUA 1IXGA 2GH9A 3OO7A 1PBQA 3KSXA 2QMXA 4R74A 3UN6A 3MZ9A 4POWA 1B7HA 4YMBA 1MY2A 2PVUA 5L9OA 4XIGQ 4N13A 5ITPA 3PUYE 2CZLA 3SEVA 3MP8A 4KD5A 5AA4B 4HCYA 4ZS9A 3I5OA 3LSLA 2I6EA 3TODA 3IJXB 3UGWA 1SW2A 1T0KA 3BKIB 1RYXA 3VLWA 3VXCA 2OCUA 1MY1A 1ZBMA 1B5IA 1SYHA 3GXAA 1SI1A 3TTRA 1NNKA 1FCKA 1B32A 1Y9UA 2H25A 3MWBA 4FORA 1NNPA 2BJJX 1XC1A 3EHTA 3O2AA 5B70A 1Y3PA 5EHSA 1TFAA 3PGFA 1DSNA 1B6HA 3G3IA 1S7YA 2GHAA 1B7ZA 2AYSA 4DDDA 2OLBA 3BBRA 5CRYA 1IUDA 3SKPA 2PT2A 2V3TA 1UIUA 1GR2A 4LUBA 4MH5A 4F1UA 3W15C 1B52A 5F7VA 1S50A 4ESXA 2V93A 2VD2A 4JBZA 5I2NA 4F1VA 1II5A 1P1UA 4UACA 3S9LC 1BLFA 1SD3A 3TTKA 4OZ9A 2DWAA 4EQ7A 1B5JA 4NF4A 5I2KA 1HSJA 2Y7RA 2ZYOA 4H1XA 1EZOA 3IORA 4O3BA 4QFOA 4KYEA 1NMUA 3DLNA 2VHAA 3IX1A 2HCAA 1Y1ZA 4F19A 2ZNTA 4Z7EA 4GL0A 2O84X 5H8NB 4LQ5A 3TQWA 1GGGA 3QK6A 1M5BA 1N3WA 1MQHA 3VVDA 4PQJA 2Q89A 5H8FB 1CE2A 1OVTA 1JEVA 4ECFA 3PU5A 4Q0CA 5TU0A 4Q5TA 1N7XA 3C9HA 4F3GA 2F5XA 2R71A 4AB5A 1P1QA 3PPRA 3BFTA 2H98A 3B6TA 3OELA 4GWOA 2B65A 3U8QA 4G68B 1NKXA 2F8DA 3VV5A 2DSFA 1QULA 1Y3QA 5M2VA 3QSLA 2ZYMA 5L9SA 4PFYA 3QUFA 5H8SA 1O63A 3H7MA 4O3AA 4H67A 4G68C 1N3XA 3ILTB 1LFIA 1MXXA 4FJPA 2XXRA 1TFDA 4ELOA 1USYH 1SI0A 1ZU0A 4OVJA 1A55A 3PMXA 2O6AA 4RY1A 2OWSA 3O9PA 3LSXA 4ZDMA 3QYTA 5ITOA 3N26A 4X9TA 3OOAA 1MQGA 3LSFB 1JQFA 4TQUQ 2YPNA 3JYRA 4X1DA 5L9MA 4NWDA 4GRKA 1IXIA 4ZEFA 1I69A 1Q1KA 1QUIA 2QJEA 3EHUA 3TFLA 1IXCA 4XTCQ 2QS2A 3CFZA 3Q29A 3TAJA 1PDAA 4YICA 4ZZEA 3A09A 3Q28A 2ZYNA 3VLUA 3VE1B 4XKQA 2F7CA 1MQDA 1YAEA 5H8HA 2QL3A 5DTBA 1QKAA 3CRBA 2RC8A 3K6VA 1R9LA 3WAFA 3FUZA 4EF1A 1MM7A 4YZZA 2DXRA 3Q27A 2QS1A 1ATGA 5AA2D 2LAOA 5FHNA 2X26A 3D4CA 3E3KA 4RNSA 1LBBA 3RT6B 1FTMA 3RT8A 4FATA 5CMCA 3HSTA 3KZGA 3M3FA 3PPNA 3MUQA 1TWYA 3MVYA 4YU0A 2P0SA 1FQAA 1B7UA 1SW4A 4RYAA 2PBWA 1LAXA 2DWIA 4IO7A 2WKYA 3VVEA 1B3GA 4OWDA 4R6KA 1JW1A 4LVQA 1PB8A 4OFJA 4RJZA 1EZPA 3T9XB 2D3IA 3K6UA 5DEXB 4NTLA 1B3HA 3H3GA 3RN8A 4PE5B 1SVXB 2F7BA 1B9JA 1DMBA 5ISUA 3O6GA 2XX7A 3V89B 1LGBC 1LFGA 2M8CA 2XHDA 3PPOA 3S9NC 3K6WA 2V25A 1PEBA 3ODBA 1USYE 3EF7A 4KPTA 3U93A 3KN8A 3VDFA 2DQVA 3K02A 3KJ7A 2DWHA 4KCCA 4YMAA 1H45A 1RYOA 2RINA 3GBBA 2O51A 2V3QA 3G3HA 3G3FA 3TQLA 3ECRA 1GVCA 3CIJA 1AOVA 1GTKA 2H4IA 1VE4A 3K01A 3RUMA 3TPAA 4NF5A 1A99A 4F31B 1JW5A 3IJOB 1P1OA 1BKAA 3RGYA 3C31A 3O28A 3K6XA 1HSEA 1QUKA 1IITA 1OMPA 4F2OA 4QSDA 4OMBA 1IQ7A 3KN7A 2DP8A 4KR5A 4OXVA 4I1DA 2AL4A 1LBCA 2HFBA 3FVOA 4X48A 3IAZA 5J1DA 2QS3A 1ANFA 4JWOA 2PT1A 4GFRA 1OIBA 2DE3A 4G77A 2OZZA 1Z7NE 4KCDA 4BDMA 4PETA 4WXJA 3IO4A 3M3KA 3U94A 1I6BA 1VFDA 2XXWA 2F6GA 4EQBA 4JSOA 3HHGA 4OHNA 3N6TA 1H44A 1IIWA 5AA2B 2XD2A 3RPWA 5AE4A 5DEXA 4F3BA 2ONKE 2QS4A 2D21A 5I57B 3O66A 4C1UA 1EZ9A 3PPPA 2XXQA 3TEPA 2ESNA 5I58A 3ZSFA 3V8XB 2QPQA 3L6HA 4R2FA 4P0GA 3PUXE 2P2AA 4HTGA 3SEYA 5K2YA 1M5CA 2Y7WA 4WKMA 2F7AA 3OO8A 4EXLA 4RK2A 1FTJA 1NFTA 2A5TB 3T9UA 2RC7A 2KLFA 3CG3A 4P0IA 1GV8A 1B0HA 3HO7A 2RCAA 5ICQA 4H8IA 4ZEBA 3FJ7A 5I56B 2Q2AA 4GXSB 1TXFA 4KYDA 2XXXA 5ELVA 4DXBA 1LAGE 2QRYA 1O64A 4IO6A 3M8UA 1B40A 3EPEA 2O1MA 5TPAA 2PMSA 4NEDA 5KZTA 2QSXA 2UYEA 4OQOA 4DXCA 5ICTA 4M1VA 4NMYA 1MY4A 3UIFA 3E13X 1QKBA 3H6TA 5IAIA 5KCJB 3FATA 1LAFE 1URGA 3CSGA 1XVYA 3FD3A 2G29A 1AL3A 3Q26A 5H8QB 3BFUA 1SW1A 3HV1A 3TELA 3SESA 3MVWA 1B3LA 2Q8JA 1JVYA 3OXNA 3OD7A 4XXUA 5CMMA 3TDJA 1UTBB 3GZGA 4C0RA 4JSDA 3Q25A 1OLCA 5CC2A 4IY6A 1YCJA 2Z23A 1B4ZA 2P1SA 4IO5A 3IOUA 3IB2A 5I57A 1B4HA 3MQ9A 2H99A 4KHZE 3C34A 2UVHA 5CI5A 3T9HB 5AA4A 4MBPA 2ZMBA 1OQHA 1S9TA 2G93A 1M5EA 1ZTYA 5A5XB 4M4GA 1JW4A 4R75A 3USDA 3PMWA 4QRZA 4QFLA 2DS9A 1R6ZA 4YB5A 1ZLQA 4U2RA 4HCWA 3MZ1A 4DIGA 1US5A 2GFEA 3OEMA 3MP1A 4H6DA 3QIMA 4AQ4A 1LB9A 4RXLA 1L5TA 3IB1A 4XKNA 1SBPA 3M3LA 4OERA 4NE4A 1B3EA 4DE8A 4GVOA 1MXWA 1UIVA 1A40A 3SEXA 2I3WA 4IO3A 4QSEA 2XX8A 1AIVA 4OENA 5HM4B 3TTLA 4U1ZA 3S4UA 3C33A 3L6GA 1N76A 2HZLA 2I4BA 1MXVA 4R6YA 2RC9A 4EF2A 3DP8A 3E9XA 5FTIA 4ZEDA 1FW0A 3OEKA 1XHYA 4DLDA 3U1OA 1MH4A 5I84A 2I49A 4GQOA 1LCFA 4PFTA 3IR1A 5H8QA 3FVNA 4FE8A 5TP9B 1XOCA 3MZBA 3KOTA 3R6UA 4BLAA 3H4ZA 2NVUB 5LOMA 3KFMA 5FHMA 3KEIA 1QJMA 1FTLA 3U92A 1H76A 5EYFA 4YKIA 4N6PA 5H8NA 5DVFA 3MPKA 3DELB 2ZYKA 1ZKBA 2Y7PA 4MFIA 5BWJA 1WDNA 2ONSA 1POTA 3TTNA 3IOVA 1UTHB 1JVXA 5H8FA 4F3PA 3FVKA 4BDLA 3THIA 4EDPA 1DPPA 3SDFA 1LB8A 3FV1A 1QW0A 3FASA 3TMGA 3UA8A 4G68A 3DP6A 1LCTA 3FJMA 3O97A 3OMBA 1KWHA 3O6IA 2XXHA 1MM6A 3ZS6A 5I59B 2UVIA 1Y20A 2DXYA 1OLAA 2OJTA 4H5GA 4BDRA 1EH3A 4N07A 1MQJA 4I62A 3MJNA 1P99A 4MLQA 1VR5A 3UP9A 3VLVA 1YTVA 3K2DA 3DP4A 2I0CA 3IO6A 1Y4TA 3DM0A 4ESWA 1D3KA 2ONRA 4F1YA 5DVJA 3WAEA 3K00A 4GF8A 4QF9A 2B3FA 4EQ9A 5FHOA 3I6VA 4LQ2A 4JWYA 1MPDA 1B46A 3FXUA 4R9GA 2ALUA 4GIZA 3ILUB 5TP9A 5CBSA 3T93B 2FYIA 2OK2A 3CI8A 5CMKA 1R1NA 4Q30B 1B0LA 1FQCA 1BTJA 2Z8EA 5F1QA 4TOZA 2I48A 1RKMA 3QAXA 1QUJA 2VD3A 1DPEA 4PFUA 3FXRA 3PMVA 3N5LA 3PV0E 2O69A 1MXYA 1FTKA 4U1OA 2E1SA 3G7WA 4ONYA 1UTHA 1UQWA 4JB7A 1FQBA 3FV2A 3B6WA 2ZNUA 4JWXA 4YAHX 4BDOA 2Q2CA 1MXZA 1SQYA 3GBAA 5I2NB 4QFNA 3TUSA 2VOZA 1IZ1A 4NF4B 3G3JA 3LUYA 3PD9A 4QHQA 5I2KB 1XT8A 4H65A 2AIXA 3CFLA 4ZECA 4LONB 2DOJA 2XXYA 3VFJA 2XXVA 5IKBA 5I59A 3LSWA 2Y7IA 4L17A 5JTYB 3TZAA 2HAVA 4I8CA 3UK4A 1WVJA 2FNCA 1B58A 3MP6A 1Y3NA 1US4A 1NNTA 1P1NA 2GRVA 4DXUA 3K4UA 3OSQA 4WEDA 4U23A
chains in the Genus database with same CATH superfamily
3FGSA 3ZKLA 2HAUA 4FEBA 2F97A 4EUOA 1IEJA 1A54A 1LLSA 3PUWE 4PP0A 4R72A 1FBDA 2B4MA 1KZ8A 4H5FA 4IY5A 4RK9A 4U4SA 3PD8A 4IO2A 1FSAA 2UVGA 1MY3A 4OETA 4ZEKA 4G8HA 4HE2A 1URDA 1PBPA 3TYHA 1LFHA 2Y7KA 2RCBA 5CBRA 4Z0IA 1JEUA 2HEUA 2CZHA 1BIYA 4KXPA 3OENA 4KI0E 3T96B 2YLNA 3E79A 3C4MA 2E0SA 2I3VA 4XKPA 1AH5A 1AMFA 2F78A 3SERA 4OFLA 1PB9A 1A8FA 3FJGA 4X1BA 4ZEIA 1A8EA 4G8MA 2V4CA 1P1WA 1FQFA 2O7IA 4R2BA 5DT6A 1IMDA 3V83A 3A3CA 4BDNA 4ZZAA 4F3SA 1D9YA 4LN5A 3JV9A 3OSRA 4F18A 2WBBA 1B2HA 4C1TA 4HXVA 3R7XA 2UYFA 1RDXA 3CHGA 4FIMA 4MCOA 4NF6B 4R73A 4O94A 3TCGA 4R9FA 4NF8B 3C36A 1J1NA 2DWJA 4KFQA 3S9EA 3TCHA 1WODA 4PAIA 4IB2A 3P7IA 2Z8DA 4JXIA 3H6VA 1DTGA 2Q9TA 1N7WA 2D5WA 4ZE9A 3T0JA 4H46A 2Y84A 2OBGA 1M5FA 3QXMA 1KA1A 1I6QA 4DCYA 1B5HA 2FA7A 2NXOA 2A5SA 3HCQA 2R6GE 4O7IA 1MY0A 3B6QA 1ELJA 1POY1 1Y4CA 2F35A 5BUUA 4G2ZA 5AA2A 1JETA 3K1MA 4GXAA 3S9MC 4E0XA 3G3GA 1B05A 3VXBA 4PBHA 4K3FA 5JTYA 4MLVA 4DZ1A 5K2XA 4ZE8A 4U22A 3AXFA 3KSJA 2QMWA 2I58A 4ELQA 4I40A 1H43A 1ZJLA 5H8HB 1B3FA 4YB6A 2XXTA 2Q88A 3OO6A 2ZXTA 2H5YA 1QGXA 4GL8A 3ZKKA 4NWCA 2ZNSA 3O29A 1Y1MA 1A7LA 1Q9DA 1B51A 3RLFE 4TLLB 4LP2B 4OESA 1N0TA 2X7PA 3N6UA 4LZ8A 3KGCA 1LAHE 1QVSA 3KBZA 4YKKA 3CG1A 4P1LA 1MPCA 1OQGA 2A5TA 3CSBA 3LC8A 4F22A 3H03A 4PAKA 1FBGA 1JNFA 4AB6A 4ISUA 1F9BA 4JDFA 4IGRA 1Z7ME 3KOSA 3MPLA 5JEIA 1FPLA 4TLMB 5JK4A 3SETA 2V3UA 3HPIA 3N94A 4P1EA 2YJPA 5I56A 2DVZA 5FTHA 2THIA 2O7UA 3KBRA 3IOTA 5EYGA 5IGAA 3K0VA 2DE2A 5B7DA 3IB0A 3TCFA 4OVRA 1HSLA 3KN3A 3T9VA 2NWJA 4QFKA 2RKMA 5HPQA 3U72A 1PC3A 2HXWA 3RTWB 4DCXA 1N84A 1ZIUA 2UXAA 1URSA 2HPGA 4NF6A 2H9BA 4ND9A 3C32A 4FBPA 1TT1A 3S2VA 3E4RA 4N81A 2AL5A 4NF8A 4HW8A 5KCJA 3NOHA 4GWXA 4F39A 1MDQA 1PB7A 1D4NA 2F36A 1R9QA 1EU8A 4G8NA 2X7QA 5T3JA 2REJA 4XKRA 3VVFA 2WBDA 4RA1A 4LA9A 3T1BA 3R26A 4BDQA 1B1XA 4LATA 3B7DA 1FQDA 3MBPA 4POXA 3G3KA 1UTBA 1FQEA 1IMCA 3SEWA 3O6HA 4LZ5A 2GHBA 1IXHA 4P11A 4KQPA 1XVXA 4NN3A 5HBCA 4NF5B 3F11A 4R6HA 4F29A 1DOTA 1IMBA 4MHFA 2W7YA 2I0BA 4OVPA 1MH3A 4FECA 1SDXA 2NUVA 2BJIA 4FEDA 3EHSA 4PCDA 1OVBA 2XX9A 2PYYA 3TKDA 5KDTB 3H06B 3IK6B 3MAMA 1NUXA 4O3CA 2OX3A 5A5XA 1D9VA 2OWTA 3EQ1A 2O68A 4PFWA 4XEQA 1MPBA 5CMBA 5F24A 4QFPA 4YKPA 3W9WA 4PF8A 2ZZXA 1NL5A 3KG2A 2UVJA 4GOTA 1N04A 3HFUA 1M5DA 4ELPA 2XXIA 1NUZA 4O8MA 1FBPA 3TTMA 4I9DA 3RNNA 1DBZA 2CMOA 1SYIA 1MS7A 3PUZE 5DVIA 3B50A 3QUJA 4OTEA 4NF0A 3FIRA 1O7TA 3W9VA 4YKJA 1NH8A 3RQTA 4E0WA 3FVGA 3MC2A 4RPNA 3T22A 1XS5A 3V5AA 1Q35A 3JZJA 4RPOA 1MDP1 1FTOA 3CR9A 3MVXA 2DYXA 1NV5A 4IO4A 3D4GA 2DE4A 1MRPA 2VP1A 3MW0A 2O1LA 2PX1A 3I3VA 1CB6A 3PUVE 5L8DA 1VFEA 1VSOA 5I58B 1YPNA 4EXKA 2Z22A 4MF3A 1FPEA 3OO9A 3IL1B 2ANJA 4QSCA 3KJTA 3RY3A 4HS7A 2XXKA 1ZMGA 5EHMA 1MXUA 2V84A 4Q8RA 2ABHA 2DVCA 5EQ7A 4LZ7A 4OFOA 4OYVA 2IEEA 3SEUA 2REGA 1FPDA 2HZKA 4OEVA 3BIHA 4ELRA 1MQIA 4F2QA 3UORA 1B1HA 3FZVA 4U21A 1NV1A 3ONMA 3CFXA 4OEUA 1LSTA 4H0WA 4AS4A 2R9JA 4G4PA 4YB7A 2F6PA 1NNFA 4KYSA 3HHFA 3LBSA 3T66A 1I6AA 5CM6A 5KDTA 1BP5A 3RTFB 3H6WA 5TPAB 3IOWA 3EKIA 4WEPA 2RF1A 2B3BA 1FJ9A 1MG1A 3EN3A 2P3NA 3HN0A 3PPQA 3LR1A 2F34A 3CVGA 1EYIA 1NH7A 1DTZA 4IR8A 3MVZA 2IA4A 4FAJA 3QMFA 3K1NA 3GLBA 2XXPA 2NOOA 5AA3A 3H6UA 2HQ0A 5DYHA 1SPIA 2VGQA 3K1PA 4IGTA 4GD5A 4GWYA 2Z8FA 1DCUA 4THIA 4GLIA 1H3DA 4H8JA 5EYHA 2I4CA 4AS5A 4U4XA 3A3UA 4UA8A 3C35A 2XD3A 3FXQA 5AA1A 1SW5A 2XXUA 1IXGA 2GH9A 1AWBA 5A5LA 3OO7A 1PBQA 3KSXA 5LDZA 2MKZA 2QMXA 5ESYA 4P3LA 4R74A 3UN6A 3MZ9A 4POWA 1FBCA 1B7HA 4YMBA 1MY2A 2PVUA 5L9OA 2XWVA 1BK4A 4XIGQ 4N13A 5ITPA 3SZPA 3PUYE 2CZLA 3SEVA 3MP8A 1RDYA 4KD5A 4MNPA 5AA4B 4HCYA 4ZS9A 3I5OA 3LSLA 2I6EA 3TODA 3IJXB 3UGWA 1SW2A 1T0KA 3BKIB 1RYXA 3VLWA 3VXCA 2OCUA 3RPLA 1MY1A 1ZBMA 4OVTA 1B5IA 1SYHA 3GXAA 1SI1A 3TTRA 1NNKA 1FCKA 2CZIA 1B32A 1Y9UA 2HXRA 2H25A 3MWBA 4FORA 1INPA 1NNPA 2BJJX 1XC1A 3EHTA 3O2AA 4OVQA 5B70A 1Y3PA 5EHSA 1TFAA 3PGFA 4X8RA 1DSNA 1B6HA 3G3IA 1S7YA 2GHAA 2PCRA 1B7ZA 1NI9A 2AYSA 4DDDA 2OLBA 3BBRA 5CRYA 1IUDA 3SKPA 2PT2A 2V3TA 1UIUA 1GR2A 4LUBA 4MH5A 4F1UA 3W15C 1B52A 5F7VA 1S50A 4ESXA 2V93A 2VD2A 4JBZA 1DK4A 5I2NA 4F1VA 1II5A 1IMAA 1P1UA 1LBWA 4UACA 3S9LC 2OWZA 1BLFA 1SD3A 2PFZA 3TTKA 4OZ9A 2DWAA 4EQ7A 1B5JA 4NF4A 5I2KA 1HSJA 2GQ1A 2Y7RA 1FBEA 2ZYOA 4H1XA 1EZOA 4N4UA 3IORA 4GX4A 4O3BA 4QFOA 4KYEA 1NMUA 1LBVA 3DLNA 2VHAA 3IX1A 2HCAA 1FBHA 1Y1ZA 4F19A 2ZNTA 4Z7EA 4GL0A 2O84X 5H8NB 1FPBA 4LQ5A 3KC1A 3TQWA 1GGGA 4GWZA 3QK6A 1M5BA 1N3WA 4NAPA 1MQHA 3VVDA 4PQJA 2Y5LA 2Q89A 1LBZA 5H8FB 1CE2A 1OVTA 1JEVA 4ECFA 5DW8A 3PU5A 4Q0CA 5TU0A 4Q5TA 2VPNA 1N7XA 3C9HA 4F3GA 2F5XA 2R71A 4AB5A 1P1QA 3PPRA 1G0IA 3BFTA 2H98A 2VT5A 3B6TA 3OELA 2KR0A 4GWOA 2B65A 3U8QA 4G68B 2Y5KA 1NKXA 2F8DA 3VV5A 2DSFA 2Q8MA 2PFYA 1QULA 1Y3QA 1EYKA 5M2VA 3QSLA 2ZYMA 4NGUA 1VDWA 5L9SA 4PFYA 3QUFA 5H8SA 1O63A 3H7MA 4O3AA 4H67A 4G68C 1N3XA 2QFLA 3ILTB 1LFIA 1MXXA 4FJPA 2XXRA 1TFDA 4ELOA 1USYH 1SI0A 1ZU0A 4OVJA 3LV0A 1A55A 3PMXA 2O6AA 4RY1A 2OWSA 4GWWA 3O9PA 3LSXA 4ZDMA 4DI3D 3QYTA 5ITOA 2P3VA 3N26A 4X9TA 2XWKA 4GWUA 3OOAA 1MQGA 3LSFB 1JQFA 4TQUQ 2YPNA 3JYRA 4X1DA 5L9MA 2ZZWA 4NWDA 4HE1A 4GRKA 1IXIA 4ZEFA 1I69A 1Q1KA 1QUIA 2QJEA 4PFRA 3EHUA 3TFLA 1IXCA 4XTCQ 2QS2A 4NX1A 3CFZA 3Q29A 3TAJA 1PDAA 4YICA 4ZZEA 3A09A 3Q28A 2ZYNA 3VLUA 3VE1B 4XKQA 2F7CA 1NV0A 1MQDA 1YAEA 5H8HA 2QL3A 5DTBA 4OA4A 1QKAA 3CRBA 2RC8A 3K6VA 1R9LA 3WAFA 3FUZA 4EF1A 1MM7A 4YZZA 2DXRA 3Q27A 2QS1A 4MMPA 1ATGA 5AA2D 4I3EA 2LAOA 5FHNA 2X26A 3D4CA 3E3KA 1YYZA 4RNSA 1LBBA 3RT6B 1FTMA 3RT8A 4FATA 5CMCA 3HSTA 3KZGA 3M3FA 3PPNA 3MUQA 4H45A 1TWYA 3MVYA 4YU0A 2P0SA 1FQAA 1B7UA 5J16A 1SW4A 4RYAA 2PBWA 1LAXA 2DWIA 4IO7A 2WKYA 3VVEA 1B3GA 4JVCA 1KA0A 5I5PA 4OWDA 4R6KA 1JW1A 4LVQA 1PB8A 1NV2A 1JP4A 4OFJA 4MNIA 4RJZA 1EZPA 2XA5A 2QVVA 3T9XB 2D3IA 3K6UA 5DEXB 4NTLA 3IFAA 1B3HA 3H3GA 3RN8A 4PE5B 1SVXB 2F7BA 5IZZA 2WX9A 1B9JA 1DMBA 5ISUA 3O6GA 2XX7A 4OVSA 3V89B 1LGBC 1LFGA 3MYUA 2M8CA 4P9KA 4PFBA 2XHDA 4PDDA 3PPOA 3S9NC 3K6WA 4MEVA 3FBPA 1FPFA 2VPOA 4PBQA 2V25A 1PEBA 4PE3A 3ODBA 1USYE 3EF7A 4KPTA 3U93A 4MX6A 2CEXA 3KN8A 5IZ3B 3VDFA 2DQVA 3K02A 3KJ7A 2DWHA 1YZ0A 4KCCA 4YMAA 1FJ6A 1H45A 1RYOA 2RINA 3GBBA 2WYKA 2O51A 2V3QA 1NV7A 3G3HA 3G3FA 3TQLA 3ECRA 1GVCA 3CIJA 1AOVA 1GTKA 2QVUA 2H4IA 1VE4A 3K01A 3RUMA 3TPAA 4PFIA 4NF5A 1A99A 4F31B 3E78A 1CNQA 1JW5A 3IJOB 1P1OA 1BKAA 3RGYA 3C31A 4N8GA 3O28A 3K6XA 1HSEA 1QUKA 1IITA 1OMPA 4F2OA 4QSDA 4N6DA 4OMBA 1IQ7A 3KN7A 2DP8A 1FPGA 2XWOA 4KR5A 4OXVA 4I1DA 2AL4A 1LBCA 2HFBA 3FVOA 4X48A 3IAZA 5J1DA 2QS3A 1ANFA 4JWOA 4PF6A 2PT1A 1FBFA 4GFRA 1OIBA 2DE3A 4G77A 2OZZA 1Z7NE 4KCDA 4BDMA 4PETA 4WXJA 3IO4A 3MSTA 4P56A 3M3KA 1I6BA 3U94A 1VFDA 2XXWA 2F6GA 4EQBA 3ROJA 4JSOA 3HHGA 4OHNA 3N6TA 1EYJA 1H44A 1IIWA 5AA2B 2XD2A 3RPWA 5AE4A 1IMFA 5DEXA 2ZZVA 4F3BA 2ONKE 2QS4A 3BIGA 2D21A 4MJOA 1NUYA 5I57B 3O66A 4C1UA 1EZ9A 3PPPA 2XXQA 3TEPA 4PGPA 5I3SA 2ESNA 5I58A 3ZSFA 3V8XB 2QPQA 3L6HA 4R2FA 4MAGA 4P0GA 3FXBA 3PUXE 2P2AA 4HTGA 3SEYA 5K2YA 5IZ3A 1M5CA 3ISPA 2Y7WA 4WKMA 2F7AA 3OO8A 4EXLA 3D1RA 4RK2A 1FTJA 1NFTA 2A5TB 3T9UA 2RC7A 4I3YA 2KLFA 3CG3A 4P0IA 2KQZA 1FPJA 1GV8A 1B0HA 3HO7A 2RCAA 5ICQA 4H8IA 4ZEBA 3B8BA 3FJ7A 2B4LA 5I56B 2Q2AA 4GXSB 1TXFA 4KYDA 2XXXA 5ELVA 4DXBA 1LAGE 2QRYA 1O64A 4IO6A 3M8UA 1B40A 3EPEA 2O1MA 5TPAA 2PMSA 4NEDA 5KZTA 2QSXA 2UYEA 4OQOA 4DXCA 2XWIA 5ICTA 4M1VA 4NMYA 1MY4A 3UIFA 3E13X 1QKBA 3H6TA 5IAIA 5KCJB 4HE0A 3FATA 4XF5A 1LAFE 1URGA 3CSGA 1XVYA 3FD3A 2G29A 1AL3A 3Q26A 5H8QB 3BFUA 1K9ZA 1SW1A 3HV1A 3TELA 3SESA 3MVWA 1B3LA 2Q8JA 2FIXA 1LBYA 1JVYA 3OXNA 3OD7A 4XXUA 5CMMA 3TDJA 2L5VA 1UTBB 4NG7A 3GZGA 4C0RA 4JSDA 3Q25A 1OLCA 5CC2A 2QVRA 4IY6A 1YCJA 2Z23A 2HHMA 1B4ZA 1NV4A 2P1SA 1NUWA 4IO5A 4DI4B 3IOUA 3IB2A 5I57A 1B4HA 3MQ9A 4PGNA 2H99A 4KHZE 3C34A 2UVHA 5CI5A 3T9HB 5AA4A 4MBPA 2ZMBA 1OQHA 1S9TA 2G93A 5ET8A 4G61A 1M5EA 1ZTYA 5A5XB 4GX6A 4M4GA 1JW4A 2FBPA 4R75A 3USDA 3PMWA 4QRZA 4QFLA 1XI6A 2DS9A 1R6ZA 4YB5A 1ZLQA 4U2RA 4HCWA 3MZ1A 4DIGA 1US5A 4PC9A 2GFEA 3OEMA 3MP1A 4H6DA 4QXDA 4N6KA 2DDKA 3QIMA 4AQ4A 1LB9A 4RXLA 5ET6A 1L5TA 3IB1A 4XKNA 4GX3A 1SBPA 3M3LA 5ET5A 4OERA 4NE4A 1B3EA 4DE8A 4GVOA 1MXWA 4N17A 1UIVA 1A40A 3SEXA 2I3WA 4IO3A 4QSEA 2XX8A 1AIVA 4OENA 5HM4B 3TTLA 4U1ZA 3S4UA 3C33A 3L6GA 1N76A 2HZLA 2JJKA 4NHBA 2I4BA 2CEYA 1MXVA 4R6YA 2RC9A 4EF2A 4XFEA 3DP8A 3E9XA 5ET7A 5FTIA 4ZEDA 1FW0A 3OEKA 1XHYA 4DLDA 3U1OA 1MH4A 2Q74A 5I84A 2I49A 5LTCA 4PFTA 1LCFA 4GQOA 3IR1A 5EQ8A 5H8QA 3FVNA 2F3DA 4P8BA 4FE8A 5TP9B 4PTKA 1XOCA 3MZBA 2FIEA 3KOTA 3PTYA 3R6UA 2WYPA 4BLAA 3H4ZA 1LBXA 2NVUB 5LOMA 3KFMA 5FHMA 1RDZA 1QJMA 3KEIA 1FTLA 3U92A 1H76A 5EYFA 4YKIA 4N6PA 5H8NA 5DVFA 3MPKA 3DELB 2ZYKA 1ZKBA 2Y7PA 4MFIA 5BWJA 1WDNA 2ONSA 1POTA 3TTNA 3IOVA 1UTHB 5EQ9A 1JVXA 5H8FA 4F3PA 3FVKA 4BDLA 3THIA 4QBAA 4P47A 1DPPA 4EDPA 3SDFA 1LB8A 3FV1A 1QW0A 3FASA 5I7IA 3TMGA 3UA8A 4G68A 4GWSA 4JVDA 1FTAA 3DP6A 3LUZA 1LCTA 3FJMA 3O97A 3OMBA 1KWHA 3GYYA 3O6IA 2XXHA 1MM6A 1FRPA 2FVZA 3ZS6A 4N91A 5IZ1A 5I59B 2UVIA 1Y20A 2DXYA 1OLAA 2OJTA 4NQ8A 4H5GA 4BDRA 1IMEA 1EH3A 1D9QA 4N07A 1MQJA 4I62A 3MJNA 1P99A 4MLQA 1VR5A 3UP9A 3VLVA 5FBPA 1FPKA 1YTVA 3K2DA 3DP4A 1YXIA 4GBVA 2I0CA 3IO6A 1Y4TA 2CZKA 3DM0A 4ESWA 1D3KA 4X04A 2ONRA 4F1YA 4MNCA 5DVJA 3WAEA 3K00A 4GF8A 4QF9A 2B3FA 4EQ9A 5FHOA 3I6VA 4LQ2A 4JWYA 4PDHA 1MPDA 3A29A 2F3BA 1B46A 3FXUA 4R9GA 2ALUA 4GIZA 3ILUB 3RPLB 3RYDA 5TP9A 5CBSA 3T93B 4O7MA 2FYIA 2OK2A 3CI8A 3U65A 5CMKA 1R1NA 4Q30B 2WEFA 1B0LA 1FQCA 1BTJA 3KC0A 2Z8EA 5F1QA 4TOZA 2I48A 4GBWA 1RKMA 3QAXA 1QUJA 5EQAA 2VD3A 1DPEA 4N15A 1K9YA 4PFUA 3FXRA 3PMVA 3N5LA 3PV0E 2O69A 1MXYA 1FTKA 4U1OA 2E1SA 3G7WA 4ONYA 1UTHA 1UQWA 4JB7A 1FQBA 3FV2A 4OANA 2FHYA 3B6WA 4MIJA 1NV3A 2ZNUA 4JWXA 4YAHX 1NV6A 4BDOA 4UABA 2Q2CA 1MXZA 1SQYA 3GBAA 5I2NB 1LEVA 4QFNA 3TUSA 4JVIA 2VOZA 1IZ1A 4NF4B 1FPIA 3G3JA 3LUYA 3PD9A 4QHQA 2R8TA 5I2KB 1XT8A 4H65A 2AIXA 3CFLA 4ZECA 4LONB 2DOJA 2XXYA 3VFJA 2XXVA 5IKBA 5I59A 3LSWA 2Y7IA 4PAFA 4L17A 5JTYB 3TZAA 2HAVA 4I8CA 3UK4A 5IM2A 3IFCA 4N8YA 1WVJA 2FNCA 1B58A 1G0HA 3MP6A 1Y3NA 1US4A 1NNTA 1P1NA 2GRVA 4DXUA 3K4UA 3OSQA 4WEDA 4U23A
chains in the Genus database with same CATH topology
3FGSA 3ZKLA 2HAUA 4FEBA 2F97A 4EUOA 1IEJA 1A54A 1LLSA 3PUWE 4PP0A 4R72A 4H5FA 4IY5A 4RK9A 4U4SA 3PD8A 4IO2A 2UVGA 1MY3A 4OETA 4ZEKA 4G8HA 1URDA 1PBPA 3TYHA 1LFHA 2Y7KA 2RCBA 5CBRA 4Z0IA 1JEUA 2HEUA 1BIYA 3OENA 4KI0E 3T96B 2YLNA 3C4MA 2E0SA 2I3VA 4XKPA 1AH5A 1AMFA 2F78A 3SERA 4OFLA 1PB9A 1A8FA 3FJGA 4X1BA 4ZEIA 1A8EA 4G8MA 1P1WA 1FQFA 2O7IA 4R2BA 5DT6A 3V83A 3A3CA 4BDNA 4ZZAA 4F3SA 1D9YA 3JV9A 3OSRA 4F18A 1B2HA 4C1TA 3R7XA 2UYFA 4FIMA 4NF6B 4R73A 3TCGA 4R9FA 4NF8B 3C36A 1J1NA 2DWJA 4KFQA 3S9EA 3TCHA 1WODA 4IB2A 3P7IA 2Z8DA 4JXIA 3H6VA 1DTGA 2Q9TA 1N7WA 2D5WA 4ZE9A 2Y84A 2OBGA 1M5FA 3QXMA 1I6QA 4DCYA 1B5HA 2FA7A 2NXOA 2A5SA 3HCQA 2R6GE 1MY0A 3B6QA 1ELJA 1POY1 1Y4CA 2F35A 5BUUA 4G2ZA 5AA2A 1JETA 3K1MA 4GXAA 3S9MC 4E0XA 3G3GA 1B05A 3VXBA 4K3FA 5JTYA 4MLVA 4DZ1A 5K2XA 4ZE8A 4U22A 3AXFA 3KSJA 2QMWA 2I58A 4ELQA 1H43A 1ZJLA 5H8HB 1B3FA 4YB6A 2XXTA 2Q88A 3OO6A 2ZXTA 2H5YA 4GL8A 3ZKKA 4NWCA 2ZNSA 3O29A 1Y1MA 1A7LA 1B51A 3RLFE 4TLLB 4LP2B 4OESA 1N0TA 2X7PA 3N6UA 4LZ8A 3KGCA 1LAHE 1QVSA 4YKKA 3CG1A 1MPCA 1OQGA 2A5TA 3CSBA 3LC8A 4F22A 3H03A 1JNFA 4AB6A 4ISUA 1F9BA 4JDFA 4IGRA 1Z7ME 3KOSA 3MPLA 5JEIA 4TLMB 5JK4A 3SETA 2V3UA 3HPIA 3N94A 2YJPA 5I56A 2DVZA 5FTHA 2THIA 2O7UA 3KBRA 3IOTA 3K0VA 2DE2A 5B7DA 3IB0A 3TCFA 1HSLA 3KN3A 3T9VA 2NWJA 4QFKA 2RKMA 5HPQA 3U72A 1PC3A 2HXWA 3RTWB 4DCXA 1N84A 1ZIUA 2UXAA 1URSA 4NF6A 2H9BA 4ND9A 3C32A 1TT1A 3S2VA 3E4RA 4NF8A 2AL5A 4HW8A 5KCJA 4F39A 1MDQA 1PB7A 1D4NA 2F36A 1R9QA 1EU8A 4G8NA 2X7QA 2REJA 4XKRA 3VVFA 4RA1A 4LA9A 3R26A 4BDQA 1B1XA 4LATA 3B7DA 1FQDA 3MBPA 4POXA 3G3KA 1UTBA 1FQEA 3SEWA 3O6HA 4LZ5A 2GHBA 1IXHA 4P11A 4KQPA 1XVXA 5HBCA 4NF5B 3F11A 4R6HA 4F29A 1DOTA 2W7YA 2I0BA 1MH3A 4FECA 1SDXA 2NUVA 4FEDA 3EHSA 1OVBA 2XX9A 2PYYA 3TKDA 5KDTB 3H06B 3IK6B 3MAMA 4O3CA 5A5XA 1D9VA 2OWTA 3EQ1A 2O68A 4PFWA 1MPBA 5CMBA 4QFPA 4YKPA 3W9WA 1NL5A 3KG2A 2UVJA 4GOTA 1N04A 1M5DA 4ELPA 2XXIA 3TTMA 4I9DA 3RNNA 2CMOA 1SYIA 1MS7A 3PUZE 5DVIA 3QUJA 4OTEA 3FIRA 1O7TA 3W9VA 4YKJA 1NH8A 3RQTA 4E0WA 3FVGA 3MC2A 4RPNA 3T22A 1XS5A 3V5AA 1Q35A 3JZJA 4RPOA 1MDP1 1FTOA 3CR9A 3MVXA 2DYXA 4IO4A 3D4GA 2DE4A 1MRPA 2VP1A 3MW0A 2O1LA 2PX1A 3I3VA 1CB6A 3PUVE 5L8DA 1VFEA 1VSOA 5I58B 1YPNA 4EXKA 2Z22A 4MF3A 3OO9A 3IL1B 2ANJA 4QSCA 3KJTA 3RY3A 4HS7A 1ZMGA 5EHMA 1MXUA 2V84A 4Q8RA 2ABHA 2DVCA 4LZ7A 4OFOA 4OYVA 2IEEA 3SEUA 2REGA 2HZKA 4OEVA 4ELRA 1MQIA 4F2QA 3UORA 1B1HA 3FZVA 4U21A 3ONMA 3CFXA 4OEUA 1LSTA 4H0WA 2R9JA 4G4PA 4YB7A 2F6PA 1NNFA 4KYSA 3HHFA 3LBSA 3T66A 1I6AA 5CM6A 5KDTA 1BP5A 3RTFB 3H6WA 5TPAB 3IOWA 4WEPA 2RF1A 2B3BA 1MG1A 3EN3A 3HN0A 3PPQA 3LR1A 2F34A 3CVGA 1NH7A 1DTZA 3MVZA 2IA4A 4FAJA 3K1NA 3GLBA 2XXPA 2NOOA 5AA3A 3H6UA 2HQ0A 5DYHA 2VGQA 3K1PA 4IGTA 4GD5A 2Z8FA 4THIA 4GLIA 1H3DA 4H8JA 2I4CA 4U4XA 3A3UA 4UA8A 3C35A 2XD3A 3FXQA 5AA1A 1SW5A 2XXUA 1IXGA 2GH9A 3OO7A 1PBQA 3KSXA 2QMXA 4R74A 3UN6A 3MZ9A 4POWA 1B7HA 4YMBA 1MY2A 2PVUA 5L9OA 4XIGQ 4N13A 5ITPA 3PUYE 2CZLA 3SEVA 3MP8A 4KD5A 5AA4B 4HCYA 4ZS9A 3I5OA 3LSLA 2I6EA 3TODA 3IJXB 3UGWA 1SW2A 1T0KA 3BKIB 1RYXA 3VLWA 3VXCA 2OCUA 1MY1A 1ZBMA 1B5IA 1SYHA 3GXAA 1SI1A 3TTRA 1NNKA 1FCKA 1B32A 1Y9UA 2H25A 3MWBA 4FORA 1NNPA 2BJJX 1XC1A 3EHTA 3O2AA 5B70A 1Y3PA 5EHSA 1TFAA 3PGFA 1DSNA 1B6HA 3G3IA 1S7YA 2GHAA 1B7ZA 2AYSA 4DDDA 2OLBA 3BBRA 5CRYA 1IUDA 3SKPA 2PT2A 2V3TA 1UIUA 1GR2A 4LUBA 4MH5A 4F1UA 3W15C 1B52A 5F7VA 1S50A 4ESXA 2V93A 2VD2A 4JBZA 5I2NA 4F1VA 1II5A 1P1UA 4UACA 3S9LC 1BLFA 1SD3A 3TTKA 4OZ9A 2DWAA 4EQ7A 1B5JA 4NF4A 5I2KA 1HSJA 2Y7RA 2ZYOA 4H1XA 1EZOA 3IORA 4O3BA 4QFOA 4KYEA 1NMUA 3DLNA 2VHAA 3IX1A 2HCAA 1Y1ZA 4F19A 2ZNTA 4Z7EA 4GL0A 2O84X 5H8NB 4LQ5A 3TQWA 1GGGA 3QK6A 1M5BA 1N3WA 1MQHA 3VVDA 4PQJA 2Q89A 5H8FB 1CE2A 1OVTA 1JEVA 4ECFA 3PU5A 4Q0CA 5TU0A 4Q5TA 1N7XA 3C9HA 4F3GA 2F5XA 2R71A 4AB5A 1P1QA 3PPRA 3BFTA 2H98A 3B6TA 3OELA 4GWOA 2B65A 3U8QA 4G68B 1NKXA 2F8DA 3VV5A 2DSFA 1QULA 1Y3QA 5M2VA 3QSLA 2ZYMA 5L9SA 4PFYA 3QUFA 5H8SA 1O63A 3H7MA 4O3AA 4H67A 4G68C 1N3XA 3ILTB 1LFIA 1MXXA 4FJPA 2XXRA 1TFDA 4ELOA 1USYH 1SI0A 1ZU0A 4OVJA 1A55A 3PMXA 2O6AA 4RY1A 2OWSA 3O9PA 3LSXA 4ZDMA 3QYTA 5ITOA 3N26A 4X9TA 3OOAA 1MQGA 3LSFB 1JQFA 4TQUQ 2YPNA 3JYRA 4X1DA 5L9MA 4NWDA 4GRKA 1IXIA 4ZEFA 1I69A 1Q1KA 1QUIA 2QJEA 3EHUA 3TFLA 1IXCA 4XTCQ 2QS2A 3CFZA 3Q29A 3TAJA 1PDAA 4YICA 4ZZEA 3A09A 3Q28A 2ZYNA 3VLUA 3VE1B 4XKQA 2F7CA 1MQDA 1YAEA 5H8HA 2QL3A 5DTBA 1QKAA 3CRBA 2RC8A 3K6VA 1R9LA 3WAFA 3FUZA 4EF1A 1MM7A 4YZZA 2DXRA 3Q27A 2QS1A 1ATGA 5AA2D 2LAOA 5FHNA 2X26A 3D4CA 3E3KA 4RNSA 1LBBA 3RT6B 1FTMA 3RT8A 4FATA 5CMCA 3HSTA 3KZGA 3M3FA 3PPNA 3MUQA 1TWYA 3MVYA 4YU0A 2P0SA 1FQAA 1B7UA 1SW4A 4RYAA 2PBWA 1LAXA 2DWIA 4IO7A 2WKYA 3VVEA 1B3GA 4OWDA 4R6KA 1JW1A 4LVQA 1PB8A 4OFJA 4RJZA 1EZPA 3T9XB 2D3IA 3K6UA 5DEXB 4NTLA 1B3HA 3H3GA 3RN8A 4PE5B 1SVXB 2F7BA 1B9JA 1DMBA 5ISUA 3O6GA 2XX7A 3V89B 1LGBC 1LFGA 2M8CA 2XHDA 3PPOA 3S9NC 3K6WA 2V25A 1PEBA 3ODBA 1USYE 3EF7A 4KPTA 3U93A 3KN8A 3VDFA 2DQVA 3K02A 3KJ7A 2DWHA 4KCCA 4YMAA 1H45A 1RYOA 2RINA 3GBBA 2O51A 2V3QA 3G3HA 3G3FA 3TQLA 3ECRA 1GVCA 3CIJA 1AOVA 1GTKA 2H4IA 1VE4A 3K01A 3RUMA 3TPAA 4NF5A 1A99A 4F31B 1JW5A 3IJOB 1P1OA 1BKAA 3RGYA 3C31A 3O28A 3K6XA 1HSEA 1QUKA 1IITA 1OMPA 4F2OA 4QSDA 4OMBA 1IQ7A 3KN7A 2DP8A 4KR5A 4OXVA 4I1DA 2AL4A 1LBCA 2HFBA 3FVOA 4X48A 3IAZA 5J1DA 2QS3A 1ANFA 4JWOA 2PT1A 4GFRA 1OIBA 2DE3A 4G77A 2OZZA 1Z7NE 4KCDA 4BDMA 4PETA 4WXJA 3IO4A 3M3KA 3U94A 1I6BA 1VFDA 2XXWA 2F6GA 4EQBA 4JSOA 3HHGA 4OHNA 3N6TA 1H44A 1IIWA 5AA2B 2XD2A 3RPWA 5AE4A 5DEXA 4F3BA 2ONKE 2QS4A 2D21A 5I57B 3O66A 4C1UA 1EZ9A 3PPPA 2XXQA 3TEPA 2ESNA 5I58A 3ZSFA 3V8XB 2QPQA 3L6HA 4R2FA 4P0GA 3PUXE 2P2AA 4HTGA 3SEYA 5K2YA 1M5CA 2Y7WA 4WKMA 2F7AA 3OO8A 4EXLA 4RK2A 1FTJA 1NFTA 2A5TB 3T9UA 2RC7A 2KLFA 3CG3A 4P0IA 1GV8A 1B0HA 3HO7A 2RCAA 5ICQA 4H8IA 4ZEBA 3FJ7A 5I56B 2Q2AA 4GXSB 1TXFA 4KYDA 2XXXA 5ELVA 4DXBA 1LAGE 2QRYA 1O64A 4IO6A 3M8UA 1B40A 3EPEA 2O1MA 5TPAA 2PMSA 4NEDA 5KZTA 2QSXA 2UYEA 4OQOA 4DXCA 5ICTA 4M1VA 4NMYA 1MY4A 3UIFA 3E13X 1QKBA 3H6TA 5IAIA 5KCJB 3FATA 1LAFE 1URGA 3CSGA 1XVYA 3FD3A 2G29A 1AL3A 3Q26A 5H8QB 3BFUA 1SW1A 3HV1A 3TELA 3SESA 3MVWA 1B3LA 2Q8JA 1JVYA 3OXNA 3OD7A 4XXUA 5CMMA 3TDJA 1UTBB 3GZGA 4C0RA 4JSDA 3Q25A 1OLCA 5CC2A 4IY6A 1YCJA 2Z23A 1B4ZA 2P1SA 4IO5A 3IOUA 3IB2A 5I57A 1B4HA 3MQ9A 2H99A 4KHZE 3C34A 2UVHA 5CI5A 3T9HB 5AA4A 4MBPA 2ZMBA 1OQHA 1S9TA 2G93A 1M5EA 1ZTYA 5A5XB 4M4GA 1JW4A 4R75A 3USDA 3PMWA 4QRZA 4QFLA 2DS9A 1R6ZA 4YB5A 1ZLQA 4U2RA 4HCWA 3MZ1A 4DIGA 1US5A 2GFEA 3OEMA 3MP1A 4H6DA 3QIMA 4AQ4A 1LB9A 4RXLA 1L5TA 3IB1A 4XKNA 1SBPA 3M3LA 4OERA 4NE4A 1B3EA 4DE8A 4GVOA 1MXWA 1UIVA 1A40A 3SEXA 2I3WA 4IO3A 4QSEA 2XX8A 1AIVA 4OENA 5HM4B 3TTLA 4U1ZA 3S4UA 3C33A 3L6GA 1N76A 2HZLA 2I4BA 1MXVA 4R6YA 2RC9A 4EF2A 3DP8A 3E9XA 5FTIA 4ZEDA 1FW0A 3OEKA 1XHYA 4DLDA 3U1OA 1MH4A 5I84A 2I49A 4GQOA 1LCFA 4PFTA 3IR1A 5H8QA 3FVNA 4FE8A 5TP9B 1XOCA 3MZBA 3KOTA 3R6UA 4BLAA 3H4ZA 2NVUB 5LOMA 3KFMA 5FHMA 3KEIA 1QJMA 1FTLA 3U92A 1H76A 5EYFA 4YKIA 4N6PA 5H8NA 5DVFA 3MPKA 3DELB 2ZYKA 1ZKBA 2Y7PA 4MFIA 5BWJA 1WDNA 2ONSA 1POTA 3TTNA 3IOVA 1UTHB 1JVXA 5H8FA 4F3PA 3FVKA 4BDLA 3THIA 4EDPA 1DPPA 3SDFA 1LB8A 3FV1A 1QW0A 3FASA 3TMGA 3UA8A 4G68A 3DP6A 1LCTA 3FJMA 3O97A 3OMBA 1KWHA 3O6IA 2XXHA 1MM6A 3ZS6A 5I59B 2UVIA 1Y20A 2DXYA 1OLAA 2OJTA 4H5GA 4BDRA 1EH3A 4N07A 1MQJA 4I62A 3MJNA 1P99A 4MLQA 1VR5A 3UP9A 3VLVA 1YTVA 3K2DA 3DP4A 2I0CA 3IO6A 1Y4TA 3DM0A 4ESWA 1D3KA 2ONRA 4F1YA 5DVJA 3WAEA 3K00A 4GF8A 4QF9A 2B3FA 4EQ9A 5FHOA 3I6VA 4LQ2A 4JWYA 1MPDA 1B46A 3FXUA 4R9GA 2ALUA 4GIZA 3ILUB 5TP9A 5CBSA 3T93B 2FYIA 2OK2A 3CI8A 5CMKA 1R1NA 4Q30B 1B0LA 1FQCA 1BTJA 2Z8EA 5F1QA 4TOZA 2I48A 1RKMA 3QAXA 1QUJA 2VD3A 1DPEA 4PFUA 3FXRA 3PMVA 3N5LA 3PV0E 2O69A 1MXYA 1FTKA 4U1OA 2E1SA 3G7WA 4ONYA 1UTHA 1UQWA 4JB7A 1FQBA 3FV2A 3B6WA 2ZNUA 4JWXA 4YAHX 4BDOA 2Q2CA 1MXZA 1SQYA 3GBAA 5I2NB 4QFNA 3TUSA 2VOZA 1IZ1A 4NF4B 3G3JA 3LUYA 3PD9A 4QHQA 5I2KB 1XT8A 4H65A 2AIXA 3CFLA 4ZECA 4LONB 2DOJA 2XXYA 3VFJA 2XXVA 5IKBA 5I59A 3LSWA 2Y7IA 4L17A 5JTYB 3TZAA 2HAVA 4I8CA 3UK4A 1WVJA 2FNCA 1B58A 3MP6A 1Y3NA 1US4A 1NNTA 1P1NA 2GRVA 4DXUA 3K4UA 3OSQA 4WEDA 4U23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGS A;  3ZKL A;  2HAU A;  4FEB A;  2F97 A;  4EUO A;  1IEJ A;  1A54 A;  1LLS A;  3PUW E;  4PP0 A;  4R72 A;  4H5F A;  4IY5 A;  4RK9 A;  4U4S A;  3PD8 A;  4IO2 A;  2UVG A;  1MY3 A;  4OET A;  4ZEK A;  4G8H A;  1URD A;  1PBP A;  3TYH A;  1LFH A;  2Y7K A;  2RCB A;  5CBR A;  4Z0I A;  1JEU A;  2HEU A;  1BIY A;  3OEN A;  4KI0 E;  3T96 B;  2YLN A;  3C4M A;  2E0S A;  2I3V A;  4XKP A;  1AH5 A;  1AMF A;  2F78 A;  3SER A;  4OFL A;  1PB9 A;  1A8F A;  3FJG A;  4X1B A;  4ZEI A;  1A8E A;  4G8M A;  1P1W A;  1FQF A;  2O7I A;  4R2B A;  5DT6 A;  3V83 A;  3A3C A;  4BDN A;  4ZZA A;  4F3S A;  1D9Y A;  3JV9 A;  3OSR A;  4F18 A;  1B2H A;  4C1T A;  3R7X A;  2UYF A;  4FIM A;  4NF6 B;  4R73 A;  3TCG A;  4R9F A;  4NF8 B;  3C36 A;  1J1N A;  2DWJ A;  4KFQ A;  3S9E A;  3TCH A;  1WOD A;  4IB2 A;  3P7I A;  2Z8D A;  4JXI A;  3H6V A;  1DTG A;  2Q9T A;  1N7W A;  2D5W A;  4ZE9 A;  2Y84 A;  2OBG A;  1M5F A;  3QXM A;  1I6Q A;  4DCY A;  1B5H A;  2FA7 A;  2NXO A;  2A5S A;  3HCQ A;  2R6G E;  1MY0 A;  3B6Q A;  1ELJ A;  1POY 1;  1Y4C A;  2F35 A;  5BUU A;  4G2Z A;  5AA2 A;  1JET A;  3K1M A;  4GXA A;  3S9M C;  4E0X A;  3G3G A;  1B05 A;  3VXB A;  4K3F A;  5JTY A;  4MLV A;  4DZ1 A;  5K2X A;  4ZE8 A;  4U22 A;  3AXF A;  3KSJ A;  2QMW A;  2I58 A;  4ELQ A;  1H43 A;  1ZJL A;  5H8H B;  1B3F A;  4YB6 A;  2XXT A;  2Q88 A;  3OO6 A;  2ZXT A;  2H5Y A;  4GL8 A;  3ZKK A;  4NWC A;  2ZNS A;  3O29 A;  1Y1M A;  1A7L A;  1B51 A;  3RLF E;  4TLL B;  4LP2 B;  4OES A;  1N0T A;  2X7P A;  3N6U A;  4LZ8 A;  3KGC A;  1LAH E;  1QVS A;  4YKK A;  3CG1 A;  1MPC A;  1OQG A;  2A5T A;  3CSB A;  3LC8 A;  4F22 A;  3H03 A;  1JNF A;  4AB6 A;  4ISU A;  1F9B A;  4JDF A;  4IGR A;  1Z7M E;  3KOS A;  3MPL A;  5JEI A;  4TLM B;  5JK4 A;  3SET A;  2V3U A;  3HPI A;  3N94 A;  2YJP A;  5I56 A;  2DVZ A;  5FTH A;  2THI A;  2O7U A;  3KBR A;  3IOT A;  3K0V A;  2DE2 A;  5B7D A;  3IB0 A;  3TCF A;  1HSL A;  3KN3 A;  3T9V A;  2NWJ A;  4QFK A;  2RKM A;  5HPQ A;  3U72 A;  1PC3 A;  2HXW A;  3RTW B;  4DCX A;  1N84 A;  1ZIU A;  2UXA A;  1URS A;  4NF6 A;  2H9B A;  4ND9 A;  3C32 A;  1TT1 A;  3S2V A;  3E4R A;  4NF8 A;  2AL5 A;  4HW8 A;  5KCJ A;  4F39 A;  1MDQ A;  1PB7 A;  1D4N A;  2F36 A;  1R9Q A;  1EU8 A;  4G8N A;  2X7Q A;  2REJ A;  4XKR A;  3VVF A;  4RA1 A;  4LA9 A;  3R26 A;  4BDQ A;  1B1X A;  4LAT A;  3B7D A;  1FQD A;  3MBP A;  4POX A;  3G3K A;  1UTB A;  1FQE A;  3SEW A;  3O6H A;  4LZ5 A;  2GHB A;  1IXH A;  4P11 A;  4KQP A;  1XVX A;  5HBC A;  4NF5 B;  3F11 A;  4R6H A;  4F29 A;  1DOT A;  2W7Y A;  2I0B A;  1MH3 A;  4FEC A;  1SDX A;  2NUV A;  4FED A;  3EHS A;  1OVB A;  2XX9 A;  2PYY A;  3TKD A;  5KDT B;  3H06 B;  3IK6 B;  3MAM A;  4O3C A;  5A5X A;  1D9V A;  2OWT A;  3EQ1 A;  2O68 A;  4PFW A;  1MPB A;  5CMB A;  4QFP A;  4YKP A;  3W9W A;  1NL5 A;  3KG2 A;  2UVJ A;  4GOT A;  1N04 A;  1M5D A;  4ELP A;  2XXI A;  3TTM A;  4I9D A;  3RNN A;  2CMO A;  1SYI A;  1MS7 A;  3PUZ E;  5DVI A;  3QUJ A;  4OTE A;  3FIR A;  1O7T A;  3W9V A;  4YKJ A;  1NH8 A;  3RQT A;  4E0W A;  3FVG A;  3MC2 A;  4RPN A;  3T22 A;  1XS5 A;  3V5A A;  1Q35 A;  3JZJ A;  4RPO A;  1MDP 1;  1FTO A;  3CR9 A;  3MVX A;  2DYX A;  4IO4 A;  3D4G A;  2DE4 A;  1MRP A;  2VP1 A;  3MW0 A;  2O1L A;  2PX1 A;  3I3V A;  1CB6 A;  3PUV E;  5L8D A;  1VFE A;  1VSO A;  5I58 B;  1YPN A;  4EXK A;  2Z22 A;  4MF3 A;  3OO9 A;  3IL1 B;  2ANJ A;  4QSC A;  3KJT A;  3RY3 A;  4HS7 A;  1ZMG A;  5EHM A;  1MXU A;  2V84 A;  4Q8R A;  2ABH A;  2DVC A;  4LZ7 A;  4OFO A;  4OYV A;  2IEE A;  3SEU A;  2REG A;  2HZK A;  4OEV A;  4ELR A;  1MQI A;  4F2Q A;  3UOR A;  1B1H A;  3FZV A;  4U21 A;  3ONM A;  3CFX A;  4OEU A;  1LST A;  4H0W A;  2R9J A;  4G4P A;  4YB7 A;  2F6P A;  1NNF A;  4KYS A;  3HHF A;  3LBS A;  3T66 A;  1I6A A;  5CM6 A;  5KDT A;  1BP5 A;  3RTF B;  3H6W A;  5TPA B;  3IOW A;  4WEP A;  2RF1 A;  2B3B A;  1MG1 A;  3EN3 A;  3HN0 A;  3PPQ A;  3LR1 A;  2F34 A;  3CVG A;  1NH7 A;  1DTZ A;  3MVZ A;  2IA4 A;  4FAJ A;  3K1N A;  3GLB A;  2XXP A;  2NOO A;  5AA3 A;  3H6U A;  2HQ0 A;  5DYH A;  2VGQ A;  3K1P A;  4IGT A;  4GD5 A;  2Z8F A;  4THI A;  4GLI A;  1H3D A;  4H8J A;  2I4C A;  4U4X A;  3A3U A;  4UA8 A;  3C35 A;  2XD3 A;  3FXQ A;  5AA1 A;  1SW5 A;  2XXU A;  1IXG A;  2GH9 A;  3OO7 A;  1PBQ A;  3KSX A;  2QMX A;  4R74 A;  3UN6 A;  3MZ9 A;  4POW A;  1B7H A;  4YMB A;  1MY2 A;  2PVU A;  5L9O A;  4XIG Q;  4N13 A;  5ITP A;  3PUY E;  2CZL A;  3SEV A;  3MP8 A;  4KD5 A;  5AA4 B;  4HCY A;  4ZS9 A;  3I5O A;  3LSL A;  2I6E A;  3TOD A;  3IJX B;  3UGW A;  1SW2 A;  1T0K A;  3BKI B;  1RYX A;  3VLW A;  3VXC A;  2OCU A;  1MY1 A;  1ZBM A;  1B5I A;  1SYH A;  3GXA A;  1SI1 A;  3TTR A;  1NNK A;  1FCK A;  1B32 A;  1Y9U A;  2H25 A;  3MWB A;  4FOR A;  1NNP A;  2BJJ X;  1XC1 A;  3EHT A;  3O2A A;  5B70 A;  1Y3P A;  5EHS A;  1TFA A;  3PGF A;  1DSN A;  1B6H A;  3G3I A;  1S7Y A;  2GHA A;  1B7Z A;  2AYS A;  4DDD A;  2OLB A;  3BBR A;  5CRY A;  1IUD A;  3SKP A;  2PT2 A;  2V3T A;  1UIU A;  1GR2 A;  4LUB A;  4MH5 A;  4F1U A;  3W15 C;  1B52 A;  5F7V A;  1S50 A;  4ESX A;  2V93 A;  2VD2 A;  4JBZ A;  5I2N A;  4F1V A;  1II5 A;  1P1U A;  4UAC A;  3S9L C;  1BLF A;  1SD3 A;  3TTK A;  4OZ9 A;  2DWA A;  4EQ7 A;  1B5J A;  4NF4 A;  5I2K A;  1HSJ A;  2Y7R A;  2ZYO A;  4H1X A;  1EZO A;  3IOR A;  4O3B A;  4QFO A;  4KYE A;  1NMU A;  3DLN A;  2VHA A;  3IX1 A;  2HCA A;  1Y1Z A;  4F19 A;  2ZNT A;  4Z7E A;  4GL0 A;  2O84 X;  5H8N B;  4LQ5 A;  3TQW A;  1GGG A;  3QK6 A;  1M5B A;  1N3W A;  1MQH A;  3VVD A;  4PQJ A;  2Q89 A;  5H8F B;  1CE2 A;  1OVT A;  1JEV A;  4ECF A;  3PU5 A;  4Q0C A;  5TU0 A;  4Q5T A;  1N7X A;  3C9H A;  4F3G A;  2F5X A;  2R71 A;  4AB5 A;  1P1Q A;  3PPR A;  3BFT A;  2H98 A;  3B6T A;  3OEL A;  4GWO A;  2B65 A;  3U8Q A;  4G68 B;  1NKX A;  2F8D A;  3VV5 A;  2DSF A;  1QUL A;  1Y3Q A;  5M2V A;  3QSL A;  2ZYM A;  5L9S A;  4PFY A;  3QUF A;  5H8S A;  1O63 A;  3H7M A;  4O3A A;  4H67 A;  4G68 C;  1N3X A;  3ILT B;  1LFI A;  1MXX A;  4FJP A;  2XXR A;  1TFD A;  4ELO A;  1USY H;  1SI0 A;  1ZU0 A;  4OVJ A;  1A55 A;  3PMX A;  2O6A A;  4RY1 A;  2OWS A;  3O9P A;  3LSX A;  4ZDM A;  3QYT A;  5ITO A;  3N26 A;  4X9T A;  3OOA A;  1MQG A;  3LSF B;  1JQF A;  4TQU Q;  2YPN A;  3JYR A;  4X1D A;  5L9M A;  4NWD A;  4GRK A;  1IXI A;  4ZEF A;  1I69 A;  1Q1K A;  1QUI A;  2QJE A;  3EHU A;  3TFL A;  1IXC A;  4XTC Q;  2QS2 A;  3CFZ A;  3Q29 A;  3TAJ A;  1PDA A;  4YIC A;  4ZZE A;  3A09 A;  3Q28 A;  2ZYN A;  3VLU A;  3VE1 B;  4XKQ A;  2F7C A;  1MQD A;  1YAE A;  5H8H A;  2QL3 A;  5DTB A;  1QKA A;  3CRB A;  2RC8 A;  3K6V A;  1R9L A;  3WAF A;  3FUZ A;  4EF1 A;  1MM7 A;  4YZZ A;  2DXR A;  3Q27 A;  2QS1 A;  1ATG A;  5AA2 D;  2LAO A;  5FHN A;  2X26 A;  3D4C A;  3E3K A;  4RNS A;  1LBB A;  3RT6 B;  1FTM A;  3RT8 A;  4FAT A;  5CMC A;  3HST A;  3KZG A;  3M3F A;  3PPN A;  3MUQ A;  1TWY A;  3MVY A;  4YU0 A;  2P0S A;  1FQA A;  1B7U A;  1SW4 A;  4RYA A;  2PBW A;  1LAX A;  2DWI A;  4IO7 A;  2WKY A;  3VVE A;  1B3G A;  4OWD A;  4R6K A;  1JW1 A;  4LVQ A;  1PB8 A;  4OFJ A;  4RJZ A;  1EZP A;  3T9X B;  2D3I A;  3K6U A;  5DEX B;  4NTL A;  1B3H A;  3H3G A;  3RN8 A;  4PE5 B;  1SVX B;  2F7B A;  1B9J A;  1DMB A;  5ISU A;  3O6G A;  2XX7 A;  3V89 B;  1LGB C;  1LFG A;  2M8C A;  2XHD A;  3PPO A;  3S9N C;  3K6W A;  2V25 A;  1PEB A;  3ODB A;  1USY E;  3EF7 A;  4KPT A;  3U93 A;  3KN8 A;  3VDF A;  2DQV A;  3K02 A;  3KJ7 A;  2DWH A;  4KCC A;  4YMA A;  1H45 A;  1RYO A;  2RIN A;  3GBB A;  2O51 A;  2V3Q A;  3G3H A;  3G3F A;  3TQL A;  3ECR A;  1GVC A;  3CIJ A;  1AOV A;  1GTK A;  2H4I A;  1VE4 A;  3K01 A;  3RUM A;  3TPA A;  4NF5 A;  1A99 A;  4F31 B;  1JW5 A;  3IJO B;  1P1O A;  1BKA A;  3RGY A;  3C31 A;  3O28 A;  3K6X A;  1HSE A;  1QUK A;  1IIT A;  1OMP A;  4F2O A;  4QSD A;  4OMB A;  1IQ7 A;  3KN7 A;  2DP8 A;  4KR5 A;  4OXV A;  4I1D A;  2AL4 A;  1LBC A;  2HFB A;  3FVO A;  4X48 A;  3IAZ A;  5J1D A;  2QS3 A;  1ANF A;  4JWO A;  2PT1 A;  4GFR A;  1OIB A;  2DE3 A;  4G77 A;  2OZZ A;  1Z7N E;  4KCD A;  4BDM A;  4PET A;  4WXJ A;  3IO4 A;  3M3K A;  3U94 A;  1I6B A;  1VFD A;  2XXW A;  2F6G A;  4EQB A;  4JSO A;  3HHG A;  4OHN A;  3N6T A;  1H44 A;  1IIW A;  5AA2 B;  2XD2 A;  3RPW A;  5AE4 A;  5DEX A;  4F3B A;  2ONK E;  2QS4 A;  2D21 A;  5I57 B;  3O66 A;  4C1U A;  1EZ9 A;  3PPP A;  2XXQ A;  3TEP A;  2ESN A;  5I58 A;  3ZSF A;  3V8X B;  2QPQ A;  3L6H A;  4R2F A;  4P0G A;  3PUX E;  2P2A A;  4HTG A;  3SEY A;  5K2Y A;  1M5C A;  2Y7W A;  4WKM A;  2F7A A;  3OO8 A;  4EXL A;  4RK2 A;  1FTJ A;  1NFT A;  2A5T B;  3T9U A;  2RC7 A;  2KLF A;  3CG3 A;  4P0I A;  1GV8 A;  1B0H A;  3HO7 A;  2RCA A;  5ICQ A;  4H8I A;  4ZEB A;  3FJ7 A;  5I56 B;  2Q2A A;  4GXS B;  1TXF A;  4KYD A;  2XXX A;  5ELV A;  4DXB A;  1LAG E;  2QRY A;  1O64 A;  4IO6 A;  3M8U A;  1B40 A;  3EPE A;  2O1M A;  5TPA A;  2PMS A;  4NED A;  5KZT A;  2QSX A;  2UYE A;  4OQO A;  4DXC A;  5ICT A;  4M1V A;  4NMY A;  1MY4 A;  3UIF A;  3E13 X;  1QKB A;  3H6T A;  5IAI A;  5KCJ B;  3FAT A;  1LAF E;  1URG A;  3CSG A;  1XVY A;  3FD3 A;  2G29 A;  1AL3 A;  3Q26 A;  5H8Q B;  3BFU A;  1SW1 A;  3HV1 A;  3TEL A;  3SES A;  3MVW A;  1B3L A;  2Q8J A;  1JVY A;  3OXN A;  3OD7 A;  4XXU A;  5CMM A;  3TDJ A;  1UTB B;  3GZG A;  4C0R A;  4JSD A;  3Q25 A;  1OLC A;  5CC2 A;  4IY6 A;  1YCJ A;  2Z23 A;  1B4Z A;  2P1S A;  4IO5 A;  3IOU A;  3IB2 A;  5I57 A;  1B4H A;  3MQ9 A;  2H99 A;  4KHZ E;  3C34 A;  2UVH A;  5CI5 A;  3T9H B;  5AA4 A;  4MBP A;  2ZMB A;  1OQH A;  1S9T A;  2G93 A;  1M5E A;  1ZTY A;  5A5X B;  4M4G A;  1JW4 A;  4R75 A;  3USD A;  3PMW A;  4QRZ A;  4QFL A;  2DS9 A;  1R6Z A;  4YB5 A;  1ZLQ A;  4U2R A;  4HCW A;  3MZ1 A;  4DIG A;  1US5 A;  2GFE A;  3OEM A;  3MP1 A;  4H6D A;  3QIM A;  4AQ4 A;  1LB9 A;  4RXL A;  1L5T A;  3IB1 A;  4XKN A;  1SBP A;  3M3L A;  4OER A;  4NE4 A;  1B3E A;  4DE8 A;  4GVO A;  1MXW A;  1UIV A;  1A40 A;  3SEX A;  2I3W A;  4IO3 A;  4QSE A;  2XX8 A;  1AIV A;  4OEN A;  5HM4 B;  3TTL A;  4U1Z A;  3S4U A;  3C33 A;  3L6G A;  1N76 A;  2HZL A;  2I4B A;  1MXV A;  4R6Y A;  2RC9 A;  4EF2 A;  3DP8 A;  3E9X A;  5FTI A;  4ZED A;  1FW0 A;  3OEK A;  1XHY A;  4DLD A;  3U1O A;  1MH4 A;  5I84 A;  2I49 A;  4GQO A;  1LCF A;  4PFT A;  3IR1 A;  5H8Q A;  3FVN A;  4FE8 A;  5TP9 B;  1XOC A;  3MZB A;  3KOT A;  3R6U A;  4BLA A;  3H4Z A;  2NVU B;  5LOM A;  3KFM A;  5FHM A;  3KEI A;  1QJM A;  1FTL A;  3U92 A;  1H76 A;  5EYF A;  4YKI A;  4N6P A;  5H8N A;  5DVF A;  3MPK A;  3DEL B;  2ZYK A;  1ZKB A;  2Y7P A;  4MFI A;  5BWJ A;  1WDN A;  2ONS A;  1POT A;  3TTN A;  3IOV A;  1UTH B;  1JVX A;  5H8F A;  4F3P A;  3FVK A;  4BDL A;  3THI A;  4EDP A;  1DPP A;  3SDF A;  1LB8 A;  3FV1 A;  1QW0 A;  3FAS A;  3TMG A;  3UA8 A;  4G68 A;  3DP6 A;  1LCT A;  3FJM A;  3O97 A;  3OMB A;  1KWH A;  3O6I A;  2XXH A;  1MM6 A;  3ZS6 A;  5I59 B;  2UVI A;  1Y20 A;  2DXY A;  1OLA A;  2OJT A;  4H5G A;  4BDR A;  1EH3 A;  4N07 A;  1MQJ A;  4I62 A;  3MJN A;  1P99 A;  4MLQ A;  1VR5 A;  3UP9 A;  3VLV A;  1YTV A;  3K2D A;  3DP4 A;  2I0C A;  3IO6 A;  1Y4T A;  3DM0 A;  4ESW A;  1D3K A;  2ONR A;  4F1Y A;  5DVJ A;  3WAE A;  3K00 A;  4GF8 A;  4QF9 A;  2B3F A;  4EQ9 A;  5FHO A;  3I6V A;  4LQ2 A;  4JWY A;  1MPD A;  1B46 A;  3FXU A;  4R9G A;  2ALU A;  4GIZ A;  3ILU B;  5TP9 A;  5CBS A;  3T93 B;  2FYI A;  2OK2 A;  3CI8 A;  5CMK A;  1R1N A;  4Q30 B;  1B0L A;  1FQC A;  1BTJ A;  2Z8E A;  5F1Q A;  4TOZ A;  2I48 A;  1RKM A;  3QAX A;  1QUJ A;  2VD3 A;  1DPE A;  4PFU A;  3FXR A;  3PMV A;  3N5L A;  3PV0 E;  2O69 A;  1MXY A;  1FTK A;  4U1O A;  2E1S A;  3G7W A;  4ONY A;  1UTH A;  1UQW A;  4JB7 A;  1FQB A;  3FV2 A;  3B6W A;  2ZNU A;  4JWX A;  4YAH X;  4BDO A;  2Q2C A;  1MXZ A;  1SQY A;  3GBA A;  5I2N B;  4QFN A;  3TUS A;  2VOZ A;  1IZ1 A;  4NF4 B;  3G3J A;  3LUY A;  3PD9 A;  4QHQ A;  5I2K B;  1XT8 A;  4H65 A;  2AIX A;  3CFL A;  4ZEC A;  4LON B;  2DOJ A;  2XXY A;  3VFJ A;  2XXV A;  5IKB A;  5I59 A;  3LSW A;  2Y7I A;  4L17 A;  5JTY B;  3TZA A;  2HAV A;  4I8C A;  3UK4 A;  1WVJ A;  2FNC A;  1B58 A;  3MP6 A;  1Y3N A;  1US4 A;  1NNT A;  1P1N A;  2GRV A;  4DXU A;  3K4U A;  3OSQ A;  4WED A;  4U23 A; 
#chains in the Genus database with same CATH topology
 3FGS A;  3ZKL A;  2HAU A;  4FEB A;  2F97 A;  4EUO A;  1IEJ A;  1A54 A;  1LLS A;  3PUW E;  4PP0 A;  4R72 A;  1FBD A;  2B4M A;  1KZ8 A;  4H5F A;  4IY5 A;  4RK9 A;  4U4S A;  3PD8 A;  4IO2 A;  1FSA A;  2UVG A;  1MY3 A;  4OET A;  4ZEK A;  4G8H A;  4HE2 A;  1URD A;  1PBP A;  3TYH A;  1LFH A;  2Y7K A;  2RCB A;  5CBR A;  4Z0I A;  1JEU A;  2HEU A;  2CZH A;  1BIY A;  4KXP A;  3OEN A;  4KI0 E;  3T96 B;  2YLN A;  3E79 A;  3C4M A;  2E0S A;  2I3V A;  4XKP A;  1AH5 A;  1AMF A;  2F78 A;  3SER A;  4OFL A;  1PB9 A;  1A8F A;  3FJG A;  4X1B A;  4ZEI A;  1A8E A;  4G8M A;  2V4C A;  1P1W A;  1FQF A;  2O7I A;  4R2B A;  5DT6 A;  1IMD A;  3V83 A;  3A3C A;  4BDN A;  4ZZA A;  4F3S A;  1D9Y A;  4LN5 A;  3JV9 A;  3OSR A;  4F18 A;  2WBB A;  1B2H A;  4C1T A;  4HXV A;  3R7X A;  2UYF A;  1RDX A;  3CHG A;  4FIM A;  4MCO A;  4NF6 B;  4R73 A;  4O94 A;  3TCG A;  4R9F A;  4NF8 B;  3C36 A;  1J1N A;  2DWJ A;  4KFQ A;  3S9E A;  3TCH A;  1WOD A;  4PAI A;  4IB2 A;  3P7I A;  2Z8D A;  4JXI A;  3H6V A;  1DTG A;  2Q9T A;  1N7W A;  2D5W A;  4ZE9 A;  3T0J A;  4H46 A;  2Y84 A;  2OBG A;  1M5F A;  3QXM A;  1KA1 A;  1I6Q A;  4DCY A;  1B5H A;  2FA7 A;  2NXO A;  2A5S A;  3HCQ A;  2R6G E;  4O7I A;  1MY0 A;  3B6Q A;  1ELJ A;  1POY 1;  1Y4C A;  2F35 A;  5BUU A;  4G2Z A;  5AA2 A;  1JET A;  3K1M A;  4GXA A;  3S9M C;  4E0X A;  3G3G A;  1B05 A;  3VXB A;  4PBH A;  4K3F A;  5JTY A;  4MLV A;  4DZ1 A;  5K2X A;  4ZE8 A;  4U22 A;  3AXF A;  3KSJ A;  2QMW A;  2I58 A;  4ELQ A;  4I40 A;  1H43 A;  1ZJL A;  5H8H B;  1B3F A;  4YB6 A;  2XXT A;  2Q88 A;  3OO6 A;  2ZXT A;  2H5Y A;  1QGX A;  4GL8 A;  3ZKK A;  4NWC A;  2ZNS A;  3O29 A;  1Y1M A;  1A7L A;  1Q9D A;  1B51 A;  3RLF E;  4TLL B;  4LP2 B;  4OES A;  1N0T A;  2X7P A;  3N6U A;  4LZ8 A;  3KGC A;  1LAH E;  1QVS A;  3KBZ A;  4YKK A;  3CG1 A;  4P1L A;  1MPC A;  1OQG A;  2A5T A;  3CSB A;  3LC8 A;  4F22 A;  3H03 A;  4PAK A;  1FBG A;  1JNF A;  4AB6 A;  4ISU A;  1F9B A;  4JDF A;  4IGR A;  1Z7M E;  3KOS A;  3MPL A;  5JEI A;  1FPL A;  4TLM B;  5JK4 A;  3SET A;  2V3U A;  3HPI A;  3N94 A;  4P1E A;  2YJP A;  5I56 A;  2DVZ A;  5FTH A;  2THI A;  2O7U A;  3KBR A;  3IOT A;  5EYG A;  5IGA A;  3K0V A;  2DE2 A;  5B7D A;  3IB0 A;  3TCF A;  4OVR A;  1HSL A;  3KN3 A;  3T9V A;  2NWJ A;  4QFK A;  2RKM A;  5HPQ A;  3U72 A;  1PC3 A;  2HXW A;  3RTW B;  4DCX A;  1N84 A;  1ZIU A;  2UXA A;  1URS A;  2HPG A;  4NF6 A;  2H9B A;  4ND9 A;  3C32 A;  4FBP A;  1TT1 A;  3S2V A;  3E4R A;  4N81 A;  2AL5 A;  4NF8 A;  4HW8 A;  5KCJ A;  3NOH A;  4GWX A;  4F39 A;  1MDQ A;  1PB7 A;  1D4N A;  2F36 A;  1R9Q A;  1EU8 A;  4G8N A;  2X7Q A;  5T3J A;  2REJ A;  4XKR A;  3VVF A;  2WBD A;  4RA1 A;  4LA9 A;  3T1B A;  3R26 A;  4BDQ A;  1B1X A;  4LAT A;  3B7D A;  1FQD A;  3MBP A;  4POX A;  3G3K A;  1UTB A;  1FQE A;  1IMC A;  3SEW A;  3O6H A;  4LZ5 A;  2GHB A;  1IXH A;  4P11 A;  4KQP A;  1XVX A;  4NN3 A;  5HBC A;  4NF5 B;  3F11 A;  4R6H A;  4F29 A;  1DOT A;  1IMB A;  4MHF A;  2W7Y A;  2I0B A;  4OVP A;  1MH3 A;  4FEC A;  1SDX A;  2NUV A;  2BJI A;  4FED A;  3EHS A;  4PCD A;  1OVB A;  2XX9 A;  2PYY A;  3TKD A;  5KDT B;  3H06 B;  3IK6 B;  3MAM A;  1NUX A;  4O3C A;  2OX3 A;  5A5X A;  1D9V A;  2OWT A;  3EQ1 A;  2O68 A;  4PFW A;  4XEQ A;  1MPB A;  5CMB A;  5F24 A;  4QFP A;  4YKP A;  3W9W A;  4PF8 A;  2ZZX A;  1NL5 A;  3KG2 A;  2UVJ A;  4GOT A;  1N04 A;  3HFU A;  1M5D A;  4ELP A;  2XXI A;  1NUZ A;  4O8M A;  1FBP A;  3TTM A;  4I9D A;  3RNN A;  1DBZ A;  2CMO A;  1SYI A;  1MS7 A;  3PUZ E;  5DVI A;  3B50 A;  3QUJ A;  4OTE A;  4NF0 A;  3FIR A;  1O7T A;  3W9V A;  4YKJ A;  1NH8 A;  3RQT A;  4E0W A;  3FVG A;  3MC2 A;  4RPN A;  3T22 A;  1XS5 A;  3V5A A;  1Q35 A;  3JZJ A;  4RPO A;  1MDP 1;  1FTO A;  3CR9 A;  3MVX A;  2DYX A;  1NV5 A;  4IO4 A;  3D4G A;  2DE4 A;  1MRP A;  2VP1 A;  3MW0 A;  2O1L A;  2PX1 A;  3I3V A;  1CB6 A;  3PUV E;  5L8D A;  1VFE A;  1VSO A;  5I58 B;  1YPN A;  4EXK A;  2Z22 A;  4MF3 A;  1FPE A;  3OO9 A;  3IL1 B;  2ANJ A;  4QSC A;  3KJT A;  3RY3 A;  4HS7 A;  2XXK A;  1ZMG A;  5EHM A;  1MXU A;  2V84 A;  4Q8R A;  2ABH A;  2DVC A;  5EQ7 A;  4LZ7 A;  4OFO A;  4OYV A;  2IEE A;  3SEU A;  2REG A;  1FPD A;  2HZK A;  4OEV A;  3BIH A;  4ELR A;  1MQI A;  4F2Q A;  3UOR A;  1B1H A;  3FZV A;  4U21 A;  1NV1 A;  3ONM A;  3CFX A;  4OEU A;  1LST A;  4H0W A;  4AS4 A;  2R9J A;  4G4P A;  4YB7 A;  2F6P A;  1NNF A;  4KYS A;  3HHF A;  3LBS A;  3T66 A;  1I6A A;  5CM6 A;  5KDT A;  1BP5 A;  3RTF B;  3H6W A;  5TPA B;  3IOW A;  3EKI A;  4WEP A;  2RF1 A;  2B3B A;  1FJ9 A;  1MG1 A;  3EN3 A;  2P3N A;  3HN0 A;  3PPQ A;  3LR1 A;  2F34 A;  3CVG A;  1EYI A;  1NH7 A;  1DTZ A;  4IR8 A;  3MVZ A;  2IA4 A;  4FAJ A;  3QMF A;  3K1N A;  3GLB A;  2XXP A;  2NOO A;  5AA3 A;  3H6U A;  2HQ0 A;  5DYH A;  1SPI A;  2VGQ A;  3K1P A;  4IGT A;  4GD5 A;  4GWY A;  2Z8F A;  1DCU A;  4THI A;  4GLI A;  1H3D A;  4H8J A;  5EYH A;  2I4C A;  4AS5 A;  4U4X A;  3A3U A;  4UA8 A;  3C35 A;  2XD3 A;  3FXQ A;  5AA1 A;  1SW5 A;  2XXU A;  1IXG A;  2GH9 A;  1AWB A;  5A5L A;  3OO7 A;  1PBQ A;  3KSX A;  5LDZ A;  2MKZ A;  2QMX A;  5ESY A;  4P3L A;  4R74 A;  3UN6 A;  3MZ9 A;  4POW A;  1FBC A;  1B7H A;  4YMB A;  1MY2 A;  2PVU A;  5L9O A;  2XWV A;  1BK4 A;  4XIG Q;  4N13 A;  5ITP A;  3SZP A;  3PUY E;  2CZL A;  3SEV A;  3MP8 A;  1RDY A;  4KD5 A;  4MNP A;  5AA4 B;  4HCY A;  4ZS9 A;  3I5O A;  3LSL A;  2I6E A;  3TOD A;  3IJX B;  3UGW A;  1SW2 A;  1T0K A;  3BKI B;  1RYX A;  3VLW A;  3VXC A;  2OCU A;  3RPL A;  1MY1 A;  1ZBM A;  4OVT A;  1B5I A;  1SYH A;  3GXA A;  1SI1 A;  3TTR A;  1NNK A;  1FCK A;  2CZI A;  1B32 A;  1Y9U A;  2HXR A;  2H25 A;  3MWB A;  4FOR A;  1INP A;  1NNP A;  2BJJ X;  1XC1 A;  3EHT A;  3O2A A;  4OVQ A;  5B70 A;  1Y3P A;  5EHS A;  1TFA A;  3PGF A;  4X8R A;  1DSN A;  1B6H A;  3G3I A;  1S7Y A;  2GHA A;  2PCR A;  1B7Z A;  1NI9 A;  2AYS A;  4DDD A;  2OLB A;  3BBR A;  5CRY A;  1IUD A;  3SKP A;  2PT2 A;  2V3T A;  1UIU A;  1GR2 A;  4LUB A;  4MH5 A;  4F1U A;  3W15 C;  1B52 A;  5F7V A;  1S50 A;  4ESX A;  2V93 A;  2VD2 A;  4JBZ A;  1DK4 A;  5I2N A;  4F1V A;  1II5 A;  1IMA A;  1P1U A;  1LBW A;  4UAC A;  3S9L C;  2OWZ A;  1BLF A;  1SD3 A;  2PFZ A;  3TTK A;  4OZ9 A;  2DWA A;  4EQ7 A;  1B5J A;  4NF4 A;  5I2K A;  1HSJ A;  2GQ1 A;  2Y7R A;  1FBE A;  2ZYO A;  4H1X A;  1EZO A;  4N4U A;  3IOR A;  4GX4 A;  4O3B A;  4QFO A;  4KYE A;  1NMU A;  1LBV A;  3DLN A;  2VHA A;  3IX1 A;  2HCA A;  1FBH A;  1Y1Z A;  4F19 A;  2ZNT A;  4Z7E A;  4GL0 A;  2O84 X;  5H8N B;  1FPB A;  4LQ5 A;  3KC1 A;  3TQW A;  1GGG A;  4GWZ A;  3QK6 A;  1M5B A;  1N3W A;  4NAP A;  1MQH A;  3VVD A;  4PQJ A;  2Y5L A;  2Q89 A;  1LBZ A;  5H8F B;  1CE2 A;  1OVT A;  1JEV A;  4ECF A;  5DW8 A;  3PU5 A;  4Q0C A;  5TU0 A;  4Q5T A;  2VPN A;  1N7X A;  3C9H A;  4F3G A;  2F5X A;  2R71 A;  4AB5 A;  1P1Q A;  3PPR A;  1G0I A;  3BFT A;  2H98 A;  2VT5 A;  3B6T A;  3OEL A;  2KR0 A;  4GWO A;  2B65 A;  3U8Q A;  4G68 B;  2Y5K A;  1NKX A;  2F8D A;  3VV5 A;  2DSF A;  2Q8M A;  2PFY A;  1QUL A;  1Y3Q A;  1EYK A;  5M2V A;  3QSL A;  2ZYM A;  4NGU A;  1VDW A;  5L9S A;  4PFY A;  3QUF A;  5H8S A;  1O63 A;  3H7M A;  4O3A A;  4H67 A;  4G68 C;  1N3X A;  2QFL A;  3ILT B;  1LFI A;  1MXX A;  4FJP A;  2XXR A;  1TFD A;  4ELO A;  1USY H;  1SI0 A;  1ZU0 A;  4OVJ A;  3LV0 A;  1A55 A;  3PMX A;  2O6A A;  4RY1 A;  2OWS A;  4GWW A;  3O9P A;  3LSX A;  4ZDM A;  4DI3 D;  3QYT A;  5ITO A;  2P3V A;  3N26 A;  4X9T A;  2XWK A;  4GWU A;  3OOA A;  1MQG A;  3LSF B;  1JQF A;  4TQU Q;  2YPN A;  3JYR A;  4X1D A;  5L9M A;  2ZZW A;  4NWD A;  4HE1 A;  4GRK A;  1IXI A;  4ZEF A;  1I69 A;  1Q1K A;  1QUI A;  2QJE A;  4PFR A;  3EHU A;  3TFL A;  1IXC A;  4XTC Q;  2QS2 A;  4NX1 A;  3CFZ A;  3Q29 A;  3TAJ A;  1PDA A;  4YIC A;  4ZZE A;  3A09 A;  3Q28 A;  2ZYN A;  3VLU A;  3VE1 B;  4XKQ A;  2F7C A;  1NV0 A;  1MQD A;  1YAE A;  5H8H A;  2QL3 A;  5DTB A;  4OA4 A;  1QKA A;  3CRB A;  2RC8 A;  3K6V A;  1R9L A;  3WAF A;  3FUZ A;  4EF1 A;  1MM7 A;  4YZZ A;  2DXR A;  3Q27 A;  2QS1 A;  4MMP A;  1ATG A;  5AA2 D;  4I3E A;  2LAO A;  5FHN A;  2X26 A;  3D4C A;  3E3K A;  1YYZ A;  4RNS A;  1LBB A;  3RT6 B;  1FTM A;  3RT8 A;  4FAT A;  5CMC A;  3HST A;  3KZG A;  3M3F A;  3PPN A;  3MUQ A;  4H45 A;  1TWY A;  3MVY A;  4YU0 A;  2P0S A;  1FQA A;  1B7U A;  5J16 A;  1SW4 A;  4RYA A;  2PBW A;  1LAX A;  2DWI A;  4IO7 A;  2WKY A;  3VVE A;  1B3G A;  4JVC A;  1KA0 A;  5I5P A;  4OWD A;  4R6K A;  1JW1 A;  4LVQ A;  1PB8 A;  1NV2 A;  1JP4 A;  4OFJ A;  4MNI A;  4RJZ A;  1EZP A;  2XA5 A;  2QVV A;  3T9X B;  2D3I A;  3K6U A;  5DEX B;  4NTL A;  3IFA A;  1B3H A;  3H3G A;  3RN8 A;  4PE5 B;  1SVX B;  2F7B A;  5IZZ A;  2WX9 A;  1B9J A;  1DMB A;  5ISU A;  3O6G A;  2XX7 A;  4OVS A;  3V89 B;  1LGB C;  1LFG A;  3MYU A;  2M8C A;  4P9K A;  4PFB A;  2XHD A;  4PDD A;  3PPO A;  3S9N C;  3K6W A;  4MEV A;  3FBP A;  1FPF A;  2VPO A;  4PBQ A;  2V25 A;  1PEB A;  4PE3 A;  3ODB A;  1USY E;  3EF7 A;  4KPT A;  3U93 A;  4MX6 A;  2CEX A;  3KN8 A;  5IZ3 B;  3VDF A;  2DQV A;  3K02 A;  3KJ7 A;  2DWH A;  1YZ0 A;  4KCC A;  4YMA A;  1FJ6 A;  1H45 A;  1RYO A;  2RIN A;  3GBB A;  2WYK A;  2O51 A;  2V3Q A;  1NV7 A;  3G3H A;  3G3F A;  3TQL A;  3ECR A;  1GVC A;  3CIJ A;  1AOV A;  1GTK A;  2QVU A;  2H4I A;  1VE4 A;  3K01 A;  3RUM A;  3TPA A;  4PFI A;  4NF5 A;  1A99 A;  4F31 B;  3E78 A;  1CNQ A;  1JW5 A;  3IJO B;  1P1O A;  1BKA A;  3RGY A;  3C31 A;  4N8G A;  3O28 A;  3K6X A;  1HSE A;  1QUK A;  1IIT A;  1OMP A;  4F2O A;  4QSD A;  4N6D A;  4OMB A;  1IQ7 A;  3KN7 A;  2DP8 A;  1FPG A;  2XWO A;  4KR5 A;  4OXV A;  4I1D A;  2AL4 A;  1LBC A;  2HFB A;  3FVO A;  4X48 A;  3IAZ A;  5J1D A;  2QS3 A;  1ANF A;  4JWO A;  4PF6 A;  2PT1 A;  1FBF A;  4GFR A;  1OIB A;  2DE3 A;  4G77 A;  2OZZ A;  1Z7N E;  4KCD A;  4BDM A;  4PET A;  4WXJ A;  3IO4 A;  3MST A;  4P56 A;  3M3K A;  1I6B A;  3U94 A;  1VFD A;  2XXW A;  2F6G A;  4EQB A;  3ROJ A;  4JSO A;  3HHG A;  4OHN A;  3N6T A;  1EYJ A;  1H44 A;  1IIW A;  5AA2 B;  2XD2 A;  3RPW A;  5AE4 A;  1IMF A;  5DEX A;  2ZZV A;  4F3B A;  2ONK E;  2QS4 A;  3BIG A;  2D21 A;  4MJO A;  1NUY A;  5I57 B;  3O66 A;  4C1U A;  1EZ9 A;  3PPP A;  2XXQ A;  3TEP A;  4PGP A;  5I3S A;  2ESN A;  5I58 A;  3ZSF A;  3V8X B;  2QPQ A;  3L6H A;  4R2F A;  4MAG A;  4P0G A;  3FXB A;  3PUX E;  2P2A A;  4HTG A;  3SEY A;  5K2Y A;  5IZ3 A;  1M5C A;  3ISP A;  2Y7W A;  4WKM A;  2F7A A;  3OO8 A;  4EXL A;  3D1R A;  4RK2 A;  1FTJ A;  1NFT A;  2A5T B;  3T9U A;  2RC7 A;  4I3Y A;  2KLF A;  3CG3 A;  4P0I A;  2KQZ A;  1FPJ A;  1GV8 A;  1B0H A;  3HO7 A;  2RCA A;  5ICQ A;  4H8I A;  4ZEB A;  3B8B A;  3FJ7 A;  2B4L A;  5I56 B;  2Q2A A;  4GXS B;  1TXF A;  4KYD A;  2XXX A;  5ELV A;  4DXB A;  1LAG E;  2QRY A;  1O64 A;  4IO6 A;  3M8U A;  1B40 A;  3EPE A;  2O1M A;  5TPA A;  2PMS A;  4NED A;  5KZT A;  2QSX A;  2UYE A;  4OQO A;  4DXC A;  2XWI A;  5ICT A;  4M1V A;  4NMY A;  1MY4 A;  3UIF A;  3E13 X;  1QKB A;  3H6T A;  5IAI A;  5KCJ B;  4HE0 A;  3FAT A;  4XF5 A;  1LAF E;  1URG A;  3CSG A;  1XVY A;  3FD3 A;  2G29 A;  1AL3 A;  3Q26 A;  5H8Q B;  3BFU A;  1K9Z A;  1SW1 A;  3HV1 A;  3TEL A;  3SES A;  3MVW A;  1B3L A;  2Q8J A;  2FIX A;  1LBY A;  1JVY A;  3OXN A;  3OD7 A;  4XXU A;  5CMM A;  3TDJ A;  2L5V A;  1UTB B;  4NG7 A;  3GZG A;  4C0R A;  4JSD A;  3Q25 A;  1OLC A;  5CC2 A;  2QVR A;  4IY6 A;  1YCJ A;  2Z23 A;  2HHM A;  1B4Z A;  1NV4 A;  2P1S A;  1NUW A;  4IO5 A;  4DI4 B;  3IOU A;  3IB2 A;  5I57 A;  1B4H A;  3MQ9 A;  4PGN A;  2H99 A;  4KHZ E;  3C34 A;  2UVH A;  5CI5 A;  3T9H B;  5AA4 A;  4MBP A;  2ZMB A;  1OQH A;  1S9T A;  2G93 A;  5ET8 A;  4G61 A;  1M5E A;  1ZTY A;  5A5X B;  4GX6 A;  4M4G A;  1JW4 A;  2FBP A;  4R75 A;  3USD A;  3PMW A;  4QRZ A;  4QFL A;  1XI6 A;  2DS9 A;  1R6Z A;  4YB5 A;  1ZLQ A;  4U2R A;  4HCW A;  3MZ1 A;  4DIG A;  1US5 A;  4PC9 A;  2GFE A;  3OEM A;  3MP1 A;  4H6D A;  4QXD A;  4N6K A;  2DDK A;  3QIM A;  4AQ4 A;  1LB9 A;  4RXL A;  5ET6 A;  1L5T A;  3IB1 A;  4XKN A;  4GX3 A;  1SBP A;  3M3L A;  5ET5 A;  4OER A;  4NE4 A;  1B3E A;  4DE8 A;  4GVO A;  1MXW A;  4N17 A;  1UIV A;  1A40 A;  3SEX A;  2I3W A;  4IO3 A;  4QSE A;  2XX8 A;  1AIV A;  4OEN A;  5HM4 B;  3TTL A;  4U1Z A;  3S4U A;  3C33 A;  3L6G A;  1N76 A;  2HZL A;  2JJK A;  4NHB A;  2I4B A;  2CEY A;  1MXV A;  4R6Y A;  2RC9 A;  4EF2 A;  4XFE A;  3DP8 A;  3E9X A;  5ET7 A;  5FTI A;  4ZED A;  1FW0 A;  3OEK A;  1XHY A;  4DLD A;  3U1O A;  1MH4 A;  2Q74 A;  5I84 A;  2I49 A;  5LTC A;  4PFT A;  1LCF A;  4GQO A;  3IR1 A;  5EQ8 A;  5H8Q A;  3FVN A;  2F3D A;  4P8B A;  4FE8 A;  5TP9 B;  4PTK A;  1XOC A;  3MZB A;  2FIE A;  3KOT A;  3PTY A;  3R6U A;  2WYP A;  4BLA A;  3H4Z A;  1LBX A;  2NVU B;  5LOM A;  3KFM A;  5FHM A;  1RDZ A;  1QJM A;  3KEI A;  1FTL A;  3U92 A;  1H76 A;  5EYF A;  4YKI A;  4N6P A;  5H8N A;  5DVF A;  3MPK A;  3DEL B;  2ZYK A;  1ZKB A;  2Y7P A;  4MFI A;  5BWJ A;  1WDN A;  2ONS A;  1POT A;  3TTN A;  3IOV A;  1UTH B;  5EQ9 A;  1JVX A;  5H8F A;  4F3P A;  3FVK A;  4BDL A;  3THI A;  4QBA A;  4P47 A;  1DPP A;  4EDP A;  3SDF A;  1LB8 A;  3FV1 A;  1QW0 A;  3FAS A;  5I7I A;  3TMG A;  3UA8 A;  4G68 A;  4GWS A;  4JVD A;  1FTA A;  3DP6 A;  3LUZ A;  1LCT A;  3FJM A;  3O97 A;  3OMB A;  1KWH A;  3GYY A;  3O6I A;  2XXH A;  1MM6 A;  1FRP A;  2FVZ A;  3ZS6 A;  4N91 A;  5IZ1 A;  5I59 B;  2UVI A;  1Y20 A;  2DXY A;  1OLA A;  2OJT A;  4NQ8 A;  4H5G A;  4BDR A;  1IME A;  1EH3 A;  1D9Q A;  4N07 A;  1MQJ A;  4I62 A;  3MJN A;  1P99 A;  4MLQ A;  1VR5 A;  3UP9 A;  3VLV A;  5FBP A;  1FPK A;  1YTV A;  3K2D A;  3DP4 A;  1YXI A;  4GBV A;  2I0C A;  3IO6 A;  1Y4T A;  2CZK A;  3DM0 A;  4ESW A;  1D3K A;  4X04 A;  2ONR A;  4F1Y A;  4MNC A;  5DVJ A;  3WAE A;  3K00 A;  4GF8 A;  4QF9 A;  2B3F A;  4EQ9 A;  5FHO A;  3I6V A;  4LQ2 A;  4JWY A;  4PDH A;  1MPD A;  3A29 A;  2F3B A;  1B46 A;  3FXU A;  4R9G A;  2ALU A;  4GIZ A;  3ILU B;  3RPL B;  3RYD A;  5TP9 A;  5CBS A;  3T93 B;  4O7M A;  2FYI A;  2OK2 A;  3CI8 A;  3U65 A;  5CMK A;  1R1N A;  4Q30 B;  2WEF A;  1B0L A;  1FQC A;  1BTJ A;  3KC0 A;  2Z8E A;  5F1Q A;  4TOZ A;  2I48 A;  4GBW A;  1RKM A;  3QAX A;  1QUJ A;  5EQA A;  2VD3 A;  1DPE A;  4N15 A;  1K9Y A;  4PFU A;  3FXR A;  3PMV A;  3N5L A;  3PV0 E;  2O69 A;  1MXY A;  1FTK A;  4U1O A;  2E1S A;  3G7W A;  4ONY A;  1UTH A;  1UQW A;  4JB7 A;  1FQB A;  3FV2 A;  4OAN A;  2FHY A;  3B6W A;  4MIJ A;  1NV3 A;  2ZNU A;  4JWX A;  4YAH X;  1NV6 A;  4BDO A;  4UAB A;  2Q2C A;  1MXZ A;  1SQY A;  3GBA A;  5I2N B;  1LEV A;  4QFN A;  3TUS A;  4JVI A;  2VOZ A;  1IZ1 A;  4NF4 B;  1FPI A;  3G3J A;  3LUY A;  3PD9 A;  4QHQ A;  2R8T A;  5I2K B;  1XT8 A;  4H65 A;  2AIX A;  3CFL A;  4ZEC A;  4LON B;  2DOJ A;  2XXY A;  3VFJ A;  2XXV A;  5IKB A;  5I59 A;  3LSW A;  2Y7I A;  4PAF A;  4L17 A;  5JTY B;  3TZA A;  2HAV A;  4I8C A;  3UK4 A;  5IM2 A;  3IFC A;  4N8Y A;  1WVJ A;  2FNC A;  1B58 A;  1G0H A;  3MP6 A;  1Y3N A;  1US4 A;  1NNT A;  1P1N A;  2GRV A;  4DXU A;  3K4U A;  3OSQ A;  4WED A;  4U23 A; 
#chains in the Genus database with same CATH homology
 3FGS A;  3ZKL A;  2HAU A;  4FEB A;  2F97 A;  4EUO A;  1IEJ A;  1A54 A;  1LLS A;  3PUW E;  4PP0 A;  4R72 A;  4H5F A;  4IY5 A;  4RK9 A;  4U4S A;  3PD8 A;  4IO2 A;  2UVG A;  1MY3 A;  4OET A;  4ZEK A;  4G8H A;  1URD A;  1PBP A;  3TYH A;  1LFH A;  2Y7K A;  2RCB A;  5CBR A;  4Z0I A;  1JEU A;  2HEU A;  1BIY A;  3OEN A;  4KI0 E;  3T96 B;  2YLN A;  3C4M A;  2E0S A;  2I3V A;  4XKP A;  1AH5 A;  1AMF A;  2F78 A;  3SER A;  4OFL A;  1PB9 A;  1A8F A;  3FJG A;  4X1B A;  4ZEI A;  1A8E A;  4G8M A;  1P1W A;  1FQF A;  2O7I A;  4R2B A;  5DT6 A;  3V83 A;  3A3C A;  4BDN A;  4ZZA A;  4F3S A;  1D9Y A;  3JV9 A;  3OSR A;  4F18 A;  1B2H A;  4C1T A;  3R7X A;  2UYF A;  4FIM A;  4NF6 B;  4R73 A;  3TCG A;  4R9F A;  4NF8 B;  3C36 A;  1J1N A;  2DWJ A;  4KFQ A;  3S9E A;  3TCH A;  1WOD A;  4IB2 A;  3P7I A;  2Z8D A;  4JXI A;  3H6V A;  1DTG A;  2Q9T A;  1N7W A;  2D5W A;  4ZE9 A;  2Y84 A;  2OBG A;  1M5F A;  3QXM A;  1I6Q A;  4DCY A;  1B5H A;  2FA7 A;  2NXO A;  2A5S A;  3HCQ A;  2R6G E;  1MY0 A;  3B6Q A;  1ELJ A;  1POY 1;  1Y4C A;  2F35 A;  5BUU A;  4G2Z A;  5AA2 A;  1JET A;  3K1M A;  4GXA A;  3S9M C;  4E0X A;  3G3G A;  1B05 A;  3VXB A;  4K3F A;  5JTY A;  4MLV A;  4DZ1 A;  5K2X A;  4ZE8 A;  4U22 A;  3AXF A;  3KSJ A;  2QMW A;  2I58 A;  4ELQ A;  1H43 A;  1ZJL A;  5H8H B;  1B3F A;  4YB6 A;  2XXT A;  2Q88 A;  3OO6 A;  2ZXT A;  2H5Y A;  4GL8 A;  3ZKK A;  4NWC A;  2ZNS A;  3O29 A;  1Y1M A;  1A7L A;  1B51 A;  3RLF E;  4TLL B;  4LP2 B;  4OES A;  1N0T A;  2X7P A;  3N6U A;  4LZ8 A;  3KGC A;  1LAH E;  1QVS A;  4YKK A;  3CG1 A;  1MPC A;  1OQG A;  2A5T A;  3CSB A;  3LC8 A;  4F22 A;  3H03 A;  1JNF A;  4AB6 A;  4ISU A;  1F9B A;  4JDF A;  4IGR A;  1Z7M E;  3KOS A;  3MPL A;  5JEI A;  4TLM B;  5JK4 A;  3SET A;  2V3U A;  3HPI A;  3N94 A;  2YJP A;  5I56 A;  2DVZ A;  5FTH A;  2THI A;  2O7U A;  3KBR A;  3IOT A;  3K0V A;  2DE2 A;  5B7D A;  3IB0 A;  3TCF A;  1HSL A;  3KN3 A;  3T9V A;  2NWJ A;  4QFK A;  2RKM A;  5HPQ A;  3U72 A;  1PC3 A;  2HXW A;  3RTW B;  4DCX A;  1N84 A;  1ZIU A;  2UXA A;  1URS A;  4NF6 A;  2H9B A;  4ND9 A;  3C32 A;  1TT1 A;  3S2V A;  3E4R A;  4NF8 A;  2AL5 A;  4HW8 A;  5KCJ A;  4F39 A;  1MDQ A;  1PB7 A;  1D4N A;  2F36 A;  1R9Q A;  1EU8 A;  4G8N A;  2X7Q A;  2REJ A;  4XKR A;  3VVF A;  4RA1 A;  4LA9 A;  3R26 A;  4BDQ A;  1B1X A;  4LAT A;  3B7D A;  1FQD A;  3MBP A;  4POX A;  3G3K A;  1UTB A;  1FQE A;  3SEW A;  3O6H A;  4LZ5 A;  2GHB A;  1IXH A;  4P11 A;  4KQP A;  1XVX A;  5HBC A;  4NF5 B;  3F11 A;  4R6H A;  4F29 A;  1DOT A;  2W7Y A;  2I0B A;  1MH3 A;  4FEC A;  1SDX A;  2NUV A;  4FED A;  3EHS A;  1OVB A;  2XX9 A;  2PYY A;  3TKD A;  5KDT B;  3H06 B;  3IK6 B;  3MAM A;  4O3C A;  5A5X A;  1D9V A;  2OWT A;  3EQ1 A;  2O68 A;  4PFW A;  1MPB A;  5CMB A;  4QFP A;  4YKP A;  3W9W A;  1NL5 A;  3KG2 A;  2UVJ A;  4GOT A;  1N04 A;  1M5D A;  4ELP A;  2XXI A;  3TTM A;  4I9D A;  3RNN A;  2CMO A;  1SYI A;  1MS7 A;  3PUZ E;  5DVI A;  3QUJ A;  4OTE A;  3FIR A;  1O7T A;  3W9V A;  4YKJ A;  1NH8 A;  3RQT A;  4E0W A;  3FVG A;  3MC2 A;  4RPN A;  3T22 A;  1XS5 A;  3V5A A;  1Q35 A;  3JZJ A;  4RPO A;  1MDP 1;  1FTO A;  3CR9 A;  3MVX A;  2DYX A;  4IO4 A;  3D4G A;  2DE4 A;  1MRP A;  2VP1 A;  3MW0 A;  2O1L A;  2PX1 A;  3I3V A;  1CB6 A;  3PUV E;  5L8D A;  1VFE A;  1VSO A;  5I58 B;  1YPN A;  4EXK A;  2Z22 A;  4MF3 A;  3OO9 A;  3IL1 B;  2ANJ A;  4QSC A;  3KJT A;  3RY3 A;  4HS7 A;  1ZMG A;  5EHM A;  1MXU A;  2V84 A;  4Q8R A;  2ABH A;  2DVC A;  4LZ7 A;  4OFO A;  4OYV A;  2IEE A;  3SEU A;  2REG A;  2HZK A;  4OEV A;  4ELR A;  1MQI A;  4F2Q A;  3UOR A;  1B1H A;  3FZV A;  4U21 A;  3ONM A;  3CFX A;  4OEU A;  1LST A;  4H0W A;  2R9J A;  4G4P A;  4YB7 A;  2F6P A;  1NNF A;  4KYS A;  3HHF A;  3LBS A;  3T66 A;  1I6A A;  5CM6 A;  5KDT A;  1BP5 A;  3RTF B;  3H6W A;  5TPA B;  3IOW A;  4WEP A;  2RF1 A;  2B3B A;  1MG1 A;  3EN3 A;  3HN0 A;  3PPQ A;  3LR1 A;  2F34 A;  3CVG A;  1NH7 A;  1DTZ A;  3MVZ A;  2IA4 A;  4FAJ A;  3K1N A;  3GLB A;  2XXP A;  2NOO A;  5AA3 A;  3H6U A;  2HQ0 A;  5DYH A;  2VGQ A;  3K1P A;  4IGT A;  4GD5 A;  2Z8F A;  4THI A;  4GLI A;  1H3D A;  4H8J A;  2I4C A;  4U4X A;  3A3U A;  4UA8 A;  3C35 A;  2XD3 A;  3FXQ A;  5AA1 A;  1SW5 A;  2XXU A;  1IXG A;  2GH9 A;  3OO7 A;  1PBQ A;  3KSX A;  2QMX A;  4R74 A;  3UN6 A;  3MZ9 A;  4POW A;  1B7H A;  4YMB A;  1MY2 A;  2PVU A;  5L9O A;  4XIG Q;  4N13 A;  5ITP A;  3PUY E;  2CZL A;  3SEV A;  3MP8 A;  4KD5 A;  5AA4 B;  4HCY A;  4ZS9 A;  3I5O A;  3LSL A;  2I6E A;  3TOD A;  3IJX B;  3UGW A;  1SW2 A;  1T0K A;  3BKI B;  1RYX A;  3VLW A;  3VXC A;  2OCU A;  1MY1 A;  1ZBM A;  1B5I A;  1SYH A;  3GXA A;  1SI1 A;  3TTR A;  1NNK A;  1FCK A;  1B32 A;  1Y9U A;  2H25 A;  3MWB A;  4FOR A;  1NNP A;  2BJJ X;  1XC1 A;  3EHT A;  3O2A A;  5B70 A;  1Y3P A;  5EHS A;  1TFA A;  3PGF A;  1DSN A;  1B6H A;  3G3I A;  1S7Y A;  2GHA A;  1B7Z A;  2AYS A;  4DDD A;  2OLB A;  3BBR A;  5CRY A;  1IUD A;  3SKP A;  2PT2 A;  2V3T A;  1UIU A;  1GR2 A;  4LUB A;  4MH5 A;  4F1U A;  3W15 C;  1B52 A;  5F7V A;  1S50 A;  4ESX A;  2V93 A;  2VD2 A;  4JBZ A;  5I2N A;  4F1V A;  1II5 A;  1P1U A;  4UAC A;  3S9L C;  1BLF A;  1SD3 A;  3TTK A;  4OZ9 A;  2DWA A;  4EQ7 A;  1B5J A;  4NF4 A;  5I2K A;  1HSJ A;  2Y7R A;  2ZYO A;  4H1X A;  1EZO A;  3IOR A;  4O3B A;  4QFO A;  4KYE A;  1NMU A;  3DLN A;  2VHA A;  3IX1 A;  2HCA A;  1Y1Z A;  4F19 A;  2ZNT A;  4Z7E A;  4GL0 A;  2O84 X;  5H8N B;  4LQ5 A;  3TQW A;  1GGG A;  3QK6 A;  1M5B A;  1N3W A;  1MQH A;  3VVD A;  4PQJ A;  2Q89 A;  5H8F B;  1CE2 A;  1OVT A;  1JEV A;  4ECF A;  3PU5 A;  4Q0C A;  5TU0 A;  4Q5T A;  1N7X A;  3C9H A;  4F3G A;  2F5X A;  2R71 A;  4AB5 A;  1P1Q A;  3PPR A;  3BFT A;  2H98 A;  3B6T A;  3OEL A;  4GWO A;  2B65 A;  3U8Q A;  4G68 B;  1NKX A;  2F8D A;  3VV5 A;  2DSF A;  1QUL A;  1Y3Q A;  5M2V A;  3QSL A;  2ZYM A;  5L9S A;  4PFY A;  3QUF A;  5H8S A;  1O63 A;  3H7M A;  4O3A A;  4H67 A;  4G68 C;  1N3X A;  3ILT B;  1LFI A;  1MXX A;  4FJP A;  2XXR A;  1TFD A;  4ELO A;  1USY H;  1SI0 A;  1ZU0 A;  4OVJ A;  1A55 A;  3PMX A;  2O6A A;  4RY1 A;  2OWS A;  3O9P A;  3LSX A;  4ZDM A;  3QYT A;  5ITO A;  3N26 A;  4X9T A;  3OOA A;  1MQG A;  3LSF B;  1JQF A;  4TQU Q;  2YPN A;  3JYR A;  4X1D A;  5L9M A;  4NWD A;  4GRK A;  1IXI A;  4ZEF A;  1I69 A;  1Q1K A;  1QUI A;  2QJE A;  3EHU A;  3TFL A;  1IXC A;  4XTC Q;  2QS2 A;  3CFZ A;  3Q29 A;  3TAJ A;  1PDA A;  4YIC A;  4ZZE A;  3A09 A;  3Q28 A;  2ZYN A;  3VLU A;  3VE1 B;  4XKQ A;  2F7C A;  1MQD A;  1YAE A;  5H8H A;  2QL3 A;  5DTB A;  1QKA A;  3CRB A;  2RC8 A;  3K6V A;  1R9L A;  3WAF A;  3FUZ A;  4EF1 A;  1MM7 A;  4YZZ A;  2DXR A;  3Q27 A;  2QS1 A;  1ATG A;  5AA2 D;  2LAO A;  5FHN A;  2X26 A;  3D4C A;  3E3K A;  4RNS A;  1LBB A;  3RT6 B;  1FTM A;  3RT8 A;  4FAT A;  5CMC A;  3HST A;  3KZG A;  3M3F A;  3PPN A;  3MUQ A;  1TWY A;  3MVY A;  4YU0 A;  2P0S A;  1FQA A;  1B7U A;  1SW4 A;  4RYA A;  2PBW A;  1LAX A;  2DWI A;  4IO7 A;  2WKY A;  3VVE A;  1B3G A;  4OWD A;  4R6K A;  1JW1 A;  4LVQ A;  1PB8 A;  4OFJ A;  4RJZ A;  1EZP A;  3T9X B;  2D3I A;  3K6U A;  5DEX B;  4NTL A;  1B3H A;  3H3G A;  3RN8 A;  4PE5 B;  1SVX B;  2F7B A;  1B9J A;  1DMB A;  5ISU A;  3O6G A;  2XX7 A;  3V89 B;  1LGB C;  1LFG A;  2M8C A;  2XHD A;  3PPO A;  3S9N C;  3K6W A;  2V25 A;  1PEB A;  3ODB A;  1USY E;  3EF7 A;  4KPT A;  3U93 A;  3KN8 A;  3VDF A;  2DQV A;  3K02 A;  3KJ7 A;  2DWH A;  4KCC A;  4YMA A;  1H45 A;  1RYO A;  2RIN A;  3GBB A;  2O51 A;  2V3Q A;  3G3H A;  3G3F A;  3TQL A;  3ECR A;  1GVC A;  3CIJ A;  1AOV A;  1GTK A;  2H4I A;  1VE4 A;  3K01 A;  3RUM A;  3TPA A;  4NF5 A;  1A99 A;  4F31 B;  1JW5 A;  3IJO B;  1P1O A;  1BKA A;  3RGY A;  3C31 A;  3O28 A;  3K6X A;  1HSE A;  1QUK A;  1IIT A;  1OMP A;  4F2O A;  4QSD A;  4OMB A;  1IQ7 A;  3KN7 A;  2DP8 A;  4KR5 A;  4OXV A;  4I1D A;  2AL4 A;  1LBC A;  2HFB A;  3FVO A;  4X48 A;  3IAZ A;  5J1D A;  2QS3 A;  1ANF A;  4JWO A;  2PT1 A;  4GFR A;  1OIB A;  2DE3 A;  4G77 A;  2OZZ A;  1Z7N E;  4KCD A;  4BDM A;  4PET A;  4WXJ A;  3IO4 A;  3M3K A;  3U94 A;  1I6B A;  1VFD A;  2XXW A;  2F6G A;  4EQB A;  4JSO A;  3HHG A;  4OHN A;  3N6T A;  1H44 A;  1IIW A;  5AA2 B;  2XD2 A;  3RPW A;  5AE4 A;  5DEX A;  4F3B A;  2ONK E;  2QS4 A;  2D21 A;  5I57 B;  3O66 A;  4C1U A;  1EZ9 A;  3PPP A;  2XXQ A;  3TEP A;  2ESN A;  5I58 A;  3ZSF A;  3V8X B;  2QPQ A;  3L6H A;  4R2F A;  4P0G A;  3PUX E;  2P2A A;  4HTG A;  3SEY A;  5K2Y A;  1M5C A;  2Y7W A;  4WKM A;  2F7A A;  3OO8 A;  4EXL A;  4RK2 A;  1FTJ A;  1NFT A;  2A5T B;  3T9U A;  2RC7 A;  2KLF A;  3CG3 A;  4P0I A;  1GV8 A;  1B0H A;  3HO7 A;  2RCA A;  5ICQ A;  4H8I A;  4ZEB A;  3FJ7 A;  5I56 B;  2Q2A A;  4GXS B;  1TXF A;  4KYD A;  2XXX A;  5ELV A;  4DXB A;  1LAG E;  2QRY A;  1O64 A;  4IO6 A;  3M8U A;  1B40 A;  3EPE A;  2O1M A;  5TPA A;  2PMS A;  4NED A;  5KZT A;  2QSX A;  2UYE A;  4OQO A;  4DXC A;  5ICT A;  4M1V A;  4NMY A;  1MY4 A;  3UIF A;  3E13 X;  1QKB A;  3H6T A;  5IAI A;  5KCJ B;  3FAT A;  1LAF E;  1URG A;  3CSG A;  1XVY A;  3FD3 A;  2G29 A;  1AL3 A;  3Q26 A;  5H8Q B;  3BFU A;  1SW1 A;  3HV1 A;  3TEL A;  3SES A;  3MVW A;  1B3L A;  2Q8J A;  1JVY A;  3OXN A;  3OD7 A;  4XXU A;  5CMM A;  3TDJ A;  1UTB B;  3GZG A;  4C0R A;  4JSD A;  3Q25 A;  1OLC A;  5CC2 A;  4IY6 A;  1YCJ A;  2Z23 A;  1B4Z A;  2P1S A;  4IO5 A;  3IOU A;  3IB2 A;  5I57 A;  1B4H A;  3MQ9 A;  2H99 A;  4KHZ E;  3C34 A;  2UVH A;  5CI5 A;  3T9H B;  5AA4 A;  4MBP A;  2ZMB A;  1OQH A;  1S9T A;  2G93 A;  1M5E A;  1ZTY A;  5A5X B;  4M4G A;  1JW4 A;  4R75 A;  3USD A;  3PMW A;  4QRZ A;  4QFL A;  2DS9 A;  1R6Z A;  4YB5 A;  1ZLQ A;  4U2R A;  4HCW A;  3MZ1 A;  4DIG A;  1US5 A;  2GFE A;  3OEM A;  3MP1 A;  4H6D A;  3QIM A;  4AQ4 A;  1LB9 A;  4RXL A;  1L5T A;  3IB1 A;  4XKN A;  1SBP A;  3M3L A;  4OER A;  4NE4 A;  1B3E A;  4DE8 A;  4GVO A;  1MXW A;  1UIV A;  1A40 A;  3SEX A;  2I3W A;  4IO3 A;  4QSE A;  2XX8 A;  1AIV A;  4OEN A;  5HM4 B;  3TTL A;  4U1Z A;  3S4U A;  3C33 A;  3L6G A;  1N76 A;  2HZL A;  2I4B A;  1MXV A;  4R6Y A;  2RC9 A;  4EF2 A;  3DP8 A;  3E9X A;  5FTI A;  4ZED A;  1FW0 A;  3OEK A;  1XHY A;  4DLD A;  3U1O A;  1MH4 A;  5I84 A;  2I49 A;  4GQO A;  1LCF A;  4PFT A;  3IR1 A;  5H8Q A;  3FVN A;  4FE8 A;  5TP9 B;  1XOC A;  3MZB A;  3KOT A;  3R6U A;  4BLA A;  3H4Z A;  2NVU B;  5LOM A;  3KFM A;  5FHM A;  3KEI A;  1QJM A;  1FTL A;  3U92 A;  1H76 A;  5EYF A;  4YKI A;  4N6P A;  5H8N A;  5DVF A;  3MPK A;  3DEL B;  2ZYK A;  1ZKB A;  2Y7P A;  4MFI A;  5BWJ A;  1WDN A;  2ONS A;  1POT A;  3TTN A;  3IOV A;  1UTH B;  1JVX A;  5H8F A;  4F3P A;  3FVK A;  4BDL A;  3THI A;  4EDP A;  1DPP A;  3SDF A;  1LB8 A;  3FV1 A;  1QW0 A;  3FAS A;  3TMG A;  3UA8 A;  4G68 A;  3DP6 A;  1LCT A;  3FJM A;  3O97 A;  3OMB A;  1KWH A;  3O6I A;  2XXH A;  1MM6 A;  3ZS6 A;  5I59 B;  2UVI A;  1Y20 A;  2DXY A;  1OLA A;  2OJT A;  4H5G A;  4BDR A;  1EH3 A;  4N07 A;  1MQJ A;  4I62 A;  3MJN A;  1P99 A;  4MLQ A;  1VR5 A;  3UP9 A;  3VLV A;  1YTV A;  3K2D A;  3DP4 A;  2I0C A;  3IO6 A;  1Y4T A;  3DM0 A;  4ESW A;  1D3K A;  2ONR A;  4F1Y A;  5DVJ A;  3WAE A;  3K00 A;  4GF8 A;  4QF9 A;  2B3F A;  4EQ9 A;  5FHO A;  3I6V A;  4LQ2 A;  4JWY A;  1MPD A;  1B46 A;  3FXU A;  4R9G A;  2ALU A;  4GIZ A;  3ILU B;  5TP9 A;  5CBS A;  3T93 B;  2FYI A;  2OK2 A;  3CI8 A;  5CMK A;  1R1N A;  4Q30 B;  1B0L A;  1FQC A;  1BTJ A;  2Z8E A;  5F1Q A;  4TOZ A;  2I48 A;  1RKM A;  3QAX A;  1QUJ A;  2VD3 A;  1DPE A;  4PFU A;  3FXR A;  3PMV A;  3N5L A;  3PV0 E;  2O69 A;  1MXY A;  1FTK A;  4U1O A;  2E1S A;  3G7W A;  4ONY A;  1UTH A;  1UQW A;  4JB7 A;  1FQB A;  3FV2 A;  3B6W A;  2ZNU A;  4JWX A;  4YAH X;  4BDO A;  2Q2C A;  1MXZ A;  1SQY A;  3GBA A;  5I2N B;  4QFN A;  3TUS A;  2VOZ A;  1IZ1 A;  4NF4 B;  3G3J A;  3LUY A;  3PD9 A;  4QHQ A;  5I2K B;  1XT8 A;  4H65 A;  2AIX A;  3CFL A;  4ZEC A;  4LON B;  2DOJ A;  2XXY A;  3VFJ A;  2XXV A;  5IKB A;  5I59 A;  3LSW A;  2Y7I A;  4L17 A;  5JTY B;  3TZA A;  2HAV A;  4I8C A;  3UK4 A;  1WVJ A;  2FNC A;  1B58 A;  3MP6 A;  1Y3N A;  1US4 A;  1NNT A;  1P1N A;  2GRV A;  4DXU A;  3K4U A;  3OSQ A;  4WED A;  4U23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...