3G3JA

Crystal structure of the glur6 ligand binding domain dimer i442h k494e k665r i749l q753k mutant with glutamate and nacl at 1.32 angstrom resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
255
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTHLGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKRSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITLAILKLQEEGKLHMMKEKWWRGCPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
total genus 80
structure length 255
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3jA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3jA02
3PUVE 2XXYA 1JETA 1Q35A 2Z23A 1MS7A 4OESA 4ZEIA 3U92A 1RYXA 1FTOA 4YICA 4WEDA 4WXJA 1WODA 4NF4B 3U93A 2UXAA 5H8QB 5H8NB 3QSLA 1N3XA 1LB8A 2I4BA 3HCQA 3MVYA 3PPPA 4FECA 1Y4CA 4X1BA 3PD9A 3MVXA 4JDFA 4NF6A 5M2VA 5CBRA 3PUWE 1JW1A 2Q2CA 3IOUA 3ONMA 3O6HA 4OVJA 2Q89A 2DXRA 3T66A 4G8NA 1IIWA 4U1ZA 1MG1A 1OLCA 2AIXA 1MXUA 1TT1A 1SW4A 1YPNA 2PX1A 4GLIA 4AB6A 1SW2A 1NL5A 1MRPA 3TKDA 2H98A 1EH3A 2QJEA 3Q26A 4OEUA 3TFLA 1DPEA 2B3FA 4DIGA 4PP0A 3OSRA 3E9XA 3QK6A 5LOMA 3LSFB 4P0GA 5ISUA 3FVNA 3IORA 3KSXA 3OO7A 1FTLA 3T22A 3TCHA 3RT8A 1A8EA 1B51A 2GRVA 1URDA 3OSQA 2B3BA 1PBPA 4LUBA 1A54A 4XTCQ 1QULA 3FZVA 4EQ7A 1FTKA 1AL3A 1MH4A 4R75A 1B4ZA 4OENA 1EZ9A 4POXA 5JK4A 4G8MA 4IO6A 3TODA 1BLFA 3IB2A 3TTLA 3EHUA 4Q30B 4Z7EA 5JEIA 5DEXB 1R1NA 3K02A 3VLWA 2V93A 3CG1A 3USDA 1MXXA 2ESNA 1IZ1A 3H3GA 1QUJA 2H99A 4LQ5A 1B5IA 4YAHX 4HCWA 4MLQA 3IK6B 4RYAA 3V83A 4ZEDA 2F6PA 2V3UA 3UN6A 4HTGA 1H44A 2O6AA 1PEBA 2G29A 3G3HA 1IITA 1VSOA 3IJXB 4LVQA 4OERA 2FA7A 4HCYA 1NH7A 5I56A 2OWSA 2VD2A 3VLUA 1Y3QA 4Q8RA 1OVTA 2HZLA 3C36A 1ZJLA 1ZKBA 2P0SA 5AA4A 3HSTA 4DCYA 4I62A 4R6KA 1FQAA 3CI8A 1ZTYA 5H8HB 4YKJA 1PB7A 4PFWA 1D3KA 3KFMA 2DVZA 2F7AA 3M8UA 3Q28A 1DSNA 4F18A 3RUMA 1BTJA 4H65A 4OFOA 3CIJA 3CG3A 2V25A 1NMUA 3KG2A 2G93A 4DDDA 4GOTA 3IR1A 4ISUA 2H9BA 1UTBB 3B6QA 1HSEA 1PDAA 4G68C 4H5FA 4JB7A 4RJZA 1Y20A 3WAEA 2F34A 4H6DA 1B5JA 2PMSA 4YKIA 5EHSA 1Q1KA 3H4ZA 4LZ5A 2KLFA 1XT8A 2XX8A 3G3IA 3MZ9A 5H8NA 1T0KA 4EF1A 3IAZA 4IGRA 2Z22A 1QUKA 4LZ8A 4OFLA 2XXHA 3O66A 1BP5A 4I1DA 5J1DA 3CR9A 1MY3A 4DXCA 2I49A 1S9TA 3BFUA 2OJTA 3R6UA 2ONRA 4IB2A 4KI0E 3SEUA 5ITPA 4O3CA 4JWYA 3V5AA 4JWOA 1IQ7A 2BJJX 3HV1A 4TLLB 1UTHA 4EXLA 3TTMA 4YKPA 1IXCA 4O3AA 2F97A 4GL8A 1NNTA 2I4CA 2QMXA 1HSLA 1MXZA 2I3WA 3PPNA 3RTWB 3VVEA 1DTZA 3FIRA 3OELA 4JSDA 4LATA 5A5XB 4OMBA 3KOTA 4N07A 4DXUA 3C31A 5KDTB 1GTKA 3MPLA 4LONB 3BKIB 5KDTA 5DVFA 2DE4A 2A5SA 4DCXA 1XS5A 3RN8A 2OWTA 1PBQA 2D3IA 2PT1A 4FJPA 3ZKLA 2OCUA 5IKBA 3UORA 2RKMA 1EZOA 1A99A 4R6HA 1JEUA 1N04A 1TWYA 3A09A 5EYFA 3TCFA 2O1MA 3PU5A 3GBBA 4JXIA 4U4SA 3TYHA 4QSDA 4NWCA 2XD3A 3TCGA 4KCDA 4RPNA 1Y1MA 1NNKA 3EHTA 2R9JA 4KR5A 3RPWA 3N6UA 2D5WA 2ZNUA 3K4UA 2I58A 4R73A 1LAXA 4IO5A 4Q5TA 5AE4A 2ABHA 3HO7A 3W15C 4G4PA 3K1MA 4TQUQ 3O6GA 1VFEA 1I6AA 1ZIUA 4K3FA 4EUOA 4G8HA 4ZEFA 3RTFB 4N6PA 1DTGA 1M5DA 4NWDA 3T9XB 1B7UA 3C32A 1URGA 2H25A 2QMWA 3FXUA 3Q29A 4KYSA 3BBRA 1FQBA 1JVYA 4MBPA 2A5TA 2REJA 4F3GA 2Z8FA 3Q27A 3MVZA 4JBZA 1L5TA 4OHNA 1B46A 4ESXA 4OFJA 2REGA 5K2XA 1VFDA 3RLFE 4GL0A 4GQOA 4XKRA 5FTIA 3VXBA 1SDXA 2VD3A 3S9LC 2Q2AA 1NKXA 2GHAA 1FCKA 3G3JA 5CMMA 3VXCA 4ELQA 1IXGA 4YB5A 3ILTB 4H67A 3MWBA 5JTYB 5B7DA 2O69A 4XIGQ 5CMKA 3KEIA 3PMWA 4M4GA 1JEVA 1LFIA 1H3DA 4R72A 4XKQA 3N26A 5I59A 2Z8EA 1MH3A 1MM6A 2F36A 3GZGA 4OTEA 1XHYA 4U22A 3T9HB 1A8FA 4C0RA 1ELJA 3OO9A 3IB0A 3THIA 4ZS9A 3I6VA 3C33A 1O7TA 2YPNA 3MZ1A 4G77A 4WKMA 4NE4A 1N76A 1GVCA 1TFAA 1GGGA 3K1NA 2XXUA 3FGSA 4X1DA 3TPAA 4YMBA 4KQPA 3SEXA 1LAGE 2NXOA 3CVGA 1SYHA 4ZE8A 5IAIA 4IY6A 1US4A 3EPEA 3PUYE 4AQ4A 5K2YA 1B3HA 4E0XA 3GXAA 4IY5A 3TTKA 2XXIA 1PB8A 2ONSA 3G3KA 4BDRA 2DS9A 2X7PA 1NNPA 4UA8A 2DWJA 5I59B 1B4HA 5I2KA 3KSJA 4U2RA 2WKYA 3WAFA 1D4NA 3FVKA 3EN3A 4X48A 5CMBA 2O1LA 4GD5A 4ZEKA 1WVJA 5I2NB 1MPCA 5HPQA 3MJNA 3P7IA 3PUXE 3UIFA 1FQEA 2XXTA 1SW5A 4FATA 1B32A 2I0CA 2XXPA 3IOTA 4OYVA 4XKNA 3TDJA 1MXVA 1FQDA 3I3VA 3G3GA 5H8QA 4RPOA 4F1YA 5CMCA 4F22A 3C35A 1SD3A 5L8DA 4ZE9A 4ESWA 1UIUA 2ALUA 1MY2A 1XVXA 2QPQA 1JQFA 4FORA 5DT6A 1AOVA 2HZKA 4H5GA 3H6TA 1R9QA 4U1OA 3KJ7A 1POY1 2DOJA 2PVUA 3MAMA 5KZTA 2QSXA 2GFEA 1LAHE 4TOZA 2DVCA 3F11A 3O9PA 3S4UA 4DE8A 1DOTA 3M3FA 3ZS6A 2GHBA 2QS2A 2QS4A 2HCAA 2RC7A 4I9DA 4NEDA 2I6EA 3ILUB 4ONYA 1OQHA 4RA1A 3KZGA 4PFTA 3VV5A 3K1PA 3ZSFA 3JV9A 1FTJA 2V84A 4NMYA 5L9MA 2OK2A 4LQ2A 5CI5A 1RYOA 3FATA 1LSTA 3LSXA 2DWIA 1XOCA 4OZ9A 5AA4B 1S7YA 5BWJA 3IOVA 3JYRA 3PPOA 5FTHA 2RINA 3QUJA 1D9VA 1LLSA 3HPIA 2RF1A 5I2KB 4BDQA 4BDLA 4EDPA 3K00A 5I84A 2IA4A 2F35A 2HQ0A 3IOWA 2ZYNA 4QHQA 2F8DA 3OOAA 3RQTA 1OIBA 3C34A 3H7MA 3UK4A 2CZLA 4FIMA 4GVOA 3SEWA 4QFNA 4PE5B 1LAFE 2NUVA 3W9VA 2NVUB 3KGCA 4KD5A 2UYEA 3OO8A 4YU0A 3VVFA 3SKPA 1B58A 4OWDA 2DQVA 3PPRA 3DP8A 5ITOA 4ZZAA 1MQHA 3PUZE 4P0IA 3FV1A 4LA9A 2XXRA 4IO7A 2UVHA 1NNFA 3A3CA 4GXSB 1JNFA 1H43A 1GR2A 1Y3NA 3N6TA 4THIA 3SETA 3ECRA 1M5BA 4PFYA 4F39A 5ICQA 3PGFA 1LBBA 2NOOA 3GBAA 5FHOA 1GV8A 3S9NC 1B3EA 2Q88A 1MY0A 2F78A 3B6WA 4QFKA 3K6UA 4DXBA 2P1SA 2ZYOA 4ZECA 2Y7RA 3TEPA 4Q0CA 2XXVA 4F2QA 4GWOA 1NH8A 1VR5A 3AXFA 2VOZA 2Y7PA 2XXXA 3DLNA 3K6WA 4I8CA 4MF3A 1B9JA 3SDFA 3SEVA 2I3VA 4R2BA 3EHSA 3QIMA 2DWHA 4QFPA 1B3LA 3LUYA 1QJMA 1N3WA 2E1SA 2Y7KA 3KN7A 2QS3A 3SESA 1MQDA 5L9OA 1LCTA 4N13A 5ELVA 2RCAA 3TZAA 5H8HA 1UIVA 2W7YA 3R26A 2XD2A 2AL4A 1B3GA 3U8QA 3K6XA 3KBRA 2RC9A 4ZZEA 2UVIA 1QVSA 3RY3A 4BDMA 2XX7A 3TQWA 1QW0A 1SVXB 2RCBA 2ZMBA 1WDNA 4RK2A 4GRKA 1XC1A 1ATGA 2O68A 4JSOA 2Q8JA 2I0BA 1UQWA 1LB9A 3HHFA 3ODBA 3H6UA 3CFLA 4EQBA 1J1NA 5DTBA 3PPQA 3QAXA 2FYIA 2F7CA 3CFXA 1OMPA 3H06B 1AMFA 3OD7A 3OEKA 3U1OA 3VLVA 1EZPA 3PV0E 4U21A 1OQGA 1B3FA 4NF6B 3L6HA 2PYYA 4O3BA 1ZU0A 4GF8A 1LFHA 3E13X 4ND9A 5F7VA 2Y7IA 1CB6A 4PQJA 5HBCA 4F3BA 1B0LA 2M8CA 3L6GA 2THIA 2HAVA 4ELPA 2E0SA 1UTBA 2NWJA 5I56B 2HEUA 3T93B 3A3UA 1B0HA 2DYXA 3T9VA 3H6WA 3FUZA 1JW4A 3D4CA 5DEXA 3KOSA 1QUIA 3W9WA 4IGTA 1OLAA 3FJMA 1Z7NE 3DELB 2Y7WA 3K0VA 4FE8A 1MXYA 2VGQA 1B1HA 3K6VA 4EQ9A 3IO6A 5JTYA 4E0WA 4GFRA 4HS7A 4YB6A 1IXHA 3T96B 4BLAA 4F19A 1B5HA 1VE4A 4R9GA 3CSGA 5CC2A 2O7IA 5CBSA 2QL3A 3GLBA 1I69A 4KPTA 1Z7ME 1NFTA 2FNCA 4QRZA 4BDOA 1USYE 1LBCA 1F9BA 2RC8A 3M3KA 4Z0IA 3N5LA 1M5EA 4H8IA 1P99A 2DXYA 2YJPA 3B7DA 3HHGA 3IB1A 1B1XA 3LC8A 3MC2A 4RY1A 3UA8A 4F3SA 2UVJA 4NF5A 3DM0A 3LSWA 2ZYMA 3FXQA 1USYH 1B40A 4KHZE 4NF5B 1MXWA 4YB7A 1SBPA 4FEDA 4P11A 5F1QA 3OENA 1N7XA 3E3KA 4KYEA 1A7LA 3FJGA 4QFLA 2AYSA 1AIVA 4OETA 1LGBC 2Q9TA 4MH5A 3K2DA 3RT6B 3V89B 4C1UA 3OXNA 1SW1A 3O2AA 1B52A 1N7WA 2V3TA 1YTVA 1M5FA 1LCFA 4GXAA 1UTHB 1HSJA 2DSFA 4OQOA 1Y1ZA 2F7BA 3FV2A 4ELOA 1JVXA 4H8JA 5DYHA 4ELRA 3D4GA 1URSA 1IXIA 2CMOA 2LAOA 1FQFA 1MDP1 4DLDA 5L9SA 2AL5A 4R6YA 4AB5A 2DP8A 4YZZA 1H45A 1B2HA 4RNSA 2ZNTA 5A5XA 3PD8A 5BUUA 3G7WA 1MY4A 1P1UA 4ECFA 5HM4B 5I58A 4PFUA 4R9FA 2QRYA 2R71A 3IJOB 3MW0A 3EF7A 1N84A 5TPAA 3RNNA 1MQJA 1IUDA 2DWAA 2F6GA 2PT2A 3O97A 3FJ7A 4MLVA 4POWA 3R7XA 1OVBA 1P1NA 3B6TA 4C1TA 3VE1B 1Y4TA 1DMBA 3QYTA 3MPKA 3LSLA 3K01A 4L17A 4UACA 1LFGA 4DZ1A 3MUQA 1A55A 4RXLA 1II5A 3H6VA 5TP9B 5AA2A 1TFDA 2ONKE 1O64A 3IX1A 4KYDA 3TELA 3VDFA 4F2OA 4PETA 1BIYA 1A40A 4R74A 2XXQA 4IO3A 2ZYKA 3TQLA 1TXFA 5EHMA 5B70A 3UP9A 2VP1A 1B7ZA 4QF9A 1S50A 1DPPA 1P1OA 3QUFA 3JZJA 3MZBA 4FEBA 3CFZA 1XVYA 4U4XA 3IO4A 5TPAB 4FAJA 1FW0A 3DP6A 3EQ1A 5H8SA 1CE2A 1SYIA 2OZZA 3FVGA 3Q25A 4YKKA 4H1XA 1MDQA 1H76A 1Y9UA 4F29A 2I48A 2HFBA 3TMGA 3MP8A 1AH5A 2QS1A 4QSEA 4EF2A 2D21A 2OLBA 5H8FB 4F3PA 3M3LA 1ZLQA 2R6GE 1FQCA 1I6QA 2H4IA 1SI1A 2VHAA 3N94A 3ZKKA 5KCJA 1QKBA 2XXWA 4QSCA 5FHNA 5TU0A 5KCJB 1RKMA 3FVOA 2UVGA 1ANFA 1YCJA 4NF8A 2DE2A 4OEVA 3C9HA 2P2AA 3HN0A 3RGYA 4NF8B 1YAEA 3FD3A 4RK9A 1I6BA 1SI0A 3MVWA 2DE3A 4EXKA 1MY1A 4G68A 1M5CA 1MQGA 1ZBMA 1MM7A 1PC3A 2ZNSA 3OMBA 3TUSA 2Z8DA 3OO6A 3TAJA 3MQ9A 2X26A 5I57A 3MBPA 4JWXA 3MP6A 1R9LA 3FXRA 1QKAA 3E4RA 5ICTA 4H0WA 1B05A 2Y84A 1PB9A 3MP1A 4WEPA 3S9EA 1FTMA 3KN8A 3PMXA 4NF4A 1Y3PA 2V3QA 5CRYA 5AA1A 2F5XA 2O51A 3CRBA 3H03A 4R2FA 4BDNA 5I58B 3I5OA 3O6IA 5FHMA 4KFQA 4KCCA 4XKPA 1JW5A 2HAUA 3IL1B 3S2VA 2B65A 4ZDMA 5AA2D 5CM6A 2ANJA 4XXUA 2ZXTA 2A5TB 3FASA 2OBGA 1P1QA 2H5YA 2HXWA 1POTA 3VVDA 1IEJA 2O84X 4QFOA 3SERA 3TTRA 2YLNA 3VFJA 5DVIA 5I57B 1B7HA 1MPBA 1BKAA 1MPDA 5TP9A 3O29A 1KWHA 4LP2B 5AA2B 5H8FA 2IEEA 5I2NA 1US5A 2GH9A 3SEYA 3U72A 4F1VA 1B6HA 2O7UA 4TLMB 5AA3A 3G3FA 3LR1A 3CSBA 4LZ7A 4ZEBA 4MFIA 3T9UA 1R6ZA 2PBWA 4YMAA 3U94A 3S9MC 3O28A 3TTNA 3BFTA 3KN3A 4F31B 1D9YA 3V8XB 2UYFA 4M1VA 4OXVA 3PMVA 1SQYA 1MQIA 1N0TA 2X7QA 2XX9A 3DP4A 4F1UA 3QXMA 3C4MA 3KJTA 4G2ZA 2XHDA 4G68B 4IO4A 1EU8A 1P1WA 1ZMGA 4IO2A 3LBSA 4X9TA 4GIZA 1O63A 4NTLA 4HW8A 3UGWA 4U23A 3OEMA 5DVJA
chains in the Genus database with same CATH superfamily
3PUVE 1FPFA 4OESA 1FTOA 3U93A 4NG7A 5H8QB 5H8NB 2I4BA 4NGUA 4ZE8A 1Y4CA 3PUWE 3O6HA 3T66A 1OLCA 1MXUA 1TT1A 1YPNA 4AB6A 1NL5A 2QJEA 4OEUA 2B3FA 4PP0A 5ISUA 3TCHA 4EQ7A 1PBPA 1FPGA 1FTKA 1AL3A 1MH4A 1B4ZA 4POXA 4G8MA 3TTLA 3IB2A 4Z7EA 3K02A 1IZ1A 2H99A 1B5IA 3IK6B 3V83A 4ZEDA 2V3UA 1IITA 1VSOA 2VD2A 2P0SA 1ZTYA 4YKJA 4F18A 3Q28A 2DVZA 2ZZVA 4OFOA 4G61A 4DDDA 2G93A 4JB7A 1UTBB 5EHSA 3IAZA 3HV1A 4EXLA 3TTMA 1IXCA 5LDZA 2QMXA 2I3WA 2VPOA 4LATA 5A5XB 4JSDA 3C31A 1RDZA 2VPNA 2R8TA 3MPLA 1XS5A 2OWTA 1PBQA 2D3IA 3ZKLA 2OCUA 4N8YA 1A99A 1N04A 3A09A 3TCFA 2O1MA 4U4SA 2FVZA 3TYHA 1FBDA 3TCGA 4KCDA 1NNKA 2D5WA 4Q5TA 2ABHA 3W15C 4G4PA 3K1MA 4P1EA 4K3FA 4ZEFA 1DTGA 3T9XB 2H25A 1NV7A 2A5TA 4GBWA 4PDHA 4PGNA 5FTIA 3VXBA 2VD3A 2GHAA 1FCKA 3G3JA 1LBWA 4XIGQ 4OANA 4M4GA 1JEVA 1H3DA 1MH3A 1MM6A 3KC0A 3GZGA 3OO9A 1GVCA 3K1NA 4YMBA 3TPAA 3SEXA 1LAGE 4IY6A 1US4A 3FBPA 3TTKA 2X7PA 4U2RA 2WKYA 3WAFA 3FVKA 1FPEA 4ZEKA 3P7IA 3PUXE 2XXTA 1SW5A 5J1DA 1B32A 2XXPA 4OYVA 1NUYA 3G3GA 5H8QA 4F1YA 4F22A 4ESWA 5DT6A 2HZKA 4HXVA 2PVUA 3MAMA 2QSXA 4N4UA 1DOTA 3M3FA 3ZS6A 2RC7A 2QVVA 4ZE9A 3ZSFA 1OQHA 2OWZA 4PFTA 3K1PA 1FTJA 4NMYA 5L9MA 4LQ2A 4GWYA 1DK4A 4XEQA 5FTHA 4BDQA 3U65A 4EDPA 3OOAA 4X8RA 3UK4A 4OVSA 2CZLA 2XA5A 4NHBA 2NUVA 3W9VA 3VVFA 1B58A 3FV1A 2XXRA 5CM6A 4THIA 5ICQA 1NUWA 1KZ8A 4DXBA 2F78A 2P1SA 4Q0CA 4F2QA 4GWOA 1NH8A 3AXFA 2VOZA 2I3VA 4O8MA 3LUYA 1N3WA 2Y7KA 1MQDA 1LCTA 4N13A 2W7YA 3U8QA 3K6XA 1DBZA 2OX3A 2XX7A 2ZMBA 4GRKA 3ODBA 3OEKA 1OQGA 4NF6B 1CB6A 5ET8A 2M8CA 2E0SA 5I56B 1B0HA 3T9VA 3H6WA 2Y7WA 4FE8A 3IO6A 5JTYA 4YB6A 3T96B 4F19A 4R9GA 3E79A 5CC2A 2O7IA 1NFTA 2PCRA 4BDOA 3M3KA 3B50A 2RC8A 4Z0IA 3N5LA 2YJPA 3IB1A 1B1XA 3LC8A 3UA8A 2UVJA 3LSWA 2ZYMA 4NF5B 4KHZE 4FEDA 4KYEA 3V89B 2FBPA 3OXNA 3O2AA 1FPKA 1YTVA 4PAFA 1HSJA 2DSFA 1JVXA 5DYHA 3D4GA 2CMOA 1FQFA 1MDP1 4I3EA 4DLDA 4R6YA 5L9SA 1H45A 1FPJA 2ZNTA 3PD8A 1NUZA 5HM4B 4PFUA 2QRYA 5TPAA 2VT5A 3RNNA 1MQJA 1IUDA 5I3SA 1OVBA 3K01A 1A55A 1II5A 1TFDA 2ONKE 4KYDA 2XXQA 3TQLA 4QF9A 1P1OA 5T3JA 5H8SA 4NAPA 4MX6A 2CEYA 2I48A 2QS1A 2B4LA 3M3LA 2R6GE 1FQCA 2H4IA 1SI1A 2VHAA 5ET5A 5KCJA 1QKBA 2F3DA 3FVOA 4NF8A 4OEVA 4NF8B 3GYYA 1M5CA 1MQGA 1ZBMA 2HXRA 3MBPA 3MP6A 5ICTA 3S9EA 5CRYA 2O51A 3H03A 4BDNA 4KCCA 1JW5A 4XXUA 2ZXTA 2H5YA 1NI9A 4P1LA 3SERA 5TP9A 1MPDA 5I2NA 2PFYA 3O29A 2IEEA 3U72A 4TLMB 3G3FA 1R6ZA 2PBWA 3U94A 3S9MC 3TTNA 3BFTA 1D9YA 3V8XB 3PMVA 1MQIA 2XX9A 3DP4A 3C4MA 2XHDA 4IO2A 1ZMGA 1O63A 4QXDA 3D1RA 3T0JA 2XXYA 1JETA 4ZEIA 4WEDA 4WXJA 1WODA 4NF4B 3QSLA 4X1BA 1LB8A 3HCQA 3PPPA 4O7IA 3MVXA 4NF6A 2XWKA 3ONMA 2HHMA 4G8NA 3A29A 1IIWA 4U1ZA 2AIXA 2CEXA 2PX1A 1MRPA 3TKDA 1EH3A 4P3LA 3Q26A 4DIGA 3OSRA 3E9XA 4P0GA 3IORA 1FTLA 3T22A 3OSQA 4LUBA 1A54A 2FHYA 3TODA 4Q30B 1R1NA 5I56A 2V93A 1MXXA 1LBXA 4HTGA 1H44A 2O6AA 1PEBA 4LVQA 4OERA 2FA7A 1NH7A 2HZLA 1FTAA 4DCYA 1D3KA 3KFMA 3RUMA 1BTJA 3KBZA 4ELRA 1NMUA 4GWUA 1XI6A 4GOTA 3IR1A 4P8BA 3WAEA 1PDAA 4YKIA 3B8BA 3H4ZA 4LZ5A 1XT8A 2XX8A 3G3IA 5H8NA 4EF1A 4LZ8A 1QUKA 3O66A 1MY3A 2I49A 4IB2A 5ITPA 4O3CA 3PTYA 4JWYA 2WYPA 1IQ7A 2BJJX 4TLLB 2F97A 2I4CA 1LBZA 3PPNA 1DTZA 4OMBA 4N07A 4DXUA 3BKIB 5IKBA 4NX1A 2RKMA 3UORA 4R6HA 3PU5A 3CHGA 4QSDA 3N6UA 3K4UA 2I58A 4IO5A 1VFEA 1I6AA 4QBAA 4EUOA 3RTFB 4NWDA 2Y5LA 3Q29A 2QMWA 3FXUA 1NUXA 1JVYA 4MBPA 4F3GA 3Q27A 3MVZA 4HE1A 4JBZA 1L5TA 1B46A 4ESXA 4OFJA 4GL0A 2KR0A 3S9LC 2Q2AA 1NKXA 4ELQA 2F3BA 4XFEA 4H67A 5JTYB 5CMKA 3RPLA 3PMWA 5I59A 2Z8EA 2F36A 4OTEA 1ELJA 4ZS9A 3I6VA 3MZ1A 4AS5A 3EPEA 3PUYE 1B3HA 3GXAA 1PB8A 4BDRA 1NNPA 4MEVA 5CMBA 1WVJA 5I2NB 1QGXA 4H46A 5HPQA 3I3VA 5L8DA 1G0IA 1JQFA 4FORA 1LBVA 3KJ7A 1POY1 5EYHA 1LAHE 3O9PA 4I9DA 4RA1A 5CI5A 1RYOA 2WEFA 3LSXA 4MNPA 5AA4B 5BWJA 3QUJA 3HPIA 2RF1A 4BDLA 3KC1A 2IA4A 2HQ0A 3IOWA 3RQTA 3H7MA 4GVOA 4QFNA 4PE5B 1LAFE 4GWWA 2DDKA 2Y5KA 4MHFA 4ZZAA 3PUZE 4P0IA 1NNFA 3A3CA 1H43A 1Y3NA 4F39A 3PGFA 1LBBA 2Q88A 4ZECA 2Y7RA 1NV5A 2XXVA 1VR5A 3K6WA 1B9JA 3SEVA 3EKIA 3QIMA 2DWHA 1B3LA 3KN7A 3SESA 5ELVA 1UIVA 2P3NA 2AL4A 3KBRA 2RC9A 5EQ7A 4ZZEA 1FBHA 1XC1A 1ATGA 2O68A 1LB9A 4EQBA 3PPQA 4LN5A 2F7CA 3U1OA 3L6HA 4O3BA 2Y7IA 4F3BA 3L6GA 2THIA 1UTBA 3T93B 3A3UA 2DYXA 2QFLA 1JW4A 5DEXA 1QUIA 4IGTA 3FJMA 5ET6A 3K0VA 2FIXA 2VGQA 4EQ9A 4PF8A 4E0WA 4BLAA 1B5HA 2QL3A 4KPTA 2FNCA 1LBCA 3HFUA 1NV6A 3B7DA 4RY1A 4F3SA 3DM0A 2WBDA 4P11A 5F1QA 1N7XA 2AYSA 5EQAA 4OQOA 1LCFA 1UTHB 1Y1ZA 4ELOA 1FPIA 2L5VA 2AL5A 4AB5A 5A5XA 1MY4A 4MNCA 2R71A 3IJOB 3MW0A 3EF7A 1N84A 1IMEA 2PT2A 2F6GA 1P1NA 2WX9A 3QYTA 3LSLA 4RXLA 5TP9B 3VDFA 4PE3A 4PETA 5B70A 2VP1A 1DPPA 3JZJA 4U4XA 4FAJA 1XVYA 1FW0A 3DP6A 2OZZA 4H1XA 1Y9UA 4UABA 2QVRA 3N94A 2UVGA 2DE2A 3C9HA 3HN0A 3RGYA 4RK9A 1I6BA 3MVWA 1PC3A 2Z8DA 1R9LA 1FRPA 1PB9A 1FTMA 5AA1A 2F5XA 5I58B 5FHMA 4XKPA 2HAUA 2B65A 2ANJA 1POTA 1IEJA 4QFOA 2YLNA 4LP2B 5H8FA 3SEYA 5AA3A 4F1VA 2O7UA 3CSBA 4ZEBA 3T9UA 1KA0A 2UYFA 4OXVA 4F1UA 1SQYA 4G2ZA 4X9TA 3LBSA 4N81A 4N15A 3UGWA 1MS7A 1FSAA 3U92A 1RYXA 4YICA 2UXAA 2FIEA 3TFLA 4FECA 3PD9A 5CBRA 1JW1A 4PF6A 4JVIA 1K9YA 1SW4A 1FJ6A 4N91A 5FBPA 3QK6A 3OO7A 3RT8A 1A8EA 1URDA 2B3BA 4XTCQ 1QULA 3BIHA 3FZVA 5JK4A 4IO6A 5JEIA 3VLWA 3CG1A 4LQ5A 4MLQA 4RYAA 2F6PA 4MMPA 2G29A 3G3HA 2OWSA 4Q8RA 1OVTA 3C36A 1ZJLA 5AA4A 3HSTA 4I62A 4R6KA 1FQAA 3CI8A 4I3YA 5H8HB 1PB7A 4PFWA 4H65A 4FATA 3CG3A 4OVQA 4ISUA 4G68C 1Y20A 2F34A 2PMSA 1Q1KA 2WBBA 4IGRA 2Z22A 5EQ8A 2XXHA 4I1DA 3CR9A 4DXCA 1S9TA 2OJTA 4KI0E 2XXKA 3V5AA 4P9KA 1UTHA 4GL8A 5IM2A 1MXZA 3QMFA 5KDTB 3KOTA 1GTKA 5KDTA 2DE4A 4DCXA 3FXBA 1JEUA 5EYFA 3GBBA 1Y1MA 3EHTA 2R9JA 1NV0A 4R73A 4HE2A 3LUZA 4TQUQ 3O6GA 1ZIUA 4G8HA 1URGA 4KYSA 3BBRA 3E78A 2Z8FA 3RLFE 4XKRA 1SDXA 5CMMA 3VXCA 5B7DA 3KEIA 2XWVA 4U22A 1XHYA 1EYKA 4C0RA 1A8FA 2YPNA 4WKMA 5EQ9A 3FGSA 4X1DA 4KQPA 3CVGA 4DI3D 5IAIA 5ESYA 5K2YA 2XXIA 2ONSA 3G3KA 2DWJA 1B4HA 3EN3A 2O1LA 1MPCA 4PC9A 3MJNA 1FQEA 5CMCA 3C35A 1SD3A 1UIUA 2QVUA 1XVXA 2QPQA 1AOVA 1IMAA 4PDDA 4GBVA 2ZZXA 5KZTA 4TOZA 3F11A 2HCAA 3KZGA 3JV9A 4IR8A 2OK2A 1LSTA 1KA1A 2DWIA 3ROJA 1XOCA 1S7YA 4PGPA 3NOHA 5I2KB 2BJIA 2P3VA 3K00A 5I84A 2ZYNA 4QHQA 3C34A 5F24A 1FPBA 3SEWA 3OO8A 2XWIA 4OWDA 3PPRA 5ITOA 5LTCA 4OETA 1JNFA 4PFYA 4N6KA 1GV8A 5FHOA 1DCUA 3TEPA 4OVPA 3DLNA 1LEVA 4PBQA 2Y7PA 2XXXA 4I8CA 4MF3A 1RDXA 4R2BA 2WYKA 5IZ1A 5H8HA 3R26A 2XD2A 4PFBA 1B3GA 4BDMA 1SVXB 4RK2A 2I0BA 3HHFA 3QAXA 3CFXA 1OMPA 1EYJA 1EZPA 3PV0E 2PYYA 1ZU0A 5IZZA 5F7VA 5HBCA 4PQJA 4MJOA 3ISPA 3FUZA 3D4CA 5IZ3A 3DELB 1MXYA 3K6VA 1B1HA 2PFZA 3CSGA 3GLBA 1Z7ME 4QRZA 1F9BA 1M5EA 4H8IA 2DXYA 3HHGA 3MC2A 2CZHA 4NF5A 4PFRA 3FXQA 5IZ3B 1B40A 4YB7A 4QFLA 3FJGA 2Q9TA 4MH5A 3K2DA 3RT6B 2V3TA 1M5FA 4GXAA 3FV2A 2F7BA 4H8JA 1SPIA 1IXIA 2LAOA 2DP8A 4RNSA 1B2HA 5BUUA 3G7WA 1P1UA 4ECFA 5I58A 2ZZWA 4P56A 4NF0A 4N6DA 5ET7A 2DWAA 1IMFA 3R7XA 4C1TA 3VE1B 1Y4TA 1NV1A 3MPKA 4L17A 4DZ1A 4UACA 1LFGA 3MUQA 5AA2A 1O64A 3TELA 1G0HA 1TXFA 1B7ZA 4OVRA 3QUFA 5TPAB 3CFZA 3EQ1A 4YKKA 3FVGA 3IFAA 1H76A 4QSEA 4EF2A 2D21A 2OLBA 5H8FB 4F3PA 1ZLQA 2XXWA 4QSCA 5KCJB 1RKMA 1ANFA 1YAEA 4P47A 1FBPA 1MY1A 4G68A 2ZNSA 4JWXA 3FXRA 1QKAA 3E4RA 4H0WA 1B05A 2Y84A 4WEPA 1Y3PA 1IMCA 4R2FA 3O6IA 4KFQA 2GQ1A 1K9ZA 4N8GA 5AA2D 2A5TB 3BIGA 1P1QA 3VVDA 2O84X 3TTRA 3VFJA 5DVIA 1MPBA 1BKAA 5IGAA 4MFIA 4YMAA 1FPLA 1LBYA 3O28A 3KN3A 4F31B 4M1VA 1N0TA 2X7QA 1EU8A 1P1WA 4GIZA 4NTLA 5DVJA 1Q35A 2Z23A 1Q9DA 2JJKA 1N3XA 2Q8MA 3MVYA 5M2VA 4JDFA 3IOUA 2Q2CA 4DI4B 4OVJA 2Q89A 2DXRA 1MG1A 4GLIA 1SW2A 2H98A 1DPEA 5LOMA 3LSFB 3FVNA 3KSXA 4GX4A 1B51A 2GRVA 4NQ8A 4PCDA 4R75A 4OENA 1EZ9A 1BLFA 3EHUA 3USDA 2ESNA 3H3GA 1QUJA 4YAHX 4HCWA 3UN6A 3IJXB 4HCYA 1RDYA 1Y3QA 3VLUA 1ZKBA 1FBCA 2HPGA 3MYUA 3M8UA 2F7AA 1DSNA 3CIJA 3KG2A 2V25A 5DEXB 2H9BA 3B6QA 1HSEA 4H5FA 4RJZA 1VDWA 4H6DA 1B5JA 4I40A 2KLFA 3MZ9A 1T0KA 4OA4A 4OFLA 1BP5A 1YXIA 1YZ0A 3BFUA 3R6UA 2ONRA 3SEUA 4JWOA 4YKPA 4O3AA 1NNTA 1IMBA 1HSLA 1FBGA 3RTWB 3VVEA 3FIRA 3OELA 3SZPA 1FJ9A 4LONB 5DVFA 5J16A 2A5SA 4O94A 3RN8A 3IFCA 4FJPA 2PT1A 1EZOA 1TWYA 1JP4A 4JXIA 1D9QA 4NWCA 2XD3A 4RPNA 3RPWA 4KR5A 2ZNUA 1LAXA 1NV3A 5AE4A 1INPA 3HO7A 1NV2A 4N6PA 1M5DA 1B7UA 3C32A 1FQBA 2REJA 4OHNA 1AWBA 2REGA 5K2XA 1VFDA 4GQOA 1IXGA 4YB5A 3ILTB 3MWBA 2O69A 1LFIA 4R72A 4XKQA 3N26A 3RPLB 3T9HB 4AS4A 3IB0A 3THIA 4X04A 3C33A 1O7TA 4G77A 4NE4A 1N76A 1TFAA 1GGGA 4MIJA 2XXUA 4PAKA 2NXOA 1SYHA 2MKZA 4AQ4A 4E0XA 4IY5A 1BK4A 2DS9A 4UA8A 5I59B 2XWOA 5I2KA 3KSJA 4NN3A 1D4NA 4X48A 4GD5A 3UIFA 2I0CA 3IOTA 3TDJA 4XKNA 1MXVA 1FQDA 4RPOA 2ALUA 3RYDA 1MY2A 4OVTA 4H5GA 3H6TA 1R9QA 4U1OA 2DOJA 2GFEA 3S4UA 2DVCA 4DE8A 2GHBA 2QS2A 2QS4A 4NEDA 2I6EA 3ILUB 4ONYA 3VV5A 2Q74A 2V84A 2CZIA 3FATA 4OZ9A 3IOVA 3JYRA 3PPOA 2RINA 1D9VA 1LLSA 4PBHA 2F35A 2F8DA 2V4CA 1OIBA 4FIMA 2NVUB 3KGCA 4KD5A 2UYEA 4PFIA 4YU0A 3SKPA 2DQVA 3DP8A 1MQHA 4LA9A 4IO7A 2UVHA 4GXSB 3SETA 1GR2A 3N6TA 3ECRA 1M5BA 2NOOA 3GBAA 3S9NC 1B3EA 3B6WA 1MY0A 4QFKA 3K6UA 2ZYOA 4KXPA 5I5PA 3SDFA 3EHSA 4GWXA 4QFPA 1QJMA 2E1SA 2QS3A 5L9OA 4PTKA 2RCAA 3TZAA 2UVIA 1QVSA 3RY3A 3TQWA 1QW0A 2RCBA 4FBPA 1WDNA 4JSOA 2Q8JA 1UQWA 3H6UA 3CFLA 1J1NA 5DTBA 2FYIA 3H06B 3VLVA 1AMFA 3OD7A 4U21A 1B3FA 4GF8A 1LFHA 3E13X 4ND9A 1FBFA 1B0LA 4ELPA 2HAVA 2NWJA 2HEUA 3KOSA 3W9WA 1OLAA 4JVCA 4MNIA 1Z7NE 3MSTA 4GFRA 4HS7A 1IXHA 1VE4A 5CBSA 1I69A 4HE0A 1USYE 4N17A 1P99A 4GX6A 1USYH 4MCOA 1MXWA 1SBPA 3OENA 3E3KA 1A7LA 1AIVA 1LGBC 4C1UA 1SW1A 1B52A 1N7WA 4XF5A 1URSA 1YYZA 4YZZA 4GWZA 4R9FA 3O97A 3FJ7A 4MLVA 4POWA 3B6TA 1DMBA 3H6VA 2B4MA 4F2OA 3IX1A 1BIYA 1A40A 4R74A 4IO3A 2ZYKA 5EHMA 3UP9A 4H45A 1S50A 5I7IA 3MZBA 4FEBA 1EYIA 3IO4A 1CE2A 1FBEA 1SYIA 3Q25A 1MDQA 4F29A 4O7MA 2HFBA 3TMGA 3MP8A 1AH5A 3ZKKA 1I6QA 1FPDA 5FHNA 5TU0A 1YCJA 3T1BA 2P2AA 3FD3A 1SI0A 2DE3A 4GWSA 4EXKA 3TUSA 3OMBA 1MM7A 3OO6A 3TAJA 3MQ9A 2X26A 5I57A 4MAGA 2CZKA 3MP1A 5EYGA 3KN8A 3PMXA 4NF4A 2V3QA 2KQZA 3CRBA 3I5OA 3LV0A 3IL1B 3S2VA 5A5LA 4ZDMA 1CNQA 3FASA 2OBGA 2HXWA 4PAIA 5I57B 1B7HA 5AA2B 1KWHA 1US5A 2GH9A 1B6HA 3LR1A 1NV4A 4LZ7A 4JVDA 4GX3A 5DW8A 1IMDA 3QXMA 3KJTA 4G68B 4IO4A 4HW8A 4U23A 3OEMA
chains in the Genus database with same CATH topology
3PUVE 2XXYA 1JETA 1Q35A 2Z23A 1MS7A 4OESA 4ZEIA 3U92A 1RYXA 1FTOA 4YICA 4WEDA 4WXJA 1WODA 4NF4B 3U93A 2UXAA 5H8QB 5H8NB 3QSLA 1N3XA 1LB8A 2I4BA 3HCQA 3MVYA 3PPPA 4FECA 1Y4CA 4X1BA 3PD9A 3MVXA 4JDFA 4NF6A 5M2VA 5CBRA 3PUWE 1JW1A 2Q2CA 3IOUA 3ONMA 3O6HA 4OVJA 2Q89A 2DXRA 3T66A 4G8NA 1IIWA 4U1ZA 1MG1A 1OLCA 2AIXA 1MXUA 1TT1A 1SW4A 1YPNA 2PX1A 4GLIA 4AB6A 1SW2A 1NL5A 1MRPA 3TKDA 2H98A 1EH3A 2QJEA 3Q26A 4OEUA 3TFLA 1DPEA 2B3FA 4DIGA 4PP0A 3OSRA 3E9XA 3QK6A 5LOMA 3LSFB 4P0GA 5ISUA 3FVNA 3IORA 3KSXA 3OO7A 1FTLA 3T22A 3TCHA 3RT8A 1A8EA 1B51A 2GRVA 1URDA 3OSQA 2B3BA 1PBPA 4LUBA 1A54A 4XTCQ 1QULA 3FZVA 4EQ7A 1FTKA 1AL3A 1MH4A 4R75A 1B4ZA 4OENA 1EZ9A 4POXA 5JK4A 4G8MA 4IO6A 3TODA 1BLFA 3IB2A 3TTLA 3EHUA 4Q30B 4Z7EA 5JEIA 5DEXB 1R1NA 3K02A 3VLWA 2V93A 3CG1A 3USDA 1MXXA 2ESNA 1IZ1A 3H3GA 1QUJA 2H99A 4LQ5A 1B5IA 4YAHX 4HCWA 4MLQA 3IK6B 4RYAA 3V83A 4ZEDA 2F6PA 2V3UA 3UN6A 4HTGA 1H44A 2O6AA 1PEBA 2G29A 3G3HA 1IITA 1VSOA 3IJXB 4LVQA 4OERA 2FA7A 4HCYA 1NH7A 5I56A 2OWSA 2VD2A 3VLUA 1Y3QA 4Q8RA 1OVTA 2HZLA 3C36A 1ZJLA 1ZKBA 2P0SA 5AA4A 3HSTA 4DCYA 4I62A 4R6KA 1FQAA 3CI8A 1ZTYA 5H8HB 4YKJA 1PB7A 4PFWA 1D3KA 3KFMA 2DVZA 2F7AA 3M8UA 3Q28A 1DSNA 4F18A 3RUMA 1BTJA 4H65A 4OFOA 3CIJA 3CG3A 2V25A 1NMUA 3KG2A 2G93A 4DDDA 4GOTA 3IR1A 4ISUA 2H9BA 1UTBB 3B6QA 1HSEA 1PDAA 4G68C 4H5FA 4JB7A 4RJZA 1Y20A 3WAEA 2F34A 4H6DA 1B5JA 2PMSA 4YKIA 5EHSA 1Q1KA 3H4ZA 4LZ5A 2KLFA 1XT8A 2XX8A 3G3IA 3MZ9A 5H8NA 1T0KA 4EF1A 3IAZA 4IGRA 2Z22A 1QUKA 4LZ8A 4OFLA 2XXHA 3O66A 1BP5A 4I1DA 5J1DA 3CR9A 1MY3A 4DXCA 2I49A 1S9TA 3BFUA 2OJTA 3R6UA 2ONRA 4IB2A 4KI0E 3SEUA 5ITPA 4O3CA 4JWYA 3V5AA 4JWOA 1IQ7A 2BJJX 3HV1A 4TLLB 1UTHA 4EXLA 3TTMA 4YKPA 1IXCA 4O3AA 2F97A 4GL8A 1NNTA 2I4CA 2QMXA 1HSLA 1MXZA 2I3WA 3PPNA 3RTWB 3VVEA 1DTZA 3FIRA 3OELA 4JSDA 4LATA 5A5XB 4OMBA 3KOTA 4N07A 4DXUA 3C31A 5KDTB 1GTKA 3MPLA 4LONB 3BKIB 5KDTA 5DVFA 2DE4A 2A5SA 4DCXA 1XS5A 3RN8A 2OWTA 1PBQA 2D3IA 2PT1A 4FJPA 3ZKLA 2OCUA 5IKBA 3UORA 2RKMA 1EZOA 1A99A 4R6HA 1JEUA 1N04A 1TWYA 3A09A 5EYFA 3TCFA 2O1MA 3PU5A 3GBBA 4JXIA 4U4SA 3TYHA 4QSDA 4NWCA 2XD3A 3TCGA 4KCDA 4RPNA 1Y1MA 1NNKA 3EHTA 2R9JA 4KR5A 3RPWA 3N6UA 2D5WA 2ZNUA 3K4UA 2I58A 4R73A 1LAXA 4IO5A 4Q5TA 5AE4A 2ABHA 3HO7A 3W15C 4G4PA 3K1MA 4TQUQ 3O6GA 1VFEA 1I6AA 1ZIUA 4K3FA 4EUOA 4G8HA 4ZEFA 3RTFB 4N6PA 1DTGA 1M5DA 4NWDA 3T9XB 1B7UA 3C32A 1URGA 2H25A 2QMWA 3FXUA 3Q29A 4KYSA 3BBRA 1FQBA 1JVYA 4MBPA 2A5TA 2REJA 4F3GA 2Z8FA 3Q27A 3MVZA 4JBZA 1L5TA 4OHNA 1B46A 4ESXA 4OFJA 2REGA 5K2XA 1VFDA 3RLFE 4GL0A 4GQOA 4XKRA 5FTIA 3VXBA 1SDXA 2VD3A 3S9LC 2Q2AA 1NKXA 2GHAA 1FCKA 3G3JA 5CMMA 3VXCA 4ELQA 1IXGA 4YB5A 3ILTB 4H67A 3MWBA 5JTYB 5B7DA 2O69A 4XIGQ 5CMKA 3KEIA 3PMWA 4M4GA 1JEVA 1LFIA 1H3DA 4R72A 4XKQA 3N26A 5I59A 2Z8EA 1MH3A 1MM6A 2F36A 3GZGA 4OTEA 1XHYA 4U22A 3T9HB 1A8FA 4C0RA 1ELJA 3OO9A 3IB0A 3THIA 4ZS9A 3I6VA 3C33A 1O7TA 2YPNA 3MZ1A 4G77A 4WKMA 4NE4A 1N76A 1GVCA 1TFAA 1GGGA 3K1NA 2XXUA 3FGSA 4X1DA 3TPAA 4YMBA 4KQPA 3SEXA 1LAGE 2NXOA 3CVGA 1SYHA 4ZE8A 5IAIA 4IY6A 1US4A 3EPEA 3PUYE 4AQ4A 5K2YA 1B3HA 4E0XA 3GXAA 4IY5A 3TTKA 2XXIA 1PB8A 2ONSA 3G3KA 4BDRA 2DS9A 2X7PA 1NNPA 4UA8A 2DWJA 5I59B 1B4HA 5I2KA 3KSJA 4U2RA 2WKYA 3WAFA 1D4NA 3FVKA 3EN3A 4X48A 5CMBA 2O1LA 4GD5A 4ZEKA 1WVJA 5I2NB 1MPCA 5HPQA 3MJNA 3P7IA 3PUXE 3UIFA 1FQEA 2XXTA 1SW5A 4FATA 1B32A 2I0CA 2XXPA 3IOTA 4OYVA 4XKNA 3TDJA 1MXVA 1FQDA 3I3VA 3G3GA 5H8QA 4RPOA 4F1YA 5CMCA 4F22A 3C35A 1SD3A 5L8DA 4ZE9A 4ESWA 1UIUA 2ALUA 1MY2A 1XVXA 2QPQA 1JQFA 4FORA 5DT6A 1AOVA 2HZKA 4H5GA 3H6TA 1R9QA 4U1OA 3KJ7A 1POY1 2DOJA 2PVUA 3MAMA 5KZTA 2QSXA 2GFEA 1LAHE 4TOZA 2DVCA 3F11A 3O9PA 3S4UA 4DE8A 1DOTA 3M3FA 3ZS6A 2GHBA 2QS2A 2QS4A 2HCAA 2RC7A 4I9DA 4NEDA 2I6EA 3ILUB 4ONYA 1OQHA 4RA1A 3KZGA 4PFTA 3VV5A 3K1PA 3ZSFA 3JV9A 1FTJA 2V84A 4NMYA 5L9MA 2OK2A 4LQ2A 5CI5A 1RYOA 3FATA 1LSTA 3LSXA 2DWIA 1XOCA 4OZ9A 5AA4B 1S7YA 5BWJA 3IOVA 3JYRA 3PPOA 5FTHA 2RINA 3QUJA 1D9VA 1LLSA 3HPIA 2RF1A 5I2KB 4BDQA 4BDLA 4EDPA 3K00A 5I84A 2IA4A 2F35A 2HQ0A 3IOWA 2ZYNA 4QHQA 2F8DA 3OOAA 3RQTA 1OIBA 3C34A 3H7MA 3UK4A 2CZLA 4FIMA 4GVOA 3SEWA 4QFNA 4PE5B 1LAFE 2NUVA 3W9VA 2NVUB 3KGCA 4KD5A 2UYEA 3OO8A 4YU0A 3VVFA 3SKPA 1B58A 4OWDA 2DQVA 3PPRA 3DP8A 5ITOA 4ZZAA 1MQHA 3PUZE 4P0IA 3FV1A 4LA9A 2XXRA 4IO7A 2UVHA 1NNFA 3A3CA 4GXSB 1JNFA 1H43A 1GR2A 1Y3NA 3N6TA 4THIA 3SETA 3ECRA 1M5BA 4PFYA 4F39A 5ICQA 3PGFA 1LBBA 2NOOA 3GBAA 5FHOA 1GV8A 3S9NC 1B3EA 2Q88A 1MY0A 2F78A 3B6WA 4QFKA 3K6UA 4DXBA 2P1SA 2ZYOA 4ZECA 2Y7RA 3TEPA 4Q0CA 2XXVA 4F2QA 4GWOA 1NH8A 1VR5A 3AXFA 2VOZA 2Y7PA 2XXXA 3DLNA 3K6WA 4I8CA 4MF3A 1B9JA 3SDFA 3SEVA 2I3VA 4R2BA 3EHSA 3QIMA 2DWHA 4QFPA 1B3LA 3LUYA 1QJMA 1N3WA 2E1SA 2Y7KA 3KN7A 2QS3A 3SESA 1MQDA 5L9OA 1LCTA 4N13A 5ELVA 2RCAA 3TZAA 5H8HA 1UIVA 2W7YA 3R26A 2XD2A 2AL4A 1B3GA 3U8QA 3K6XA 3KBRA 2RC9A 4ZZEA 2UVIA 1QVSA 3RY3A 4BDMA 2XX7A 3TQWA 1QW0A 1SVXB 2RCBA 2ZMBA 1WDNA 4RK2A 4GRKA 1XC1A 1ATGA 2O68A 4JSOA 2Q8JA 2I0BA 1UQWA 1LB9A 3HHFA 3ODBA 3H6UA 3CFLA 4EQBA 1J1NA 5DTBA 3PPQA 3QAXA 2FYIA 2F7CA 3CFXA 1OMPA 3H06B 1AMFA 3OD7A 3OEKA 3U1OA 3VLVA 1EZPA 3PV0E 4U21A 1OQGA 1B3FA 4NF6B 3L6HA 2PYYA 4O3BA 1ZU0A 4GF8A 1LFHA 3E13X 4ND9A 5F7VA 2Y7IA 1CB6A 4PQJA 5HBCA 4F3BA 1B0LA 2M8CA 3L6GA 2THIA 2HAVA 4ELPA 2E0SA 1UTBA 2NWJA 5I56B 2HEUA 3T93B 3A3UA 1B0HA 2DYXA 3T9VA 3H6WA 3FUZA 1JW4A 3D4CA 5DEXA 3KOSA 1QUIA 3W9WA 4IGTA 1OLAA 3FJMA 1Z7NE 3DELB 2Y7WA 3K0VA 4FE8A 1MXYA 2VGQA 1B1HA 3K6VA 4EQ9A 3IO6A 5JTYA 4E0WA 4GFRA 4HS7A 4YB6A 1IXHA 3T96B 4BLAA 4F19A 1B5HA 1VE4A 4R9GA 3CSGA 5CC2A 2O7IA 5CBSA 2QL3A 3GLBA 1I69A 4KPTA 1Z7ME 1NFTA 2FNCA 4QRZA 4BDOA 1USYE 1LBCA 1F9BA 2RC8A 3M3KA 4Z0IA 3N5LA 1M5EA 4H8IA 1P99A 2DXYA 2YJPA 3B7DA 3HHGA 3IB1A 1B1XA 3LC8A 3MC2A 4RY1A 3UA8A 4F3SA 2UVJA 4NF5A 3DM0A 3LSWA 2ZYMA 3FXQA 1USYH 1B40A 4KHZE 4NF5B 1MXWA 4YB7A 1SBPA 4FEDA 4P11A 5F1QA 3OENA 1N7XA 3E3KA 4KYEA 1A7LA 3FJGA 4QFLA 2AYSA 1AIVA 4OETA 1LGBC 2Q9TA 4MH5A 3K2DA 3RT6B 3V89B 4C1UA 3OXNA 1SW1A 3O2AA 1B52A 1N7WA 2V3TA 1YTVA 1M5FA 1LCFA 4GXAA 1UTHB 1HSJA 2DSFA 4OQOA 1Y1ZA 2F7BA 3FV2A 4ELOA 1JVXA 4H8JA 5DYHA 4ELRA 3D4GA 1URSA 1IXIA 2CMOA 2LAOA 1FQFA 1MDP1 4DLDA 5L9SA 2AL5A 4R6YA 4AB5A 2DP8A 4YZZA 1H45A 1B2HA 4RNSA 2ZNTA 5A5XA 3PD8A 5BUUA 3G7WA 1MY4A 1P1UA 4ECFA 5HM4B 5I58A 4PFUA 4R9FA 2QRYA 2R71A 3IJOB 3MW0A 3EF7A 1N84A 5TPAA 3RNNA 1MQJA 1IUDA 2DWAA 2F6GA 2PT2A 3O97A 3FJ7A 4MLVA 4POWA 3R7XA 1OVBA 1P1NA 3B6TA 4C1TA 3VE1B 1Y4TA 1DMBA 3QYTA 3MPKA 3LSLA 3K01A 4L17A 4UACA 1LFGA 4DZ1A 3MUQA 1A55A 4RXLA 1II5A 3H6VA 5TP9B 5AA2A 1TFDA 2ONKE 1O64A 3IX1A 4KYDA 3TELA 3VDFA 4F2OA 4PETA 1BIYA 1A40A 4R74A 2XXQA 4IO3A 2ZYKA 3TQLA 1TXFA 5EHMA 5B70A 3UP9A 2VP1A 1B7ZA 4QF9A 1S50A 1DPPA 1P1OA 3QUFA 3JZJA 3MZBA 4FEBA 3CFZA 1XVYA 4U4XA 3IO4A 5TPAB 4FAJA 1FW0A 3DP6A 3EQ1A 5H8SA 1CE2A 1SYIA 2OZZA 3FVGA 3Q25A 4YKKA 4H1XA 1MDQA 1H76A 1Y9UA 4F29A 2I48A 2HFBA 3TMGA 3MP8A 1AH5A 2QS1A 4QSEA 4EF2A 2D21A 2OLBA 5H8FB 4F3PA 3M3LA 1ZLQA 2R6GE 1FQCA 1I6QA 2H4IA 1SI1A 2VHAA 3N94A 3ZKKA 5KCJA 1QKBA 2XXWA 4QSCA 5FHNA 5TU0A 5KCJB 1RKMA 3FVOA 2UVGA 1ANFA 1YCJA 4NF8A 2DE2A 4OEVA 3C9HA 2P2AA 3HN0A 3RGYA 4NF8B 1YAEA 3FD3A 4RK9A 1I6BA 1SI0A 3MVWA 2DE3A 4EXKA 1MY1A 4G68A 1M5CA 1MQGA 1ZBMA 1MM7A 1PC3A 2ZNSA 3OMBA 3TUSA 2Z8DA 3OO6A 3TAJA 3MQ9A 2X26A 5I57A 3MBPA 4JWXA 3MP6A 1R9LA 3FXRA 1QKAA 3E4RA 5ICTA 4H0WA 1B05A 2Y84A 1PB9A 3MP1A 4WEPA 3S9EA 1FTMA 3KN8A 3PMXA 4NF4A 1Y3PA 2V3QA 5CRYA 5AA1A 2F5XA 2O51A 3CRBA 3H03A 4R2FA 4BDNA 5I58B 3I5OA 3O6IA 5FHMA 4KFQA 4KCCA 4XKPA 1JW5A 2HAUA 3IL1B 3S2VA 2B65A 4ZDMA 5AA2D 5CM6A 2ANJA 4XXUA 2ZXTA 2A5TB 3FASA 2OBGA 1P1QA 2H5YA 2HXWA 1POTA 3VVDA 1IEJA 2O84X 4QFOA 3SERA 3TTRA 2YLNA 3VFJA 5DVIA 5I57B 1B7HA 1MPBA 1BKAA 1MPDA 5TP9A 3O29A 1KWHA 4LP2B 5AA2B 5H8FA 2IEEA 5I2NA 1US5A 2GH9A 3SEYA 3U72A 4F1VA 1B6HA 2O7UA 4TLMB 5AA3A 3G3FA 3LR1A 3CSBA 4LZ7A 4ZEBA 4MFIA 3T9UA 1R6ZA 2PBWA 4YMAA 3U94A 3S9MC 3O28A 3TTNA 3BFTA 3KN3A 4F31B 1D9YA 3V8XB 2UYFA 4M1VA 4OXVA 3PMVA 1SQYA 1MQIA 1N0TA 2X7QA 2XX9A 3DP4A 4F1UA 3QXMA 3C4MA 3KJTA 4G2ZA 2XHDA 4G68B 4IO4A 1EU8A 1P1WA 1ZMGA 4IO2A 3LBSA 4X9TA 4GIZA 1O63A 4NTLA 4HW8A 3UGWA 4U23A 3OEMA 5DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUV E;  2XXY A;  1JET A;  1Q35 A;  2Z23 A;  1MS7 A;  4OES A;  4ZEI A;  3U92 A;  1RYX A;  1FTO A;  4YIC A;  4WED A;  4WXJ A;  1WOD A;  4NF4 B;  3U93 A;  2UXA A;  5H8Q B;  5H8N B;  3QSL A;  1N3X A;  1LB8 A;  2I4B A;  3HCQ A;  3MVY A;  3PPP A;  4FEC A;  1Y4C A;  4X1B A;  3PD9 A;  3MVX A;  4JDF A;  4NF6 A;  5M2V A;  5CBR A;  3PUW E;  1JW1 A;  2Q2C A;  3IOU A;  3ONM A;  3O6H A;  4OVJ A;  2Q89 A;  2DXR A;  3T66 A;  4G8N A;  1IIW A;  4U1Z A;  1MG1 A;  1OLC A;  2AIX A;  1MXU A;  1TT1 A;  1SW4 A;  1YPN A;  2PX1 A;  4GLI A;  4AB6 A;  1SW2 A;  1NL5 A;  1MRP A;  3TKD A;  2H98 A;  1EH3 A;  2QJE A;  3Q26 A;  4OEU A;  3TFL A;  1DPE A;  2B3F A;  4DIG A;  4PP0 A;  3OSR A;  3E9X A;  3QK6 A;  5LOM A;  3LSF B;  4P0G A;  5ISU A;  3FVN A;  3IOR A;  3KSX A;  3OO7 A;  1FTL A;  3T22 A;  3TCH A;  3RT8 A;  1A8E A;  1B51 A;  2GRV A;  1URD A;  3OSQ A;  2B3B A;  1PBP A;  4LUB A;  1A54 A;  4XTC Q;  1QUL A;  3FZV A;  4EQ7 A;  1FTK A;  1AL3 A;  1MH4 A;  4R75 A;  1B4Z A;  4OEN A;  1EZ9 A;  4POX A;  5JK4 A;  4G8M A;  4IO6 A;  3TOD A;  1BLF A;  3IB2 A;  3TTL A;  3EHU A;  4Q30 B;  4Z7E A;  5JEI A;  5DEX B;  1R1N A;  3K02 A;  3VLW A;  2V93 A;  3CG1 A;  3USD A;  1MXX A;  2ESN A;  1IZ1 A;  3H3G A;  1QUJ A;  2H99 A;  4LQ5 A;  1B5I A;  4YAH X;  4HCW A;  4MLQ A;  3IK6 B;  4RYA A;  3V83 A;  4ZED A;  2F6P A;  2V3U A;  3UN6 A;  4HTG A;  1H44 A;  2O6A A;  1PEB A;  2G29 A;  3G3H A;  1IIT A;  1VSO A;  3IJX B;  4LVQ A;  4OER A;  2FA7 A;  4HCY A;  1NH7 A;  5I56 A;  2OWS A;  2VD2 A;  3VLU A;  1Y3Q A;  4Q8R A;  1OVT A;  2HZL A;  3C36 A;  1ZJL A;  1ZKB A;  2P0S A;  5AA4 A;  3HST A;  4DCY A;  4I62 A;  4R6K A;  1FQA A;  3CI8 A;  1ZTY A;  5H8H B;  4YKJ A;  1PB7 A;  4PFW A;  1D3K A;  3KFM A;  2DVZ A;  2F7A A;  3M8U A;  3Q28 A;  1DSN A;  4F18 A;  3RUM A;  1BTJ A;  4H65 A;  4OFO A;  3CIJ A;  3CG3 A;  2V25 A;  1NMU A;  3KG2 A;  2G93 A;  4DDD A;  4GOT A;  3IR1 A;  4ISU A;  2H9B A;  1UTB B;  3B6Q A;  1HSE A;  1PDA A;  4G68 C;  4H5F A;  4JB7 A;  4RJZ A;  1Y20 A;  3WAE A;  2F34 A;  4H6D A;  1B5J A;  2PMS A;  4YKI A;  5EHS A;  1Q1K A;  3H4Z A;  4LZ5 A;  2KLF A;  1XT8 A;  2XX8 A;  3G3I A;  3MZ9 A;  5H8N A;  1T0K A;  4EF1 A;  3IAZ A;  4IGR A;  2Z22 A;  1QUK A;  4LZ8 A;  4OFL A;  2XXH A;  3O66 A;  1BP5 A;  4I1D A;  5J1D A;  3CR9 A;  1MY3 A;  4DXC A;  2I49 A;  1S9T A;  3BFU A;  2OJT A;  3R6U A;  2ONR A;  4IB2 A;  4KI0 E;  3SEU A;  5ITP A;  4O3C A;  4JWY A;  3V5A A;  4JWO A;  1IQ7 A;  2BJJ X;  3HV1 A;  4TLL B;  1UTH A;  4EXL A;  3TTM A;  4YKP A;  1IXC A;  4O3A A;  2F97 A;  4GL8 A;  1NNT A;  2I4C A;  2QMX A;  1HSL A;  1MXZ A;  2I3W A;  3PPN A;  3RTW B;  3VVE A;  1DTZ A;  3FIR A;  3OEL A;  4JSD A;  4LAT A;  5A5X B;  4OMB A;  3KOT A;  4N07 A;  4DXU A;  3C31 A;  5KDT B;  1GTK A;  3MPL A;  4LON B;  3BKI B;  5KDT A;  5DVF A;  2DE4 A;  2A5S A;  4DCX A;  1XS5 A;  3RN8 A;  2OWT A;  1PBQ A;  2D3I A;  2PT1 A;  4FJP A;  3ZKL A;  2OCU A;  5IKB A;  3UOR A;  2RKM A;  1EZO A;  1A99 A;  4R6H A;  1JEU A;  1N04 A;  1TWY A;  3A09 A;  5EYF A;  3TCF A;  2O1M A;  3PU5 A;  3GBB A;  4JXI A;  4U4S A;  3TYH A;  4QSD A;  4NWC A;  2XD3 A;  3TCG A;  4KCD A;  4RPN A;  1Y1M A;  1NNK A;  3EHT A;  2R9J A;  4KR5 A;  3RPW A;  3N6U A;  2D5W A;  2ZNU A;  3K4U A;  2I58 A;  4R73 A;  1LAX A;  4IO5 A;  4Q5T A;  5AE4 A;  2ABH A;  3HO7 A;  3W15 C;  4G4P A;  3K1M A;  4TQU Q;  3O6G A;  1VFE A;  1I6A A;  1ZIU A;  4K3F A;  4EUO A;  4G8H A;  4ZEF A;  3RTF B;  4N6P A;  1DTG A;  1M5D A;  4NWD A;  3T9X B;  1B7U A;  3C32 A;  1URG A;  2H25 A;  2QMW A;  3FXU A;  3Q29 A;  4KYS A;  3BBR A;  1FQB A;  1JVY A;  4MBP A;  2A5T A;  2REJ A;  4F3G A;  2Z8F A;  3Q27 A;  3MVZ A;  4JBZ A;  1L5T A;  4OHN A;  1B46 A;  4ESX A;  4OFJ A;  2REG A;  5K2X A;  1VFD A;  3RLF E;  4GL0 A;  4GQO A;  4XKR A;  5FTI A;  3VXB A;  1SDX A;  2VD3 A;  3S9L C;  2Q2A A;  1NKX A;  2GHA A;  1FCK A;  3G3J A;  5CMM A;  3VXC A;  4ELQ A;  1IXG A;  4YB5 A;  3ILT B;  4H67 A;  3MWB A;  5JTY B;  5B7D A;  2O69 A;  4XIG Q;  5CMK A;  3KEI A;  3PMW A;  4M4G A;  1JEV A;  1LFI A;  1H3D A;  4R72 A;  4XKQ A;  3N26 A;  5I59 A;  2Z8E A;  1MH3 A;  1MM6 A;  2F36 A;  3GZG A;  4OTE A;  1XHY A;  4U22 A;  3T9H B;  1A8F A;  4C0R A;  1ELJ A;  3OO9 A;  3IB0 A;  3THI A;  4ZS9 A;  3I6V A;  3C33 A;  1O7T A;  2YPN A;  3MZ1 A;  4G77 A;  4WKM A;  4NE4 A;  1N76 A;  1GVC A;  1TFA A;  1GGG A;  3K1N A;  2XXU A;  3FGS A;  4X1D A;  3TPA A;  4YMB A;  4KQP A;  3SEX A;  1LAG E;  2NXO A;  3CVG A;  1SYH A;  4ZE8 A;  5IAI A;  4IY6 A;  1US4 A;  3EPE A;  3PUY E;  4AQ4 A;  5K2Y A;  1B3H A;  4E0X A;  3GXA A;  4IY5 A;  3TTK A;  2XXI A;  1PB8 A;  2ONS A;  3G3K A;  4BDR A;  2DS9 A;  2X7P A;  1NNP A;  4UA8 A;  2DWJ A;  5I59 B;  1B4H A;  5I2K A;  3KSJ A;  4U2R A;  2WKY A;  3WAF A;  1D4N A;  3FVK A;  3EN3 A;  4X48 A;  5CMB A;  2O1L A;  4GD5 A;  4ZEK A;  1WVJ A;  5I2N B;  1MPC A;  5HPQ A;  3MJN A;  3P7I A;  3PUX E;  3UIF A;  1FQE A;  2XXT A;  1SW5 A;  4FAT A;  1B32 A;  2I0C A;  2XXP A;  3IOT A;  4OYV A;  4XKN A;  3TDJ A;  1MXV A;  1FQD A;  3I3V A;  3G3G A;  5H8Q A;  4RPO A;  4F1Y A;  5CMC A;  4F22 A;  3C35 A;  1SD3 A;  5L8D A;  4ZE9 A;  4ESW A;  1UIU A;  2ALU A;  1MY2 A;  1XVX A;  2QPQ A;  1JQF A;  4FOR A;  5DT6 A;  1AOV A;  2HZK A;  4H5G A;  3H6T A;  1R9Q A;  4U1O A;  3KJ7 A;  1POY 1;  2DOJ A;  2PVU A;  3MAM A;  5KZT A;  2QSX A;  2GFE A;  1LAH E;  4TOZ A;  2DVC A;  3F11 A;  3O9P A;  3S4U A;  4DE8 A;  1DOT A;  3M3F A;  3ZS6 A;  2GHB A;  2QS2 A;  2QS4 A;  2HCA A;  2RC7 A;  4I9D A;  4NED A;  2I6E A;  3ILU B;  4ONY A;  1OQH A;  4RA1 A;  3KZG A;  4PFT A;  3VV5 A;  3K1P A;  3ZSF A;  3JV9 A;  1FTJ A;  2V84 A;  4NMY A;  5L9M A;  2OK2 A;  4LQ2 A;  5CI5 A;  1RYO A;  3FAT A;  1LST A;  3LSX A;  2DWI A;  1XOC A;  4OZ9 A;  5AA4 B;  1S7Y A;  5BWJ A;  3IOV A;  3JYR A;  3PPO A;  5FTH A;  2RIN A;  3QUJ A;  1D9V A;  1LLS A;  3HPI A;  2RF1 A;  5I2K B;  4BDQ A;  4BDL A;  4EDP A;  3K00 A;  5I84 A;  2IA4 A;  2F35 A;  2HQ0 A;  3IOW A;  2ZYN A;  4QHQ A;  2F8D A;  3OOA A;  3RQT A;  1OIB A;  3C34 A;  3H7M A;  3UK4 A;  2CZL A;  4FIM A;  4GVO A;  3SEW A;  4QFN A;  4PE5 B;  1LAF E;  2NUV A;  3W9V A;  2NVU B;  3KGC A;  4KD5 A;  2UYE A;  3OO8 A;  4YU0 A;  3VVF A;  3SKP A;  1B58 A;  4OWD A;  2DQV A;  3PPR A;  3DP8 A;  5ITO A;  4ZZA A;  1MQH A;  3PUZ E;  4P0I A;  3FV1 A;  4LA9 A;  2XXR A;  4IO7 A;  2UVH A;  1NNF A;  3A3C A;  4GXS B;  1JNF A;  1H43 A;  1GR2 A;  1Y3N A;  3N6T A;  4THI A;  3SET A;  3ECR A;  1M5B A;  4PFY A;  4F39 A;  5ICQ A;  3PGF A;  1LBB A;  2NOO A;  3GBA A;  5FHO A;  1GV8 A;  3S9N C;  1B3E A;  2Q88 A;  1MY0 A;  2F78 A;  3B6W A;  4QFK A;  3K6U A;  4DXB A;  2P1S A;  2ZYO A;  4ZEC A;  2Y7R A;  3TEP A;  4Q0C A;  2XXV A;  4F2Q A;  4GWO A;  1NH8 A;  1VR5 A;  3AXF A;  2VOZ A;  2Y7P A;  2XXX A;  3DLN A;  3K6W A;  4I8C A;  4MF3 A;  1B9J A;  3SDF A;  3SEV A;  2I3V A;  4R2B A;  3EHS A;  3QIM A;  2DWH A;  4QFP A;  1B3L A;  3LUY A;  1QJM A;  1N3W A;  2E1S A;  2Y7K A;  3KN7 A;  2QS3 A;  3SES A;  1MQD A;  5L9O A;  1LCT A;  4N13 A;  5ELV A;  2RCA A;  3TZA A;  5H8H A;  1UIV A;  2W7Y A;  3R26 A;  2XD2 A;  2AL4 A;  1B3G A;  3U8Q A;  3K6X A;  3KBR A;  2RC9 A;  4ZZE A;  2UVI A;  1QVS A;  3RY3 A;  4BDM A;  2XX7 A;  3TQW A;  1QW0 A;  1SVX B;  2RCB A;  2ZMB A;  1WDN A;  4RK2 A;  4GRK A;  1XC1 A;  1ATG A;  2O68 A;  4JSO A;  2Q8J A;  2I0B A;  1UQW A;  1LB9 A;  3HHF A;  3ODB A;  3H6U A;  3CFL A;  4EQB A;  1J1N A;  5DTB A;  3PPQ A;  3QAX A;  2FYI A;  2F7C A;  3CFX A;  1OMP A;  3H06 B;  1AMF A;  3OD7 A;  3OEK A;  3U1O A;  3VLV A;  1EZP A;  3PV0 E;  4U21 A;  1OQG A;  1B3F A;  4NF6 B;  3L6H A;  2PYY A;  4O3B A;  1ZU0 A;  4GF8 A;  1LFH A;  3E13 X;  4ND9 A;  5F7V A;  2Y7I A;  1CB6 A;  4PQJ A;  5HBC A;  4F3B A;  1B0L A;  2M8C A;  3L6G A;  2THI A;  2HAV A;  4ELP A;  2E0S A;  1UTB A;  2NWJ A;  5I56 B;  2HEU A;  3T93 B;  3A3U A;  1B0H A;  2DYX A;  3T9V A;  3H6W A;  3FUZ A;  1JW4 A;  3D4C A;  5DEX A;  3KOS A;  1QUI A;  3W9W A;  4IGT A;  1OLA A;  3FJM A;  1Z7N E;  3DEL B;  2Y7W A;  3K0V A;  4FE8 A;  1MXY A;  2VGQ A;  1B1H A;  3K6V A;  4EQ9 A;  3IO6 A;  5JTY A;  4E0W A;  4GFR A;  4HS7 A;  4YB6 A;  1IXH A;  3T96 B;  4BLA A;  4F19 A;  1B5H A;  1VE4 A;  4R9G A;  3CSG A;  5CC2 A;  2O7I A;  5CBS A;  2QL3 A;  3GLB A;  1I69 A;  4KPT A;  1Z7M E;  1NFT A;  2FNC A;  4QRZ A;  4BDO A;  1USY E;  1LBC A;  1F9B A;  2RC8 A;  3M3K A;  4Z0I A;  3N5L A;  1M5E A;  4H8I A;  1P99 A;  2DXY A;  2YJP A;  3B7D A;  3HHG A;  3IB1 A;  1B1X A;  3LC8 A;  3MC2 A;  4RY1 A;  3UA8 A;  4F3S A;  2UVJ A;  4NF5 A;  3DM0 A;  3LSW A;  2ZYM A;  3FXQ A;  1USY H;  1B40 A;  4KHZ E;  4NF5 B;  1MXW A;  4YB7 A;  1SBP A;  4FED A;  4P11 A;  5F1Q A;  3OEN A;  1N7X A;  3E3K A;  4KYE A;  1A7L A;  3FJG A;  4QFL A;  2AYS A;  1AIV A;  4OET A;  1LGB C;  2Q9T A;  4MH5 A;  3K2D A;  3RT6 B;  3V89 B;  4C1U A;  3OXN A;  1SW1 A;  3O2A A;  1B52 A;  1N7W A;  2V3T A;  1YTV A;  1M5F A;  1LCF A;  4GXA A;  1UTH B;  1HSJ A;  2DSF A;  4OQO A;  1Y1Z A;  2F7B A;  3FV2 A;  4ELO A;  1JVX A;  4H8J A;  5DYH A;  4ELR A;  3D4G A;  1URS A;  1IXI A;  2CMO A;  2LAO A;  1FQF A;  1MDP 1;  4DLD A;  5L9S A;  2AL5 A;  4R6Y A;  4AB5 A;  2DP8 A;  4YZZ A;  1H45 A;  1B2H A;  4RNS A;  2ZNT A;  5A5X A;  3PD8 A;  5BUU A;  3G7W A;  1MY4 A;  1P1U A;  4ECF A;  5HM4 B;  5I58 A;  4PFU A;  4R9F A;  2QRY A;  2R71 A;  3IJO B;  3MW0 A;  3EF7 A;  1N84 A;  5TPA A;  3RNN A;  1MQJ A;  1IUD A;  2DWA A;  2F6G A;  2PT2 A;  3O97 A;  3FJ7 A;  4MLV A;  4POW A;  3R7X A;  1OVB A;  1P1N A;  3B6T A;  4C1T A;  3VE1 B;  1Y4T A;  1DMB A;  3QYT A;  3MPK A;  3LSL A;  3K01 A;  4L17 A;  4UAC A;  1LFG A;  4DZ1 A;  3MUQ A;  1A55 A;  4RXL A;  1II5 A;  3H6V A;  5TP9 B;  5AA2 A;  1TFD A;  2ONK E;  1O64 A;  3IX1 A;  4KYD A;  3TEL A;  3VDF A;  4F2O A;  4PET A;  1BIY A;  1A40 A;  4R74 A;  2XXQ A;  4IO3 A;  2ZYK A;  3TQL A;  1TXF A;  5EHM A;  5B70 A;  3UP9 A;  2VP1 A;  1B7Z A;  4QF9 A;  1S50 A;  1DPP A;  1P1O A;  3QUF A;  3JZJ A;  3MZB A;  4FEB A;  3CFZ A;  1XVY A;  4U4X A;  3IO4 A;  5TPA B;  4FAJ A;  1FW0 A;  3DP6 A;  3EQ1 A;  5H8S A;  1CE2 A;  1SYI A;  2OZZ A;  3FVG A;  3Q25 A;  4YKK A;  4H1X A;  1MDQ A;  1H76 A;  1Y9U A;  4F29 A;  2I48 A;  2HFB A;  3TMG A;  3MP8 A;  1AH5 A;  2QS1 A;  4QSE A;  4EF2 A;  2D21 A;  2OLB A;  5H8F B;  4F3P A;  3M3L A;  1ZLQ A;  2R6G E;  1FQC A;  1I6Q A;  2H4I A;  1SI1 A;  2VHA A;  3N94 A;  3ZKK A;  5KCJ A;  1QKB A;  2XXW A;  4QSC A;  5FHN A;  5TU0 A;  5KCJ B;  1RKM A;  3FVO A;  2UVG A;  1ANF A;  1YCJ A;  4NF8 A;  2DE2 A;  4OEV A;  3C9H A;  2P2A A;  3HN0 A;  3RGY A;  4NF8 B;  1YAE A;  3FD3 A;  4RK9 A;  1I6B A;  1SI0 A;  3MVW A;  2DE3 A;  4EXK A;  1MY1 A;  4G68 A;  1M5C A;  1MQG A;  1ZBM A;  1MM7 A;  1PC3 A;  2ZNS A;  3OMB A;  3TUS A;  2Z8D A;  3OO6 A;  3TAJ A;  3MQ9 A;  2X26 A;  5I57 A;  3MBP A;  4JWX A;  3MP6 A;  1R9L A;  3FXR A;  1QKA A;  3E4R A;  5ICT A;  4H0W A;  1B05 A;  2Y84 A;  1PB9 A;  3MP1 A;  4WEP A;  3S9E A;  1FTM A;  3KN8 A;  3PMX A;  4NF4 A;  1Y3P A;  2V3Q A;  5CRY A;  5AA1 A;  2F5X A;  2O51 A;  3CRB A;  3H03 A;  4R2F A;  4BDN A;  5I58 B;  3I5O A;  3O6I A;  5FHM A;  4KFQ A;  4KCC A;  4XKP A;  1JW5 A;  2HAU A;  3IL1 B;  3S2V A;  2B65 A;  4ZDM A;  5AA2 D;  5CM6 A;  2ANJ A;  4XXU A;  2ZXT A;  2A5T B;  3FAS A;  2OBG A;  1P1Q A;  2H5Y A;  2HXW A;  1POT A;  3VVD A;  1IEJ A;  2O84 X;  4QFO A;  3SER A;  3TTR A;  2YLN A;  3VFJ A;  5DVI A;  5I57 B;  1B7H A;  1MPB A;  1BKA A;  1MPD A;  5TP9 A;  3O29 A;  1KWH A;  4LP2 B;  5AA2 B;  5H8F A;  2IEE A;  5I2N A;  1US5 A;  2GH9 A;  3SEY A;  3U72 A;  4F1V A;  1B6H A;  2O7U A;  4TLM B;  5AA3 A;  3G3F A;  3LR1 A;  3CSB A;  4LZ7 A;  4ZEB A;  4MFI A;  3T9U A;  1R6Z A;  2PBW A;  4YMA A;  3U94 A;  3S9M C;  3O28 A;  3TTN A;  3BFT A;  3KN3 A;  4F31 B;  1D9Y A;  3V8X B;  2UYF A;  4M1V A;  4OXV A;  3PMV A;  1SQY A;  1MQI A;  1N0T A;  2X7Q A;  2XX9 A;  3DP4 A;  4F1U A;  3QXM A;  3C4M A;  3KJT A;  4G2Z A;  2XHD A;  4G68 B;  4IO4 A;  1EU8 A;  1P1W A;  1ZMG A;  4IO2 A;  3LBS A;  4X9T A;  4GIZ A;  1O63 A;  4NTL A;  4HW8 A;  3UGW A;  4U23 A;  3OEM A;  5DVJ A; 
#chains in the Genus database with same CATH topology
 3PUV E;  1FPF A;  4OES A;  1FTO A;  3U93 A;  4NG7 A;  5H8Q B;  5H8N B;  2I4B A;  4NGU A;  4ZE8 A;  1Y4C A;  3PUW E;  3O6H A;  3T66 A;  1OLC A;  1MXU A;  1TT1 A;  1YPN A;  4AB6 A;  1NL5 A;  2QJE A;  4OEU A;  2B3F A;  4PP0 A;  5ISU A;  3TCH A;  4EQ7 A;  1PBP A;  1FPG A;  1FTK A;  1AL3 A;  1MH4 A;  1B4Z A;  4POX A;  4G8M A;  3TTL A;  3IB2 A;  4Z7E A;  3K02 A;  1IZ1 A;  2H99 A;  1B5I A;  3IK6 B;  3V83 A;  4ZED A;  2V3U A;  1IIT A;  1VSO A;  2VD2 A;  2P0S A;  1ZTY A;  4YKJ A;  4F18 A;  3Q28 A;  2DVZ A;  2ZZV A;  4OFO A;  4G61 A;  4DDD A;  2G93 A;  4JB7 A;  1UTB B;  5EHS A;  3IAZ A;  3HV1 A;  4EXL A;  3TTM A;  1IXC A;  5LDZ A;  2QMX A;  2I3W A;  2VPO A;  4LAT A;  5A5X B;  4JSD A;  3C31 A;  1RDZ A;  2VPN A;  2R8T A;  3MPL A;  1XS5 A;  2OWT A;  1PBQ A;  2D3I A;  3ZKL A;  2OCU A;  4N8Y A;  1A99 A;  1N04 A;  3A09 A;  3TCF A;  2O1M A;  4U4S A;  2FVZ A;  3TYH A;  1FBD A;  3TCG A;  4KCD A;  1NNK A;  2D5W A;  4Q5T A;  2ABH A;  3W15 C;  4G4P A;  3K1M A;  4P1E A;  4K3F A;  4ZEF A;  1DTG A;  3T9X B;  2H25 A;  1NV7 A;  2A5T A;  4GBW A;  4PDH A;  4PGN A;  5FTI A;  3VXB A;  2VD3 A;  2GHA A;  1FCK A;  3G3J A;  1LBW A;  4XIG Q;  4OAN A;  4M4G A;  1JEV A;  1H3D A;  1MH3 A;  1MM6 A;  3KC0 A;  3GZG A;  3OO9 A;  1GVC A;  3K1N A;  4YMB A;  3TPA A;  3SEX A;  1LAG E;  4IY6 A;  1US4 A;  3FBP A;  3TTK A;  2X7P A;  4U2R A;  2WKY A;  3WAF A;  3FVK A;  1FPE A;  4ZEK A;  3P7I A;  3PUX E;  2XXT A;  1SW5 A;  5J1D A;  1B32 A;  2XXP A;  4OYV A;  1NUY A;  3G3G A;  5H8Q A;  4F1Y A;  4F22 A;  4ESW A;  5DT6 A;  2HZK A;  4HXV A;  2PVU A;  3MAM A;  2QSX A;  4N4U A;  1DOT A;  3M3F A;  3ZS6 A;  2RC7 A;  2QVV A;  4ZE9 A;  3ZSF A;  1OQH A;  2OWZ A;  4PFT A;  3K1P A;  1FTJ A;  4NMY A;  5L9M A;  4LQ2 A;  4GWY A;  1DK4 A;  4XEQ A;  5FTH A;  4BDQ A;  3U65 A;  4EDP A;  3OOA A;  4X8R A;  3UK4 A;  4OVS A;  2CZL A;  2XA5 A;  4NHB A;  2NUV A;  3W9V A;  3VVF A;  1B58 A;  3FV1 A;  2XXR A;  5CM6 A;  4THI A;  5ICQ A;  1NUW A;  1KZ8 A;  4DXB A;  2F78 A;  2P1S A;  4Q0C A;  4F2Q A;  4GWO A;  1NH8 A;  3AXF A;  2VOZ A;  2I3V A;  4O8M A;  3LUY A;  1N3W A;  2Y7K A;  1MQD A;  1LCT A;  4N13 A;  2W7Y A;  3U8Q A;  3K6X A;  1DBZ A;  2OX3 A;  2XX7 A;  2ZMB A;  4GRK A;  3ODB A;  3OEK A;  1OQG A;  4NF6 B;  1CB6 A;  5ET8 A;  2M8C A;  2E0S A;  5I56 B;  1B0H A;  3T9V A;  3H6W A;  2Y7W A;  4FE8 A;  3IO6 A;  5JTY A;  4YB6 A;  3T96 B;  4F19 A;  4R9G A;  3E79 A;  5CC2 A;  2O7I A;  1NFT A;  2PCR A;  4BDO A;  3M3K A;  3B50 A;  2RC8 A;  4Z0I A;  3N5L A;  2YJP A;  3IB1 A;  1B1X A;  3LC8 A;  3UA8 A;  2UVJ A;  3LSW A;  2ZYM A;  4NF5 B;  4KHZ E;  4FED A;  4KYE A;  3V89 B;  2FBP A;  3OXN A;  3O2A A;  1FPK A;  1YTV A;  4PAF A;  1HSJ A;  2DSF A;  1JVX A;  5DYH A;  3D4G A;  2CMO A;  1FQF A;  1MDP 1;  4I3E A;  4DLD A;  4R6Y A;  5L9S A;  1H45 A;  1FPJ A;  2ZNT A;  3PD8 A;  1NUZ A;  5HM4 B;  4PFU A;  2QRY A;  5TPA A;  2VT5 A;  3RNN A;  1MQJ A;  1IUD A;  5I3S A;  1OVB A;  3K01 A;  1A55 A;  1II5 A;  1TFD A;  2ONK E;  4KYD A;  2XXQ A;  3TQL A;  4QF9 A;  1P1O A;  5T3J A;  5H8S A;  4NAP A;  4MX6 A;  2CEY A;  2I48 A;  2QS1 A;  2B4L A;  3M3L A;  2R6G E;  1FQC A;  2H4I A;  1SI1 A;  2VHA A;  5ET5 A;  5KCJ A;  1QKB A;  2F3D A;  3FVO A;  4NF8 A;  4OEV A;  4NF8 B;  3GYY A;  1M5C A;  1MQG A;  1ZBM A;  2HXR A;  3MBP A;  3MP6 A;  5ICT A;  3S9E A;  5CRY A;  2O51 A;  3H03 A;  4BDN A;  4KCC A;  1JW5 A;  4XXU A;  2ZXT A;  2H5Y A;  1NI9 A;  4P1L A;  3SER A;  5TP9 A;  1MPD A;  5I2N A;  2PFY A;  3O29 A;  2IEE A;  3U72 A;  4TLM B;  3G3F A;  1R6Z A;  2PBW A;  3U94 A;  3S9M C;  3TTN A;  3BFT A;  1D9Y A;  3V8X B;  3PMV A;  1MQI A;  2XX9 A;  3DP4 A;  3C4M A;  2XHD A;  4IO2 A;  1ZMG A;  1O63 A;  4QXD A;  3D1R A;  3T0J A;  2XXY A;  1JET A;  4ZEI A;  4WED A;  4WXJ A;  1WOD A;  4NF4 B;  3QSL A;  4X1B A;  1LB8 A;  3HCQ A;  3PPP A;  4O7I A;  3MVX A;  4NF6 A;  2XWK A;  3ONM A;  2HHM A;  4G8N A;  3A29 A;  1IIW A;  4U1Z A;  2AIX A;  2CEX A;  2PX1 A;  1MRP A;  3TKD A;  1EH3 A;  4P3L A;  3Q26 A;  4DIG A;  3OSR A;  3E9X A;  4P0G A;  3IOR A;  1FTL A;  3T22 A;  3OSQ A;  4LUB A;  1A54 A;  2FHY A;  3TOD A;  4Q30 B;  1R1N A;  5I56 A;  2V93 A;  1MXX A;  1LBX A;  4HTG A;  1H44 A;  2O6A A;  1PEB A;  4LVQ A;  4OER A;  2FA7 A;  1NH7 A;  2HZL A;  1FTA A;  4DCY A;  1D3K A;  3KFM A;  3RUM A;  1BTJ A;  3KBZ A;  4ELR A;  1NMU A;  4GWU A;  1XI6 A;  4GOT A;  3IR1 A;  4P8B A;  3WAE A;  1PDA A;  4YKI A;  3B8B A;  3H4Z A;  4LZ5 A;  1XT8 A;  2XX8 A;  3G3I A;  5H8N A;  4EF1 A;  4LZ8 A;  1QUK A;  3O66 A;  1MY3 A;  2I49 A;  4IB2 A;  5ITP A;  4O3C A;  3PTY A;  4JWY A;  2WYP A;  1IQ7 A;  2BJJ X;  4TLL B;  2F97 A;  2I4C A;  1LBZ A;  3PPN A;  1DTZ A;  4OMB A;  4N07 A;  4DXU A;  3BKI B;  5IKB A;  4NX1 A;  2RKM A;  3UOR A;  4R6H A;  3PU5 A;  3CHG A;  4QSD A;  3N6U A;  3K4U A;  2I58 A;  4IO5 A;  1VFE A;  1I6A A;  4QBA A;  4EUO A;  3RTF B;  4NWD A;  2Y5L A;  3Q29 A;  2QMW A;  3FXU A;  1NUX A;  1JVY A;  4MBP A;  4F3G A;  3Q27 A;  3MVZ A;  4HE1 A;  4JBZ A;  1L5T A;  1B46 A;  4ESX A;  4OFJ A;  4GL0 A;  2KR0 A;  3S9L C;  2Q2A A;  1NKX A;  4ELQ A;  2F3B A;  4XFE A;  4H67 A;  5JTY B;  5CMK A;  3RPL A;  3PMW A;  5I59 A;  2Z8E A;  2F36 A;  4OTE A;  1ELJ A;  4ZS9 A;  3I6V A;  3MZ1 A;  4AS5 A;  3EPE A;  3PUY E;  1B3H A;  3GXA A;  1PB8 A;  4BDR A;  1NNP A;  4MEV A;  5CMB A;  1WVJ A;  5I2N B;  1QGX A;  4H46 A;  5HPQ A;  3I3V A;  5L8D A;  1G0I A;  1JQF A;  4FOR A;  1LBV A;  3KJ7 A;  1POY 1;  5EYH A;  1LAH E;  3O9P A;  4I9D A;  4RA1 A;  5CI5 A;  1RYO A;  2WEF A;  3LSX A;  4MNP A;  5AA4 B;  5BWJ A;  3QUJ A;  3HPI A;  2RF1 A;  4BDL A;  3KC1 A;  2IA4 A;  2HQ0 A;  3IOW A;  3RQT A;  3H7M A;  4GVO A;  4QFN A;  4PE5 B;  1LAF E;  4GWW A;  2DDK A;  2Y5K A;  4MHF A;  4ZZA A;  3PUZ E;  4P0I A;  1NNF A;  3A3C A;  1H43 A;  1Y3N A;  4F39 A;  3PGF A;  1LBB A;  2Q88 A;  4ZEC A;  2Y7R A;  1NV5 A;  2XXV A;  1VR5 A;  3K6W A;  1B9J A;  3SEV A;  3EKI A;  3QIM A;  2DWH A;  1B3L A;  3KN7 A;  3SES A;  5ELV A;  1UIV A;  2P3N A;  2AL4 A;  3KBR A;  2RC9 A;  5EQ7 A;  4ZZE A;  1FBH A;  1XC1 A;  1ATG A;  2O68 A;  1LB9 A;  4EQB A;  3PPQ A;  4LN5 A;  2F7C A;  3U1O A;  3L6H A;  4O3B A;  2Y7I A;  4F3B A;  3L6G A;  2THI A;  1UTB A;  3T93 B;  3A3U A;  2DYX A;  2QFL A;  1JW4 A;  5DEX A;  1QUI A;  4IGT A;  3FJM A;  5ET6 A;  3K0V A;  2FIX A;  2VGQ A;  4EQ9 A;  4PF8 A;  4E0W A;  4BLA A;  1B5H A;  2QL3 A;  4KPT A;  2FNC A;  1LBC A;  3HFU A;  1NV6 A;  3B7D A;  4RY1 A;  4F3S A;  3DM0 A;  2WBD A;  4P11 A;  5F1Q A;  1N7X A;  2AYS A;  5EQA A;  4OQO A;  1LCF A;  1UTH B;  1Y1Z A;  4ELO A;  1FPI A;  2L5V A;  2AL5 A;  4AB5 A;  5A5X A;  1MY4 A;  4MNC A;  2R71 A;  3IJO B;  3MW0 A;  3EF7 A;  1N84 A;  1IME A;  2PT2 A;  2F6G A;  1P1N A;  2WX9 A;  3QYT A;  3LSL A;  4RXL A;  5TP9 B;  3VDF A;  4PE3 A;  4PET A;  5B70 A;  2VP1 A;  1DPP A;  3JZJ A;  4U4X A;  4FAJ A;  1XVY A;  1FW0 A;  3DP6 A;  2OZZ A;  4H1X A;  1Y9U A;  4UAB A;  2QVR A;  3N94 A;  2UVG A;  2DE2 A;  3C9H A;  3HN0 A;  3RGY A;  4RK9 A;  1I6B A;  3MVW A;  1PC3 A;  2Z8D A;  1R9L A;  1FRP A;  1PB9 A;  1FTM A;  5AA1 A;  2F5X A;  5I58 B;  5FHM A;  4XKP A;  2HAU A;  2B65 A;  2ANJ A;  1POT A;  1IEJ A;  4QFO A;  2YLN A;  4LP2 B;  5H8F A;  3SEY A;  5AA3 A;  4F1V A;  2O7U A;  3CSB A;  4ZEB A;  3T9U A;  1KA0 A;  2UYF A;  4OXV A;  4F1U A;  1SQY A;  4G2Z A;  4X9T A;  3LBS A;  4N81 A;  4N15 A;  3UGW A;  1MS7 A;  1FSA A;  3U92 A;  1RYX A;  4YIC A;  2UXA A;  2FIE A;  3TFL A;  4FEC A;  3PD9 A;  5CBR A;  1JW1 A;  4PF6 A;  4JVI A;  1K9Y A;  1SW4 A;  1FJ6 A;  4N91 A;  5FBP A;  3QK6 A;  3OO7 A;  3RT8 A;  1A8E A;  1URD A;  2B3B A;  4XTC Q;  1QUL A;  3BIH A;  3FZV A;  5JK4 A;  4IO6 A;  5JEI A;  3VLW A;  3CG1 A;  4LQ5 A;  4MLQ A;  4RYA A;  2F6P A;  4MMP A;  2G29 A;  3G3H A;  2OWS A;  4Q8R A;  1OVT A;  3C36 A;  1ZJL A;  5AA4 A;  3HST A;  4I62 A;  4R6K A;  1FQA A;  3CI8 A;  4I3Y A;  5H8H B;  1PB7 A;  4PFW A;  4H65 A;  4FAT A;  3CG3 A;  4OVQ A;  4ISU A;  4G68 C;  1Y20 A;  2F34 A;  2PMS A;  1Q1K A;  2WBB A;  4IGR A;  2Z22 A;  5EQ8 A;  2XXH A;  4I1D A;  3CR9 A;  4DXC A;  1S9T A;  2OJT A;  4KI0 E;  2XXK A;  3V5A A;  4P9K A;  1UTH A;  4GL8 A;  5IM2 A;  1MXZ A;  3QMF A;  5KDT B;  3KOT A;  1GTK A;  5KDT A;  2DE4 A;  4DCX A;  3FXB A;  1JEU A;  5EYF A;  3GBB A;  1Y1M A;  3EHT A;  2R9J A;  1NV0 A;  4R73 A;  4HE2 A;  3LUZ A;  4TQU Q;  3O6G A;  1ZIU A;  4G8H A;  1URG A;  4KYS A;  3BBR A;  3E78 A;  2Z8F A;  3RLF E;  4XKR A;  1SDX A;  5CMM A;  3VXC A;  5B7D A;  3KEI A;  2XWV A;  4U22 A;  1XHY A;  1EYK A;  4C0R A;  1A8F A;  2YPN A;  4WKM A;  5EQ9 A;  3FGS A;  4X1D A;  4KQP A;  3CVG A;  4DI3 D;  5IAI A;  5ESY A;  5K2Y A;  2XXI A;  2ONS A;  3G3K A;  2DWJ A;  1B4H A;  3EN3 A;  2O1L A;  1MPC A;  4PC9 A;  3MJN A;  1FQE A;  5CMC A;  3C35 A;  1SD3 A;  1UIU A;  2QVU A;  1XVX A;  2QPQ A;  1AOV A;  1IMA A;  4PDD A;  4GBV A;  2ZZX A;  5KZT A;  4TOZ A;  3F11 A;  2HCA A;  3KZG A;  3JV9 A;  4IR8 A;  2OK2 A;  1LST A;  1KA1 A;  2DWI A;  3ROJ A;  1XOC A;  1S7Y A;  4PGP A;  3NOH A;  5I2K B;  2BJI A;  2P3V A;  3K00 A;  5I84 A;  2ZYN A;  4QHQ A;  3C34 A;  5F24 A;  1FPB A;  3SEW A;  3OO8 A;  2XWI A;  4OWD A;  3PPR A;  5ITO A;  5LTC A;  4OET A;  1JNF A;  4PFY A;  4N6K A;  1GV8 A;  5FHO A;  1DCU A;  3TEP A;  4OVP A;  3DLN A;  1LEV A;  4PBQ A;  2Y7P A;  2XXX A;  4I8C A;  4MF3 A;  1RDX A;  4R2B A;  2WYK A;  5IZ1 A;  5H8H A;  3R26 A;  2XD2 A;  4PFB A;  1B3G A;  4BDM A;  1SVX B;  4RK2 A;  2I0B A;  3HHF A;  3QAX A;  3CFX A;  1OMP A;  1EYJ A;  1EZP A;  3PV0 E;  2PYY A;  1ZU0 A;  5IZZ A;  5F7V A;  5HBC A;  4PQJ A;  4MJO A;  3ISP A;  3FUZ A;  3D4C A;  5IZ3 A;  3DEL B;  1MXY A;  3K6V A;  1B1H A;  2PFZ A;  3CSG A;  3GLB A;  1Z7M E;  4QRZ A;  1F9B A;  1M5E A;  4H8I A;  2DXY A;  3HHG A;  3MC2 A;  2CZH A;  4NF5 A;  4PFR A;  3FXQ A;  5IZ3 B;  1B40 A;  4YB7 A;  4QFL A;  3FJG A;  2Q9T A;  4MH5 A;  3K2D A;  3RT6 B;  2V3T A;  1M5F A;  4GXA A;  3FV2 A;  2F7B A;  4H8J A;  1SPI A;  1IXI A;  2LAO A;  2DP8 A;  4RNS A;  1B2H A;  5BUU A;  3G7W A;  1P1U A;  4ECF A;  5I58 A;  2ZZW A;  4P56 A;  4NF0 A;  4N6D A;  5ET7 A;  2DWA A;  1IMF A;  3R7X A;  4C1T A;  3VE1 B;  1Y4T A;  1NV1 A;  3MPK A;  4L17 A;  4DZ1 A;  4UAC A;  1LFG A;  3MUQ A;  5AA2 A;  1O64 A;  3TEL A;  1G0H A;  1TXF A;  1B7Z A;  4OVR A;  3QUF A;  5TPA B;  3CFZ A;  3EQ1 A;  4YKK A;  3FVG A;  3IFA A;  1H76 A;  4QSE A;  4EF2 A;  2D21 A;  2OLB A;  5H8F B;  4F3P A;  1ZLQ A;  2XXW A;  4QSC A;  5KCJ B;  1RKM A;  1ANF A;  1YAE A;  4P47 A;  1FBP A;  1MY1 A;  4G68 A;  2ZNS A;  4JWX A;  3FXR A;  1QKA A;  3E4R A;  4H0W A;  1B05 A;  2Y84 A;  4WEP A;  1Y3P A;  1IMC A;  4R2F A;  3O6I A;  4KFQ A;  2GQ1 A;  1K9Z A;  4N8G A;  5AA2 D;  2A5T B;  3BIG A;  1P1Q A;  3VVD A;  2O84 X;  3TTR A;  3VFJ A;  5DVI A;  1MPB A;  1BKA A;  5IGA A;  4MFI A;  4YMA A;  1FPL A;  1LBY A;  3O28 A;  3KN3 A;  4F31 B;  4M1V A;  1N0T A;  2X7Q A;  1EU8 A;  1P1W A;  4GIZ A;  4NTL A;  5DVJ A;  1Q35 A;  2Z23 A;  1Q9D A;  2JJK A;  1N3X A;  2Q8M A;  3MVY A;  5M2V A;  4JDF A;  3IOU A;  2Q2C A;  4DI4 B;  4OVJ A;  2Q89 A;  2DXR A;  1MG1 A;  4GLI A;  1SW2 A;  2H98 A;  1DPE A;  5LOM A;  3LSF B;  3FVN A;  3KSX A;  4GX4 A;  1B51 A;  2GRV A;  4NQ8 A;  4PCD A;  4R75 A;  4OEN A;  1EZ9 A;  1BLF A;  3EHU A;  3USD A;  2ESN A;  3H3G A;  1QUJ A;  4YAH X;  4HCW A;  3UN6 A;  3IJX B;  4HCY A;  1RDY A;  1Y3Q A;  3VLU A;  1ZKB A;  1FBC A;  2HPG A;  3MYU A;  3M8U A;  2F7A A;  1DSN A;  3CIJ A;  3KG2 A;  2V25 A;  5DEX B;  2H9B A;  3B6Q A;  1HSE A;  4H5F A;  4RJZ A;  1VDW A;  4H6D A;  1B5J A;  4I40 A;  2KLF A;  3MZ9 A;  1T0K A;  4OA4 A;  4OFL A;  1BP5 A;  1YXI A;  1YZ0 A;  3BFU A;  3R6U A;  2ONR A;  3SEU A;  4JWO A;  4YKP A;  4O3A A;  1NNT A;  1IMB A;  1HSL A;  1FBG A;  3RTW B;  3VVE A;  3FIR A;  3OEL A;  3SZP A;  1FJ9 A;  4LON B;  5DVF A;  5J16 A;  2A5S A;  4O94 A;  3RN8 A;  3IFC A;  4FJP A;  2PT1 A;  1EZO A;  1TWY A;  1JP4 A;  4JXI A;  1D9Q A;  4NWC A;  2XD3 A;  4RPN A;  3RPW A;  4KR5 A;  2ZNU A;  1LAX A;  1NV3 A;  5AE4 A;  1INP A;  3HO7 A;  1NV2 A;  4N6P A;  1M5D A;  1B7U A;  3C32 A;  1FQB A;  2REJ A;  4OHN A;  1AWB A;  2REG A;  5K2X A;  1VFD A;  4GQO A;  1IXG A;  4YB5 A;  3ILT B;  3MWB A;  2O69 A;  1LFI A;  4R72 A;  4XKQ A;  3N26 A;  3RPL B;  3T9H B;  4AS4 A;  3IB0 A;  3THI A;  4X04 A;  3C33 A;  1O7T A;  4G77 A;  4NE4 A;  1N76 A;  1TFA A;  1GGG A;  4MIJ A;  2XXU A;  4PAK A;  2NXO A;  1SYH A;  2MKZ A;  4AQ4 A;  4E0X A;  4IY5 A;  1BK4 A;  2DS9 A;  4UA8 A;  5I59 B;  2XWO A;  5I2K A;  3KSJ A;  4NN3 A;  1D4N A;  4X48 A;  4GD5 A;  3UIF A;  2I0C A;  3IOT A;  3TDJ A;  4XKN A;  1MXV A;  1FQD A;  4RPO A;  2ALU A;  3RYD A;  1MY2 A;  4OVT A;  4H5G A;  3H6T A;  1R9Q A;  4U1O A;  2DOJ A;  2GFE A;  3S4U A;  2DVC A;  4DE8 A;  2GHB A;  2QS2 A;  2QS4 A;  4NED A;  2I6E A;  3ILU B;  4ONY A;  3VV5 A;  2Q74 A;  2V84 A;  2CZI A;  3FAT A;  4OZ9 A;  3IOV A;  3JYR A;  3PPO A;  2RIN A;  1D9V A;  1LLS A;  4PBH A;  2F35 A;  2F8D A;  2V4C A;  1OIB A;  4FIM A;  2NVU B;  3KGC A;  4KD5 A;  2UYE A;  4PFI A;  4YU0 A;  3SKP A;  2DQV A;  3DP8 A;  1MQH A;  4LA9 A;  4IO7 A;  2UVH A;  4GXS B;  3SET A;  1GR2 A;  3N6T A;  3ECR A;  1M5B A;  2NOO A;  3GBA A;  3S9N C;  1B3E A;  3B6W A;  1MY0 A;  4QFK A;  3K6U A;  2ZYO A;  4KXP A;  5I5P A;  3SDF A;  3EHS A;  4GWX A;  4QFP A;  1QJM A;  2E1S A;  2QS3 A;  5L9O A;  4PTK A;  2RCA A;  3TZA A;  2UVI A;  1QVS A;  3RY3 A;  3TQW A;  1QW0 A;  2RCB A;  4FBP A;  1WDN A;  4JSO A;  2Q8J A;  1UQW A;  3H6U A;  3CFL A;  1J1N A;  5DTB A;  2FYI A;  3H06 B;  3VLV A;  1AMF A;  3OD7 A;  4U21 A;  1B3F A;  4GF8 A;  1LFH A;  3E13 X;  4ND9 A;  1FBF A;  1B0L A;  4ELP A;  2HAV A;  2NWJ A;  2HEU A;  3KOS A;  3W9W A;  1OLA A;  4JVC A;  4MNI A;  1Z7N E;  3MST A;  4GFR A;  4HS7 A;  1IXH A;  1VE4 A;  5CBS A;  1I69 A;  4HE0 A;  1USY E;  4N17 A;  1P99 A;  4GX6 A;  1USY H;  4MCO A;  1MXW A;  1SBP A;  3OEN A;  3E3K A;  1A7L A;  1AIV A;  1LGB C;  4C1U A;  1SW1 A;  1B52 A;  1N7W A;  4XF5 A;  1URS A;  1YYZ A;  4YZZ A;  4GWZ A;  4R9F A;  3O97 A;  3FJ7 A;  4MLV A;  4POW A;  3B6T A;  1DMB A;  3H6V A;  2B4M A;  4F2O A;  3IX1 A;  1BIY A;  1A40 A;  4R74 A;  4IO3 A;  2ZYK A;  5EHM A;  3UP9 A;  4H45 A;  1S50 A;  5I7I A;  3MZB A;  4FEB A;  1EYI A;  3IO4 A;  1CE2 A;  1FBE A;  1SYI A;  3Q25 A;  1MDQ A;  4F29 A;  4O7M A;  2HFB A;  3TMG A;  3MP8 A;  1AH5 A;  3ZKK A;  1I6Q A;  1FPD A;  5FHN A;  5TU0 A;  1YCJ A;  3T1B A;  2P2A A;  3FD3 A;  1SI0 A;  2DE3 A;  4GWS A;  4EXK A;  3TUS A;  3OMB A;  1MM7 A;  3OO6 A;  3TAJ A;  3MQ9 A;  2X26 A;  5I57 A;  4MAG A;  2CZK A;  3MP1 A;  5EYG A;  3KN8 A;  3PMX A;  4NF4 A;  2V3Q A;  2KQZ A;  3CRB A;  3I5O A;  3LV0 A;  3IL1 B;  3S2V A;  5A5L A;  4ZDM A;  1CNQ A;  3FAS A;  2OBG A;  2HXW A;  4PAI A;  5I57 B;  1B7H A;  5AA2 B;  1KWH A;  1US5 A;  2GH9 A;  1B6H A;  3LR1 A;  1NV4 A;  4LZ7 A;  4JVD A;  4GX3 A;  5DW8 A;  1IMD A;  3QXM A;  3KJT A;  4G68 B;  4IO4 A;  4HW8 A;  4U23 A;  3OEM A; 
#chains in the Genus database with same CATH homology
 3PUV E;  2XXY A;  1JET A;  1Q35 A;  2Z23 A;  1MS7 A;  4OES A;  4ZEI A;  3U92 A;  1RYX A;  1FTO A;  4YIC A;  4WED A;  4WXJ A;  1WOD A;  4NF4 B;  3U93 A;  2UXA A;  5H8Q B;  5H8N B;  3QSL A;  1N3X A;  1LB8 A;  2I4B A;  3HCQ A;  3MVY A;  3PPP A;  4FEC A;  1Y4C A;  4X1B A;  3PD9 A;  3MVX A;  4JDF A;  4NF6 A;  5M2V A;  5CBR A;  3PUW E;  1JW1 A;  2Q2C A;  3IOU A;  3ONM A;  3O6H A;  4OVJ A;  2Q89 A;  2DXR A;  3T66 A;  4G8N A;  1IIW A;  4U1Z A;  1MG1 A;  1OLC A;  2AIX A;  1MXU A;  1TT1 A;  1SW4 A;  1YPN A;  2PX1 A;  4GLI A;  4AB6 A;  1SW2 A;  1NL5 A;  1MRP A;  3TKD A;  2H98 A;  1EH3 A;  2QJE A;  3Q26 A;  4OEU A;  3TFL A;  1DPE A;  2B3F A;  4DIG A;  4PP0 A;  3OSR A;  3E9X A;  3QK6 A;  5LOM A;  3LSF B;  4P0G A;  5ISU A;  3FVN A;  3IOR A;  3KSX A;  3OO7 A;  1FTL A;  3T22 A;  3TCH A;  3RT8 A;  1A8E A;  1B51 A;  2GRV A;  1URD A;  3OSQ A;  2B3B A;  1PBP A;  4LUB A;  1A54 A;  4XTC Q;  1QUL A;  3FZV A;  4EQ7 A;  1FTK A;  1AL3 A;  1MH4 A;  4R75 A;  1B4Z A;  4OEN A;  1EZ9 A;  4POX A;  5JK4 A;  4G8M A;  4IO6 A;  3TOD A;  1BLF A;  3IB2 A;  3TTL A;  3EHU A;  4Q30 B;  4Z7E A;  5JEI A;  5DEX B;  1R1N A;  3K02 A;  3VLW A;  2V93 A;  3CG1 A;  3USD A;  1MXX A;  2ESN A;  1IZ1 A;  3H3G A;  1QUJ A;  2H99 A;  4LQ5 A;  1B5I A;  4YAH X;  4HCW A;  4MLQ A;  3IK6 B;  4RYA A;  3V83 A;  4ZED A;  2F6P A;  2V3U A;  3UN6 A;  4HTG A;  1H44 A;  2O6A A;  1PEB A;  2G29 A;  3G3H A;  1IIT A;  1VSO A;  3IJX B;  4LVQ A;  4OER A;  2FA7 A;  4HCY A;  1NH7 A;  5I56 A;  2OWS A;  2VD2 A;  3VLU A;  1Y3Q A;  4Q8R A;  1OVT A;  2HZL A;  3C36 A;  1ZJL A;  1ZKB A;  2P0S A;  5AA4 A;  3HST A;  4DCY A;  4I62 A;  4R6K A;  1FQA A;  3CI8 A;  1ZTY A;  5H8H B;  4YKJ A;  1PB7 A;  4PFW A;  1D3K A;  3KFM A;  2DVZ A;  2F7A A;  3M8U A;  3Q28 A;  1DSN A;  4F18 A;  3RUM A;  1BTJ A;  4H65 A;  4OFO A;  3CIJ A;  3CG3 A;  2V25 A;  1NMU A;  3KG2 A;  2G93 A;  4DDD A;  4GOT A;  3IR1 A;  4ISU A;  2H9B A;  1UTB B;  3B6Q A;  1HSE A;  1PDA A;  4G68 C;  4H5F A;  4JB7 A;  4RJZ A;  1Y20 A;  3WAE A;  2F34 A;  4H6D A;  1B5J A;  2PMS A;  4YKI A;  5EHS A;  1Q1K A;  3H4Z A;  4LZ5 A;  2KLF A;  1XT8 A;  2XX8 A;  3G3I A;  3MZ9 A;  5H8N A;  1T0K A;  4EF1 A;  3IAZ A;  4IGR A;  2Z22 A;  1QUK A;  4LZ8 A;  4OFL A;  2XXH A;  3O66 A;  1BP5 A;  4I1D A;  5J1D A;  3CR9 A;  1MY3 A;  4DXC A;  2I49 A;  1S9T A;  3BFU A;  2OJT A;  3R6U A;  2ONR A;  4IB2 A;  4KI0 E;  3SEU A;  5ITP A;  4O3C A;  4JWY A;  3V5A A;  4JWO A;  1IQ7 A;  2BJJ X;  3HV1 A;  4TLL B;  1UTH A;  4EXL A;  3TTM A;  4YKP A;  1IXC A;  4O3A A;  2F97 A;  4GL8 A;  1NNT A;  2I4C A;  2QMX A;  1HSL A;  1MXZ A;  2I3W A;  3PPN A;  3RTW B;  3VVE A;  1DTZ A;  3FIR A;  3OEL A;  4JSD A;  4LAT A;  5A5X B;  4OMB A;  3KOT A;  4N07 A;  4DXU A;  3C31 A;  5KDT B;  1GTK A;  3MPL A;  4LON B;  3BKI B;  5KDT A;  5DVF A;  2DE4 A;  2A5S A;  4DCX A;  1XS5 A;  3RN8 A;  2OWT A;  1PBQ A;  2D3I A;  2PT1 A;  4FJP A;  3ZKL A;  2OCU A;  5IKB A;  3UOR A;  2RKM A;  1EZO A;  1A99 A;  4R6H A;  1JEU A;  1N04 A;  1TWY A;  3A09 A;  5EYF A;  3TCF A;  2O1M A;  3PU5 A;  3GBB A;  4JXI A;  4U4S A;  3TYH A;  4QSD A;  4NWC A;  2XD3 A;  3TCG A;  4KCD A;  4RPN A;  1Y1M A;  1NNK A;  3EHT A;  2R9J A;  4KR5 A;  3RPW A;  3N6U A;  2D5W A;  2ZNU A;  3K4U A;  2I58 A;  4R73 A;  1LAX A;  4IO5 A;  4Q5T A;  5AE4 A;  2ABH A;  3HO7 A;  3W15 C;  4G4P A;  3K1M A;  4TQU Q;  3O6G A;  1VFE A;  1I6A A;  1ZIU A;  4K3F A;  4EUO A;  4G8H A;  4ZEF A;  3RTF B;  4N6P A;  1DTG A;  1M5D A;  4NWD A;  3T9X B;  1B7U A;  3C32 A;  1URG A;  2H25 A;  2QMW A;  3FXU A;  3Q29 A;  4KYS A;  3BBR A;  1FQB A;  1JVY A;  4MBP A;  2A5T A;  2REJ A;  4F3G A;  2Z8F A;  3Q27 A;  3MVZ A;  4JBZ A;  1L5T A;  4OHN A;  1B46 A;  4ESX A;  4OFJ A;  2REG A;  5K2X A;  1VFD A;  3RLF E;  4GL0 A;  4GQO A;  4XKR A;  5FTI A;  3VXB A;  1SDX A;  2VD3 A;  3S9L C;  2Q2A A;  1NKX A;  2GHA A;  1FCK A;  3G3J A;  5CMM A;  3VXC A;  4ELQ A;  1IXG A;  4YB5 A;  3ILT B;  4H67 A;  3MWB A;  5JTY B;  5B7D A;  2O69 A;  4XIG Q;  5CMK A;  3KEI A;  3PMW A;  4M4G A;  1JEV A;  1LFI A;  1H3D A;  4R72 A;  4XKQ A;  3N26 A;  5I59 A;  2Z8E A;  1MH3 A;  1MM6 A;  2F36 A;  3GZG A;  4OTE A;  1XHY A;  4U22 A;  3T9H B;  1A8F A;  4C0R A;  1ELJ A;  3OO9 A;  3IB0 A;  3THI A;  4ZS9 A;  3I6V A;  3C33 A;  1O7T A;  2YPN A;  3MZ1 A;  4G77 A;  4WKM A;  4NE4 A;  1N76 A;  1GVC A;  1TFA A;  1GGG A;  3K1N A;  2XXU A;  3FGS A;  4X1D A;  3TPA A;  4YMB A;  4KQP A;  3SEX A;  1LAG E;  2NXO A;  3CVG A;  1SYH A;  4ZE8 A;  5IAI A;  4IY6 A;  1US4 A;  3EPE A;  3PUY E;  4AQ4 A;  5K2Y A;  1B3H A;  4E0X A;  3GXA A;  4IY5 A;  3TTK A;  2XXI A;  1PB8 A;  2ONS A;  3G3K A;  4BDR A;  2DS9 A;  2X7P A;  1NNP A;  4UA8 A;  2DWJ A;  5I59 B;  1B4H A;  5I2K A;  3KSJ A;  4U2R A;  2WKY A;  3WAF A;  1D4N A;  3FVK A;  3EN3 A;  4X48 A;  5CMB A;  2O1L A;  4GD5 A;  4ZEK A;  1WVJ A;  5I2N B;  1MPC A;  5HPQ A;  3MJN A;  3P7I A;  3PUX E;  3UIF A;  1FQE A;  2XXT A;  1SW5 A;  4FAT A;  1B32 A;  2I0C A;  2XXP A;  3IOT A;  4OYV A;  4XKN A;  3TDJ A;  1MXV A;  1FQD A;  3I3V A;  3G3G A;  5H8Q A;  4RPO A;  4F1Y A;  5CMC A;  4F22 A;  3C35 A;  1SD3 A;  5L8D A;  4ZE9 A;  4ESW A;  1UIU A;  2ALU A;  1MY2 A;  1XVX A;  2QPQ A;  1JQF A;  4FOR A;  5DT6 A;  1AOV A;  2HZK A;  4H5G A;  3H6T A;  1R9Q A;  4U1O A;  3KJ7 A;  1POY 1;  2DOJ A;  2PVU A;  3MAM A;  5KZT A;  2QSX A;  2GFE A;  1LAH E;  4TOZ A;  2DVC A;  3F11 A;  3O9P A;  3S4U A;  4DE8 A;  1DOT A;  3M3F A;  3ZS6 A;  2GHB A;  2QS2 A;  2QS4 A;  2HCA A;  2RC7 A;  4I9D A;  4NED A;  2I6E A;  3ILU B;  4ONY A;  1OQH A;  4RA1 A;  3KZG A;  4PFT A;  3VV5 A;  3K1P A;  3ZSF A;  3JV9 A;  1FTJ A;  2V84 A;  4NMY A;  5L9M A;  2OK2 A;  4LQ2 A;  5CI5 A;  1RYO A;  3FAT A;  1LST A;  3LSX A;  2DWI A;  1XOC A;  4OZ9 A;  5AA4 B;  1S7Y A;  5BWJ A;  3IOV A;  3JYR A;  3PPO A;  5FTH A;  2RIN A;  3QUJ A;  1D9V A;  1LLS A;  3HPI A;  2RF1 A;  5I2K B;  4BDQ A;  4BDL A;  4EDP A;  3K00 A;  5I84 A;  2IA4 A;  2F35 A;  2HQ0 A;  3IOW A;  2ZYN A;  4QHQ A;  2F8D A;  3OOA A;  3RQT A;  1OIB A;  3C34 A;  3H7M A;  3UK4 A;  2CZL A;  4FIM A;  4GVO A;  3SEW A;  4QFN A;  4PE5 B;  1LAF E;  2NUV A;  3W9V A;  2NVU B;  3KGC A;  4KD5 A;  2UYE A;  3OO8 A;  4YU0 A;  3VVF A;  3SKP A;  1B58 A;  4OWD A;  2DQV A;  3PPR A;  3DP8 A;  5ITO A;  4ZZA A;  1MQH A;  3PUZ E;  4P0I A;  3FV1 A;  4LA9 A;  2XXR A;  4IO7 A;  2UVH A;  1NNF A;  3A3C A;  4GXS B;  1JNF A;  1H43 A;  1GR2 A;  1Y3N A;  3N6T A;  4THI A;  3SET A;  3ECR A;  1M5B A;  4PFY A;  4F39 A;  5ICQ A;  3PGF A;  1LBB A;  2NOO A;  3GBA A;  5FHO A;  1GV8 A;  3S9N C;  1B3E A;  2Q88 A;  1MY0 A;  2F78 A;  3B6W A;  4QFK A;  3K6U A;  4DXB A;  2P1S A;  2ZYO A;  4ZEC A;  2Y7R A;  3TEP A;  4Q0C A;  2XXV A;  4F2Q A;  4GWO A;  1NH8 A;  1VR5 A;  3AXF A;  2VOZ A;  2Y7P A;  2XXX A;  3DLN A;  3K6W A;  4I8C A;  4MF3 A;  1B9J A;  3SDF A;  3SEV A;  2I3V A;  4R2B A;  3EHS A;  3QIM A;  2DWH A;  4QFP A;  1B3L A;  3LUY A;  1QJM A;  1N3W A;  2E1S A;  2Y7K A;  3KN7 A;  2QS3 A;  3SES A;  1MQD A;  5L9O A;  1LCT A;  4N13 A;  5ELV A;  2RCA A;  3TZA A;  5H8H A;  1UIV A;  2W7Y A;  3R26 A;  2XD2 A;  2AL4 A;  1B3G A;  3U8Q A;  3K6X A;  3KBR A;  2RC9 A;  4ZZE A;  2UVI A;  1QVS A;  3RY3 A;  4BDM A;  2XX7 A;  3TQW A;  1QW0 A;  1SVX B;  2RCB A;  2ZMB A;  1WDN A;  4RK2 A;  4GRK A;  1XC1 A;  1ATG A;  2O68 A;  4JSO A;  2Q8J A;  2I0B A;  1UQW A;  1LB9 A;  3HHF A;  3ODB A;  3H6U A;  3CFL A;  4EQB A;  1J1N A;  5DTB A;  3PPQ A;  3QAX A;  2FYI A;  2F7C A;  3CFX A;  1OMP A;  3H06 B;  1AMF A;  3OD7 A;  3OEK A;  3U1O A;  3VLV A;  1EZP A;  3PV0 E;  4U21 A;  1OQG A;  1B3F A;  4NF6 B;  3L6H A;  2PYY A;  4O3B A;  1ZU0 A;  4GF8 A;  1LFH A;  3E13 X;  4ND9 A;  5F7V A;  2Y7I A;  1CB6 A;  4PQJ A;  5HBC A;  4F3B A;  1B0L A;  2M8C A;  3L6G A;  2THI A;  2HAV A;  4ELP A;  2E0S A;  1UTB A;  2NWJ A;  5I56 B;  2HEU A;  3T93 B;  3A3U A;  1B0H A;  2DYX A;  3T9V A;  3H6W A;  3FUZ A;  1JW4 A;  3D4C A;  5DEX A;  3KOS A;  1QUI A;  3W9W A;  4IGT A;  1OLA A;  3FJM A;  1Z7N E;  3DEL B;  2Y7W A;  3K0V A;  4FE8 A;  1MXY A;  2VGQ A;  1B1H A;  3K6V A;  4EQ9 A;  3IO6 A;  5JTY A;  4E0W A;  4GFR A;  4HS7 A;  4YB6 A;  1IXH A;  3T96 B;  4BLA A;  4F19 A;  1B5H A;  1VE4 A;  4R9G A;  3CSG A;  5CC2 A;  2O7I A;  5CBS A;  2QL3 A;  3GLB A;  1I69 A;  4KPT A;  1Z7M E;  1NFT A;  2FNC A;  4QRZ A;  4BDO A;  1USY E;  1LBC A;  1F9B A;  2RC8 A;  3M3K A;  4Z0I A;  3N5L A;  1M5E A;  4H8I A;  1P99 A;  2DXY A;  2YJP A;  3B7D A;  3HHG A;  3IB1 A;  1B1X A;  3LC8 A;  3MC2 A;  4RY1 A;  3UA8 A;  4F3S A;  2UVJ A;  4NF5 A;  3DM0 A;  3LSW A;  2ZYM A;  3FXQ A;  1USY H;  1B40 A;  4KHZ E;  4NF5 B;  1MXW A;  4YB7 A;  1SBP A;  4FED A;  4P11 A;  5F1Q A;  3OEN A;  1N7X A;  3E3K A;  4KYE A;  1A7L A;  3FJG A;  4QFL A;  2AYS A;  1AIV A;  4OET A;  1LGB C;  2Q9T A;  4MH5 A;  3K2D A;  3RT6 B;  3V89 B;  4C1U A;  3OXN A;  1SW1 A;  3O2A A;  1B52 A;  1N7W A;  2V3T A;  1YTV A;  1M5F A;  1LCF A;  4GXA A;  1UTH B;  1HSJ A;  2DSF A;  4OQO A;  1Y1Z A;  2F7B A;  3FV2 A;  4ELO A;  1JVX A;  4H8J A;  5DYH A;  4ELR A;  3D4G A;  1URS A;  1IXI A;  2CMO A;  2LAO A;  1FQF A;  1MDP 1;  4DLD A;  5L9S A;  2AL5 A;  4R6Y A;  4AB5 A;  2DP8 A;  4YZZ A;  1H45 A;  1B2H A;  4RNS A;  2ZNT A;  5A5X A;  3PD8 A;  5BUU A;  3G7W A;  1MY4 A;  1P1U A;  4ECF A;  5HM4 B;  5I58 A;  4PFU A;  4R9F A;  2QRY A;  2R71 A;  3IJO B;  3MW0 A;  3EF7 A;  1N84 A;  5TPA A;  3RNN A;  1MQJ A;  1IUD A;  2DWA A;  2F6G A;  2PT2 A;  3O97 A;  3FJ7 A;  4MLV A;  4POW A;  3R7X A;  1OVB A;  1P1N A;  3B6T A;  4C1T A;  3VE1 B;  1Y4T A;  1DMB A;  3QYT A;  3MPK A;  3LSL A;  3K01 A;  4L17 A;  4UAC A;  1LFG A;  4DZ1 A;  3MUQ A;  1A55 A;  4RXL A;  1II5 A;  3H6V A;  5TP9 B;  5AA2 A;  1TFD A;  2ONK E;  1O64 A;  3IX1 A;  4KYD A;  3TEL A;  3VDF A;  4F2O A;  4PET A;  1BIY A;  1A40 A;  4R74 A;  2XXQ A;  4IO3 A;  2ZYK A;  3TQL A;  1TXF A;  5EHM A;  5B70 A;  3UP9 A;  2VP1 A;  1B7Z A;  4QF9 A;  1S50 A;  1DPP A;  1P1O A;  3QUF A;  3JZJ A;  3MZB A;  4FEB A;  3CFZ A;  1XVY A;  4U4X A;  3IO4 A;  5TPA B;  4FAJ A;  1FW0 A;  3DP6 A;  3EQ1 A;  5H8S A;  1CE2 A;  1SYI A;  2OZZ A;  3FVG A;  3Q25 A;  4YKK A;  4H1X A;  1MDQ A;  1H76 A;  1Y9U A;  4F29 A;  2I48 A;  2HFB A;  3TMG A;  3MP8 A;  1AH5 A;  2QS1 A;  4QSE A;  4EF2 A;  2D21 A;  2OLB A;  5H8F B;  4F3P A;  3M3L A;  1ZLQ A;  2R6G E;  1FQC A;  1I6Q A;  2H4I A;  1SI1 A;  2VHA A;  3N94 A;  3ZKK A;  5KCJ A;  1QKB A;  2XXW A;  4QSC A;  5FHN A;  5TU0 A;  5KCJ B;  1RKM A;  3FVO A;  2UVG A;  1ANF A;  1YCJ A;  4NF8 A;  2DE2 A;  4OEV A;  3C9H A;  2P2A A;  3HN0 A;  3RGY A;  4NF8 B;  1YAE A;  3FD3 A;  4RK9 A;  1I6B A;  1SI0 A;  3MVW A;  2DE3 A;  4EXK A;  1MY1 A;  4G68 A;  1M5C A;  1MQG A;  1ZBM A;  1MM7 A;  1PC3 A;  2ZNS A;  3OMB A;  3TUS A;  2Z8D A;  3OO6 A;  3TAJ A;  3MQ9 A;  2X26 A;  5I57 A;  3MBP A;  4JWX A;  3MP6 A;  1R9L A;  3FXR A;  1QKA A;  3E4R A;  5ICT A;  4H0W A;  1B05 A;  2Y84 A;  1PB9 A;  3MP1 A;  4WEP A;  3S9E A;  1FTM A;  3KN8 A;  3PMX A;  4NF4 A;  1Y3P A;  2V3Q A;  5CRY A;  5AA1 A;  2F5X A;  2O51 A;  3CRB A;  3H03 A;  4R2F A;  4BDN A;  5I58 B;  3I5O A;  3O6I A;  5FHM A;  4KFQ A;  4KCC A;  4XKP A;  1JW5 A;  2HAU A;  3IL1 B;  3S2V A;  2B65 A;  4ZDM A;  5AA2 D;  5CM6 A;  2ANJ A;  4XXU A;  2ZXT A;  2A5T B;  3FAS A;  2OBG A;  1P1Q A;  2H5Y A;  2HXW A;  1POT A;  3VVD A;  1IEJ A;  2O84 X;  4QFO A;  3SER A;  3TTR A;  2YLN A;  3VFJ A;  5DVI A;  5I57 B;  1B7H A;  1MPB A;  1BKA A;  1MPD A;  5TP9 A;  3O29 A;  1KWH A;  4LP2 B;  5AA2 B;  5H8F A;  2IEE A;  5I2N A;  1US5 A;  2GH9 A;  3SEY A;  3U72 A;  4F1V A;  1B6H A;  2O7U A;  4TLM B;  5AA3 A;  3G3F A;  3LR1 A;  3CSB A;  4LZ7 A;  4ZEB A;  4MFI A;  3T9U A;  1R6Z A;  2PBW A;  4YMA A;  3U94 A;  3S9M C;  3O28 A;  3TTN A;  3BFT A;  3KN3 A;  4F31 B;  1D9Y A;  3V8X B;  2UYF A;  4M1V A;  4OXV A;  3PMV A;  1SQY A;  1MQI A;  1N0T A;  2X7Q A;  2XX9 A;  3DP4 A;  4F1U A;  3QXM A;  3C4M A;  3KJT A;  4G2Z A;  2XHD A;  4G68 B;  4IO4 A;  1EU8 A;  1P1W A;  1ZMG A;  4IO2 A;  3LBS A;  4X9T A;  4GIZ A;  1O63 A;  4NTL A;  4HW8 A;  3UGW A;  4U23 A;  3OEM A;  5DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...