3G3JA

Crystal structure of the glur6 ligand binding domain dimer i442h k494e k665r i749l q753k mutant with glutamate and nacl at 1.32 angstrom resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
255
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTHLGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREEVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKRSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITLAILKLQEEGKLHMMKEKWWRGCPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
total genus 80
structure length 255
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3jA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3jA02
4ZEIA 2XX7A 2DXYA 3U8QA 4EF2A 1KWHA 3O9PA 3TCGA 1ZBMA 4NF6B 4NWCA 1MQGA 4N6PA 4X48A 1US5A 5I57A 2D5WA 5AE4A 4F2QA 1LCTA 1PB8A 1MXYA 2UVJA 5DYHA 3WAEA 5CM6A 4E0WA 2BJJX 3FV2A 3SERA 2DS9A 1XOCA 3PD8A 2QS2A 1B6HA 2IA4A 3IAZA 2Z8EA 2YLNA 1IUDA 2V93A 3MWBA 2O6AA 4HCYA 1WVJA 3V8XB 2DE2A 3IB0A 4X9TA 3SEUA 3JYRA 3T9XB 3QIMA 1FTLA 4RK9A 3H6VA 1B3GA 2GHAA 1B2HA 4LA9A 4RXLA 3S4UA 4POXA 3T9HB 4ZEKA 3LSFB 1H45A 1RKMA 1TFAA 1FQDA 2ALUA 3FJMA 3LUYA 3K1MA 1SDXA 1WDNA 1ZMGA 3Q29A 1UTBA 1B4HA 3PPRA 4KD5A 1H3DA 3FXRA 5B70A 4P11A 2XHDA 2QJEA 5KZTA 1IITA 3EHTA 3Q25A 5J1DA 1NH8A 1QUJA 2DXRA 3PUXE 1LCFA 4QRZA 4PFYA 1UTBB 2XXIA 4ESXA 3G3HA 3HV1A 3EQ1A 3TCHA 4R2FA 4H5FA 3HSTA 4QSEA 2DE3A 4WEDA 5CMBA 3FIRA 4KYEA 4M1VA 2DWAA 4U22A 4F1VA 2W7YA 2V3QA 3TQWA 3HPIA 3U1OA 1QKAA 3K01A 1FW0A 1GR2A 5F7VA 1JEUA 2DOJA 3MVZA 4R6KA 3H6TA 1NNKA 4NF5A 2XXUA 4WKMA 5I2NA 3AXFA 1P1QA 2Z22A 4KFQA 1Y3QA 5CBRA 2DYXA 3VVFA 1A8FA 1PEBA 5CMCA 1OQHA 1IXGA 1FTOA 4OFJA 2A5TB 3DM0A 4HS7A 2Y7KA 5I56A 3HHGA 4NF5B 1I6BA 5I2NB 2XXWA 4Z0IA 1BLFA 2ZYKA 4R73A 1AL3A 1YAEA 2GHBA 3IOUA 2YPNA 1DTZA 3KOSA 3PMVA 4Q0CA 4GL0A 1N0TA 2OWTA 3OSQA 3KN8A 3V5AA 2F7AA 1DOTA 1EU8A 3H6WA 2CMOA 2OLBA 2UVIA 3PPOA 5DVIA 1ZJLA 2ONKE 3HHFA 4N07A 3U94A 2RC9A 4FE8A 4GD5A 3U72A 4BDNA 1YPNA 3ECRA 4KHZE 2I3WA 4ZS9A 3O97A 2Y7RA 3C32A 4XKQA 4XXUA 4F3GA 2I6EA 3FV1A 3K0VA 3UIFA 4F3PA 2XX8A 4F22A 1I6QA 2OWSA 1MXWA 3V89B 3G3IA 4LQ2A 3FVGA 1GGGA 3I5OA 2QS3A 3QSLA 3BBRA 4G77A 4ZDMA 3VLWA 3O6GA 2PBWA 4XKNA 1BKAA 4JWOA 2NWJA 2KLFA 5ITPA 2FA7A 3CFXA 3OO6A 4OERA 3C34A 3OSRA 4KYSA 4QHQA 2E0SA 4JWXA 5AA4B 3KJTA 4LP2B 3LBSA 4JBZA 3A3CA 4XIGQ 2NVUB 3IR1A 1BP5A 1S7YA 3FJ7A 4BDLA 4DZ1A 1LAFE 1UIUA 1WODA 2UVGA 3HO7A 3VXBA 4ELPA 2F6PA 3OEKA 4IO7A 3UORA 2LAOA 4KCCA 4OFOA 3FD3A 3A09A 1B3FA 2O51A 3IO6A 4H8IA 4RYAA 3GLBA 4IY5A 3VDFA 2P1SA 3MVYA 4QSCA 5I57B 3F11A 1MXZA 1N76A 1SQYA 4KPTA 2Y7WA 4FJPA 2GFEA 4U23A 4IGTA 1M5EA 1IQ7A 2NOOA 3PD9A 2H9BA 1LFHA 3C35A 2PT1A 3K6WA 4X1BA 4YKJA 4JDFA 3TZAA 3CSGA 3H7MA 4F1YA 3QXMA 1Y9UA 2HZLA 1LSTA 2H25A 4EUOA 2ZYOA 4IY6A 3LSLA 4F39A 2QS4A 3VFJA 4F31B 4P0IA 3IX1A 3N6TA 4THIA 3S9EA 1B46A 3K1NA 1M5DA 5TP9A 4H65A 2DQVA 2OJTA 4H67A 4YAHX 4WXJA 3UK4A 4JXIA 3OOAA 1S50A 4YB6A 5JEIA 4GXSB 1A54A 1P1UA 2PVUA 2QMWA 4GOTA 4PFWA 4ZEFA 1UTHA 2YJPA 2F78A 3ZSFA 1TXFA 1VE4A 3D4GA 2X7QA 3M3FA 4LQ5A 3SKPA 4C0RA 4YMBA 5I2KA 2DVCA 1B51A 1SW2A 3K6XA 2AIXA 1HSJA 2DWIA 3MAMA 3MZ1A 3QUFA 4QFKA 2HXWA 4U1ZA 3TDJA 3ZS6A 4R9GA 2F35A 1MY1A 3OEMA 4MFIA 3LR1A 1GV8A 3N94A 1XT8A 3OD7A 3K00A 4G68C 5K2YA 5IAIA 1PB7A 3IB2A 2P0SA 4NWDA 1OLAA 2Q2AA 2RCAA 3BFTA 3MP1A 3PUYE 4LONB 1PB9A 1F9BA 5HM4B 4Q30B 5H8HA 3O29A 5BWJA 1QJMA 2UYFA 1MXVA 4MLVA 4LATA 3CVGA 1B32A 5I56B 1B3HA 1ZLQA 3R6UA 3KSJA 1LAHE 2QMXA 4UACA 1D4NA 3SETA 3UGWA 1LAXA 3GZGA 2WKYA 1H76A 1QW0A 3C36A 3A3UA 4LZ5A 3SEXA 5A5XA 3VVEA 1JW1A 1NMUA 4I9DA 4LZ8A 2OCUA 1ATGA 3CFLA 3OO7A 1AMFA 1LFIA 2H5YA 3K4UA 1IIWA 3ODBA 4FIMA 4GLIA 3H06B 3W9VA 4DE8A 5L9MA 3BKIB 4GIZA 4IO4A 2AL5A 4PQJA 4U4XA 1O7TA 3IOVA 3MBPA 4LUBA 3MW0A 1EZ9A 3OENA 1JQFA 2QL3A 1Y1MA 2UYEA 1TWYA 3D4CA 1A99A 4ZEBA 2Y84A 3C4MA 5ITOA 3KJ7A 3RTWB 1J1NA 3E9XA 3FXQA 4HTGA 3IOTA 3TTMA 5L9SA 1FQEA 4JWYA 2H99A 1B40A 4QFNA 4O3AA 5ICTA 3T93B 4ONYA 1MQJA 4F18A 4JSOA 5CI5A 3H03A 4BDQA 3FATA 2I4CA 1RYOA 4C1TA 2XXRA 1XS5A 3L6HA 1QUIA 2RCBA 2XXYA 3G3KA 3TCFA 3O6IA 4AB6A 3MC2A 5AA4A 5ICQA 4QSDA 4R2BA 4BDOA 1B0LA 2VP1A 3QK6A 5DEXA 1B0HA 3E4RA 3KZGA 1SI1A 3K02A 4G4PA 4MH5A 5FTIA 5JK4A 3TMGA 1D3KA 4OFLA 1M5CA 3VE1B 3JV9A 3TODA 4EQ7A 1B5JA 1SYHA 4KR5A 4U4SA 1PBQA 3B6QA 3VLVA 4F2OA 4TLMB 1EZOA 1HSLA 4I1DA 4UA8A 3TTRA 3W15C 5DEXB 1B1HA 2ZMBA 1LB9A 1MPCA 4NEDA 1LLSA 1NH7A 2Q2CA 4G8MA 4OETA 4RPOA 1ZIUA 2IEEA 3H4ZA 2REGA 2FNCA 2ZNTA 3SEWA 2OZZA 1DSNA 4KQPA 2ONSA 1PC3A 4FECA 5CMMA 1FTMA 2XD3A 3TTNA 1IXHA 3MZBA 3DLNA 1Z7NE 3PMXA 3R26A 3CRBA 4YMAA 1LB8A 3K6VA 1SVXB 4R6YA 3TUSA 4RPNA 5TP9B 3GBBA 4POWA 2OBGA 2VD3A 4QFOA 1TT1A 3U93A 5M2VA 3VVDA 4BLAA 3EHSA 1Y4CA 4ZE9A 4ESWA 1A40A 2ZNSA 1QULA 2HEUA 3KFMA 1JVXA 4YKKA 5FHNA 3TYHA 3MPKA 4OXVA 3MP8A 5B7DA 1AH5A 4TLLB 4F1UA 1UTHB 3KGCA 4YKIA 4H0WA 3E3KA 3KOTA 3S9MC 4G8NA 3O2AA 5I2KB 1URSA 4EXKA 4HW8A 3PUZE 4G2ZA 3FVKA 1CE2A 3T66A 3IB1A 1POTA 3SESA 4H8JA 4F3SA 4DCXA 3ZKLA 3RTFB 3FZVA 3WAFA 4RK2A 4DIGA 3TTLA 1NFTA 1NKXA 3SEVA 2HQ0A 2I48A 4YB5A 1A55A 1POY1 1N3WA 2XXXA 3RUMA 2DSFA 2AYSA 4U21A 4I8CA 5H8HB 2Z8DA 2XXHA 2B3FA 4F3BA 1IXCA 4FORA 5AA2A 3PMWA 1DMBA 1FQFA 1PBPA 2B65A 2Y7PA 1MDQA 4YB7A 3FJGA 1OVTA 3TFLA 2UVHA 3G7WA 2FYIA 5AA1A 1MXXA 3RY3A 1DPPA 4O3CA 4Q8RA 3R7XA 5CMKA 2O1MA 3O6HA 5DTBA 1O63A 2D21A 2O7IA 5AA2B 2AL4A 3KSXA 4IO5A 5TPAB 5I84A 3CI8A 1R9QA 1Y3PA 5A5XB 2Z23A 1DPEA 5KDTB 3GBAA 2XXQA 3OXNA 4IGRA 5I58A 2F7CA 1N3XA 3P7IA 1B7UA 1M5BA 1NNPA 2Z8FA 5TPAA 3UP9A 2P2AA 1QKBA 1DTGA 3C33A 3HN0A 4ELQA 1EH3A 3CSBA 4ELRA 5KDTA 3B7DA 1USYH 5CRYA 1SD3A 2A5SA 4ZECA 4ZZEA 4ZEDA 4R75A 2RC7A 2UXAA 1MH4A 4R9FA 1LFGA 4EQ9A 1B9JA 3LSWA 1A7LA 1CB6A 3PV0E 3MVWA 4GF8A 2VOZA 4P0GA 2GRVA 3CIJA 1OVBA 3KEIA 4O3BA 1S9TA 4U2RA 3TKDA 3U92A 3MP6A 4OESA 1N7XA 3PGFA 4G68B 3Q26A 4MF3A 4TOZA 4EDPA 1XHYA 1M5FA 2VD2A 3RT6B 3FASA 3PU5A 1B52A 3CG3A 5FTHA 2Q8JA 5DVFA 5JTYA 1O64A 2ZYNA 4XTCQ 1SW1A 2F97A 4PFUA 3VV5A 2Q9TA 3N26A 4R74A 3RN8A 3W9WA 2ZNUA 4G68A 2VHAA 4ECFA 2G93A 1IZ1A 4LZ7A 1FCKA 2H98A 1ZU0A 3MPLA 1MY2A 1MQDA 3LSXA 4YU0A 5F1QA 5HPQA 1N7WA 1UQWA 4OZ9A 2I3VA 1JEVA 2X26A 4BDRA 1MPDA 2HAUA 2VGQA 1B4ZA 3KG2A 2RINA 1B58A 3TTKA 3N5LA 1OLCA 2RKMA 3C9HA 1II5A 3I6VA 4OVJA 2RC8A 4PP0A 4GFRA 5H8FA 1NL5A 1JETA 2E1SA 4H6DA 1LAGE 3TELA 1MM7A 1NNFA 1JNFA 1USYE 2REJA 1SBPA 4NTLA 4KCDA 2ESNA 4I62A 4PE5B 4FEDA 4LVQA 1TFDA 1H43A 3GXAA 3MJNA 5DT6A 1D9YA 1ZTYA 2Q89A 1ZKBA 3PUWE 4IO3A 1L5TA 4N13A 3TAJA 1OIBA 1P1OA 1AIVA 4F29A 4RA1A 5AA2D 1I6AA 2O69A 4WEPA 5I59A 4MLQA 3I3VA 4HCWA 4JSDA 4ZZAA 1T0KA 1URGA 1ELJA 1JW4A 3HCQA 4AQ4A 3RT8A 3DP8A 4MBPA 3OO8A 4ND9A 3IOWA 2I58A 1D9VA 4GVOA 1XC1A 2DVZA 2F36A 2X7PA 4DXBA 3JZJA 4ISUA 3T9UA 3VXCA 2D3IA 4FAJA 5I59B 1FTKA 4EXLA 3S9NC 3B6WA 5K2XA 1VFDA 2Q88A 3K2DA 1MS7A 2OK2A 4DXCA 1MRPA 4FATA 2H4IA 1BIYA 3IO4A 3H3GA 4IO2A 1FQAA 2QS1A 1B7HA 1SI0A 1Y4TA 1XVXA 3KN3A 2DE4A 3H6UA 2HZKA 5H8NB 2V84A 1Q35A 4YICA 4ELOA 2I0CA 3M3KA 5L9OA 1MM6A 2ABHA 4KYDA 1GVCA 2NUVA 2R6GE 4H5GA 3C31A 3EPEA 1B3LA 2O68A 2XXTA 2R9JA 3FGSA 3IORA 1OQGA 2F6GA 2F8DA 3FVOA 4L17A 4AB5A 5I58B 4QF9A 1FQCA 3PUVE 1RYXA 2V25A 5DVJA 1MY4A 2DP8A 1XVYA 1MG1A 3DP4A 1R6ZA 2XD2A 4PFTA 5FHOA 4C1UA 5AA3A 1HSEA 3S9LC 4QFLA 1FQBA 2THIA 3FVNA 3EHUA 3IJXB 5FHMA 4K3FA 3RLFE 4EQBA 4TQUQ 1PDAA 2DWJA 2F34A 3TPAA 1I69A 1SW5A 4YZZA 2NXOA 3K6UA 3L6GA 4RY1A 3Q28A 5BUUA 4NF8B 1Y1ZA 3S2VA 3EF7A 4GXAA 4OENA 4E0XA 4OYVA 5EYFA 3MUQA 4DCYA 2QSXA 2B3BA 4R6HA 1EZPA 3G3GA 1UIVA 5L8DA 3IJOB 4G8HA 2XX9A 2DWHA 3CFZA 3M8UA 5JTYB 5KCJA 3V83A 4NF8A 1MH3A 4IO6A 1MQIA 4U1OA 3IL1B 1Y3NA 2I49A 3T9VA 4NE4A 4OMBA 3ZKKA 3EN3A 2ZYMA 1H44A 2M8CA 2RF1A 4DXUA 1B1XA 3FUZA 5KCJB 2HCAA 2G29A 1MQHA 1OMPA 3O28A 3MVXA 1A8EA 1B5HA 4Z7EA 1LBCA 3G3JA 5H8QB 3G3FA 1AOVA 4RJZA 2HFBA 2V3TA 1B05A 1P1WA 3IK6B 5ISUA 2XXPA 3OELA 3RGYA 2PYYA 5H8FB 2PT2A 1B3EA 1QUKA 3PPNA 4DLDA 1NNTA 3MQ9A 2I0BA 5H8QA 2CZLA 5TU0A 5LOMA 3THIA 4DDDA 1JVYA 2I4BA 1SYIA 3QYTA 4H1XA 4M4GA 5HBCA 4FEBA 1QVSA 2O7UA 4RNSA 4GRKA 1JW5A 1R1NA 4OHNA 5EHSA 3RQTA 3T22A 5H8SA 3O66A 1N84A 1P1NA 3E13X 3KBRA 4OEUA 2HAVA 1P99A 3ILUB 4IB2A 3MZ9A 3T96B 3RNNA 3N6UA 4BDMA 5IKBA 3UA8A 5CBSA 2F5XA 2A5TA 4OQOA 1B5IA 2GH9A 4F19A 3BFUA 4OEVA 2PX1A 2O1LA 4QFPA 4EF1A 3USDA 1YCJA 4OTEA 5EHMA 1BTJA 1IXIA 1Q1KA 4JB7A 3B6TA 1YTVA 3K1PA 4KI0E 4PETA 3TQLA 1R9LA 2O84X 4XKRA 3RPWA 3M3LA 1FTJA 3UN6A 3OO9A 3DP6A 4Q5TA 3ILTB 2QRYA 1N04A 3PPQA 3CG1A 3DELB 3PPPA 1MPBA 4GQOA 4NMYA 2ZXTA 3KN7A 4ZE8A 1MDP1 1SW4A 1LGBC 1MY0A 1MXUA 1GTKA 3ONMA 2R71A 1ANFA 3SDFA 2Y7IA 5ELVA 1VFEA 5H8NA 4X1DA 2PMSA 3QUJA 1MY3A 4R72A 1LBBA 1URDA 1Y20A 2V3UA 4GL8A 1VR5A 2XXVA 3LC8A 2F7BA 2ONRA 1Z7ME 4NF4B 3VLUA 1US4A 3TEPA 3OMBA 3FXUA 1B7ZA 3QAXA 4NF6A 4YKPA 3SEYA 5CC2A 2QPQA 4NF4A 3Q27A 2ANJA 4XKPA 1IEJA 4OWDA 4GWOA 1VSOA 3CR9A
chains in the Genus database with same CATH superfamily
2DXYA 4NWCA 5I57A 2D5WA 4E0WA 4MMPA 2IA4A 1NUZA 5ET8A 2Z8EA 1IUDA 1WVJA 3JYRA 3QIMA 3T9HB 3LSFB 1H45A 3FJMA 4E0XA 4XF5A 1B4HA 1H3DA 3FXRA 4N8YA 4H45A 4I3EA 5J1DA 3PUXE 4PCDA 5F24A 4ESXA 4R2FA 4H5FA 2L5VA 2DE3A 4KYEA 3U1OA 1JEUA 2DOJA 3MVZA 4NF5A 5I2NA 3AXFA 1Y3QA 4PAKA 2JJKA 1A8FA 1FTOA 3KC1A 4PC9A 3HHGA 4NF5B 5I2NB 4Z0IA 1BLFA 1YAEA 4Q0CA 3V5AA 1N0TA 2OWTA 2BJIA 1NV7A 3PPOA 4N07A 1YPNA 4KHZE 2I3WA 3C32A 4F3GA 2I6EA 4F3PA 4F22A 1I6QA 2KLFA 5I7IA 4LP2B 3A3CA 2WYKA 3VXBA 2F6PA 2LAOA 4KCCA 1FPLA 1SPIA 2WBBA 4QSCA 5A5LA 1YYZA 1MXZA 1N76A 4GBVA 2Y7WA 2GFEA 2NOOA 3K6WA 4JDFA 3H7MA 1Y9UA 4F31B 2H25A 4DI4B 2QS4A 3VFJA 4P0IA 1NI9A 3S9EA 4H65A 4YAHX 3OOAA 4PFWA 2QFLA 4C0RA 5I2KA 2PFYA 1B51A 2F35A 3OEMA 3LR1A 3N94A 1XT8A 3K00A 1PB7A 3PUYE 2XWVA 5H8HA 4N15A 1LAXA 3A3UA 5A5XA 1FJ6A 3CFLA 3OO7A 3K4UA 3W9VA 5L9MA 1O7TA 4OVPA 4LUBA 1EZ9A 1JQFA 4P8BA 5ITOA 2Y84A 3RTWB 3TTMA 2H99A 5ICTA 1NUYA 4ONYA 4NGUA 4JSOA 4C1TA 2XXRA 3TCFA 5LDZA 4R2BA 5DEXA 3KZGA 3TMGA 1D3KA 1B5JA 4F2OA 1EZOA 1PBQA 4UA8A 3W15C 3TTRA 5DW8A 1B1HA 1MPCA 4OETA 2IEEA 4PBHA 3SEWA 4KQPA 1PC3A 2XD3A 3K6VA 4R6YA 5TP9B 3GBBA 4POWA 2OBGA 1TT1A 2HEUA 5FHNA 5B7DA 1AH5A 3KGCA 1NV4A 1FBCA 3PUZE 1POTA 3SESA 4F3SA 4DCXA 3ZKLA 1FBPA 4PFBA 1POY1 4OANA 2AYSA 4MNCA 2Z8DA 2B3FA 4F3BA 1IXCA 4YB7A 1MDQA 3G7WA 2O1MA 2AL4A 3KSXA 5TPAB 3PTYA 5I84A 1R9QA 5KDTB 2OX3A 5I58A 3P7IA 1M5BA 5TPAA 1QKBA 1DTGA 3HN0A 5KDTA 3FBPA 1USYH 5CRYA 1SD3A 2A5SA 4GX3A 4ZECA 4R75A 2RC7A 1MH4A 1LFGA 3PV0E 2GRVA 3MSTA 4U2RA 4XEQA 1XHYA 1M5FA 2VD2A 5JTYA 1SW1A 4R74A 3RN8A 2G93A 1IZ1A 1FCKA 4PE3A 1ZU0A 5J16A 1N7WA 2I3VA 2HAUA 3KG2A 3B8BA 3N5LA 1II5A 4GFRA 1NL5A 4N81A 4H6DA 4NTLA 4KCDA 2CEXA 4PE5B 1TFDA 5DT6A 1D9YA 1LBXA 3TAJA 1AIVA 2O69A 2Q74A 1ELJA 2CZIA 4AQ4A 3RT8A 1RDXA 2F36A 3T9UA 4PAIA 1FTKA 4EXLA 1VFDA 2Q88A 3K2DA 2OK2A 1MRPA 4FATA 3IO4A 1B7HA 5FBPA 2DE4A 2HZKA 5H8NB 5I5PA 1MM6A 3QMFA 2R6GE 2XXTA 3IORA 2F8DA 1NV2A 3PUVE 1RYXA 1MG1A 1R6ZA 2XD2A 3RLFE 1NV1A 2DWJA 4YZZA 3S2VA 4OYVA 4R6HA 1EZPA 3G3GA 4G8HA 3M8UA 4NF8A 1MH3A 3IL1B 1Y3NA 1DBZA 3T9VA 4NE4A 4OMBA 2ZYMA 2RF1A 1LEVA 3FUZA 2G29A 1MQHA 1OMPA 1LBCA 4OA4A 2XWIA 4RJZA 2V3TA 1B05A 1P1WA 5ISUA 3OELA 2PT2A 1QUKA 1FPIA 3ISPA 1NNTA 5TU0A 3QYTA 4H1XA 2O7UA 4MCOA 1R1NA 3IFAA 5H8SA 1DK4A 3T96B 3RNNA 1IMCA 1G0HA 4OQOA 4XFEA 3BFUA 2O1LA 1Q1KA 3UN6A 3M3LA 1FTJA 2HPGA 2QRYA 3DELB 1MPBA 3T1BA 5IM2A 3ONMA 1EYIA 1ANFA 2Y7IA 1VFEA 2ONRA 4NF4B 3VLUA 3QAXA 4XKPA 4N6DA 4GWOA 3SEVA 1QVSA 2XX7A 3O9PA 4UABA 1ZBMA 4F2QA 1LCTA 1FJ9A 2BJJX 2DS9A 1B6HA 2YLNA 4HCYA 3D1RA 2Y5LA 3IB0A 3SEUA 2ZZVA 1FTLA 1B3GA 3S4UA 1B2HA 4RXLA 4POXA 4ZEKA 1TFAA 2ALUA 1ZMGA 3Q29A 2QJEA 3EHTA 3Q25A 1UTBB 3G3HA 5EQ8A 5CMBA 4U22A 3TQWA 1FW0A 5F7VA 1NNKA 1P1QA 1Q9DA 2Z22A 3VVFA 1PEBA 1IXGA 2A5TB 3EKIA 4HS7A 2Y7KA 2XXWA 2ZYKA 4R73A 4PAFA 2GHBA 2YPNA 1DTZA 2F7AA 1DOTA 2OWZA 1LBZA 2OLBA 3U94A 2RC9A 4FE8A 1FBHA 3ECRA 4XKQA 3FV1A 2XX8A 3RPLB 3V89B 3FVGA 1GGGA 4NHBA 4ZDMA 3O6GA 2PBWA 4XKNA 2NWJA 5ITPA 4OERA 4NAPA 5AA4B 3IR1A 1LAFE 4GWSA 3OEKA 4PDDA 4WKMA 3A09A 1B3FA 5I57B 1SQYA 4FJPA 4OVTA 1M5EA 1IQ7A 4MJOA 2H9BA 1LFHA 3TZAA 4X1BA 4YKJA 3CSGA 3E79A 1LSTA 3N6TA 2DQVA 4H67A 4WXJA 2PVUA 2YJPA 1VE4A 3D4GA 4LQ5A 3SKPA 3QUFA 2DWIA 2QVRA 4NX1A 4R9GA 1MY1A 5EYHA 2P0SA 3MP1A 1F9BA 3O29A 5BWJA 1MXVA 3CVGA 1ZLQA 3SETA 1H76A 1QW0A 4LZ5A 3VVEA 1ATGA 1LFIA 1AMFA 3ODBA 3H06B 4GIZA 4IO4A 4U4XA 3OENA 3C4MA 3KJ7A 4GX4A 2QVVA 4QFNA 4O3AA 1MQJA 5CI5A 5LTCA 3FATA 2I4CA 4PGNA 3L6HA 1QUIA 3G3KA 4AB6A 3O6IA 3MC2A 4BDOA 2VP1A 1B0HA 1M5CA 3TODA 1SYHA 3VLVA 4TLMB 1LB9A 2Q2CA 3H4ZA 2REGA 4MHFA 4FECA 5CMMA 3TTNA 1IXHA 3DLNA 3R26A 4YMAA 1LB8A 4BLAA 3VVDA 1Y4CA 1A40A 2ZNSA 4GBWA 4YKIA 3E3KA 3KOTA 3S9MC 5I2KB 4G2ZA 4X04A 1CE2A 3T66A 3WAFA 2VT5A 1NFTA 1NKXA 4YB5A 1A55A 2XXHA 5AA2A 4FORA 3T0JA 3RYDA 1DMBA 4P1LA 1OVTA 2FYIA 5AA1A 1MXXA 3RY3A 5CMKA 5DTBA 3O6HA 1O63A 2D21A 5AA2B 1Y3PA 3GBAA 2XXQA 3OXNA 1B7UA 2P3NA 4X8RA 3UP9A 3C33A 3CSBA 3B7DA 4ZEDA 2UXAA 1A7LA 4P0GA 1XI6A 1OVBA 3KEIA 4O3BA 3MP6A 4OESA 4GWXA 4EDPA 3FASA 3CG3A 5FTHA 4XTCQ 2ZYNA 4PFUA 1VDWA 3N26A 3NOHA 2ZNUA 4ECFA 1RDYA 2H98A 4N91A 5HPQA 1UQWA 4OZ9A 1JEVA 2X26A 1MPDA 2WEFA 3I6VA 2RC8A 3TELA 1KA1A 1MM7A 1JNFA 2REJA 1SBPA 4FEDA 1H43A 3MJNA 4N13A 3U65A 1OIBA 5IZZA 4F29A 5AA2D 3I3VA 4ZZAA 3DP8A 4ND9A 3OO8A 2B4MA 1BK4A 1XC1A 4O7IA 4ISUA 2D3IA 5I59B 3S9NC 3B6WA 4DI3D 1MS7A 2GQ1A 2H4IA 1SI0A 2V84A 2FVZA 2ABHA 1GVCA 3EPEA 1B3LA 1OQGA 3CHGA 4AB5A 4QF9A 1FQCA 2FIEA 2DP8A 1XVYA 3DP4A 4PFTA 2VPNA 4C1UA 3S9LC 4QFLA 3IJXB 1PDAA 3TPAA 1I69A 2HHMA 4NF8B 3EF7A 4GXAA 3MUQA 4DCYA 2QSXA 5JTYB 3CFZA 1MQIA 1H44A 1IMAA 3O28A 4Z7EA 2HFBA 4N4UA 1B3EA 5ET7A 2I0BA 2CZLA 4DDDA 2I4BA 4RNSA 3T22A 4N17A 1P1NA 3KBRA 2HAVA 1P99A 3N6UA 3UA8A 5CBSA 2F5XA 4OEVA 3USDA 1IMFA 4JB7A 1YTVA 4KI0E 1R9LA 4XKRA 2WBDA 3PPPA 4GQOA 1N04A 2WYPA 2ZXTA 3KN7A 1SW4A 1LGBC 4P9KA 5H8NA 3QUJA 5T3JA 4R72A 1URDA 2V3UA 2F7BA 1Z7ME 3OMBA 4JVDA 4YKPA 3Q27A 1IEJA 4ZEIA 3U8QA 1FBEA 1NV3A 1KWHA 4N6PA 4X48A 5AE4A 5CM6A 1MXYA 2UVJA 3WAEA 3FV2A 3SERA 1XOCA 3PD8A 2QS2A 1FPGA 2O6AA 4RK9A 3H6VA 2GHAA 4LA9A 4N8GA 1K9YA 3LUYA 1FQDA 1SDXA 1UTBA 3PPRA 1IMEA 2XXKA 4P11A 1YZ0A 2XHDA 5KZTA 1IITA 1NH8A 1QUJA 4QRZA 4PFYA 3EQ1A 4QSEA 3FIRA 2DWAA 1FSAA 2V3QA 3HPIA 4R6KA 3H6TA 2XXUA 1VSOA 5EQ9A 2DYXA 5CMCA 3DM0A 5I56A 3BIGA 3IOUA 3PMVA 3H6WA 1EU8A 1ZJLA 2CZKA 3HHFA 4GD5A 3U72A 2Y7RA 4AS5A 4KXPA 2OWSA 1MXWA 3G3IA 3VLWA 3QSLA 2QS3A 4JWOA 2FA7A 3OO6A 3C34A 3OSRA 4KYSA 4QHQA 3KJTA 2NVUB 4BDLA 1BP5A 1UIUA 3HO7A 1KA0A 3FD3A 4H8IA 3IO6A 4RYAA 5IZ3B 2FHYA 4NN3A 2CZHA 4U23A 3C35A 4HE0A 4F1YA 4EUOA 4F39A 2ZYOA 3IX1A 3K1NA 4MX6A 1A54A 1P1UA 2QMWA 1UTHA 3ZSFA 4YMBA 3B50A 2DVCA 1SW2A 4QFKA 3R7XA 3MAMA 2HXWA 3ZS6A 1GV8A 5EQ7A 4G68C 3HFUA 3IB2A 1OLAA 2RCAA 4LONB 1K9ZA 1PB9A 4Q30B 4MLVA 1B3HA 3R6UA 2QMXA 4UACA 2WKYA 3SEXA 4JVIA 1JW1A 1NMUA 2XWKA 4FIMA 1IIWA 4DE8A 3BKIB 3IOVA 3MBPA 3D4CA 2QL3A 1TWYA 1A99A 4ZEBA 1J1NA 3E9XA 1FQEA 4JWYA 3T93B 4F18A 4BDQA 1RYOA 1FPFA 2XXYA 5AA4A 4QSDA 4G4PA 1SI1A 5JK4A 3VE1B 2KQZA 4I1DA 1DSNA 2ONSA 3MZBA 3PMXA 2VPOA 3A29A 2VD3A 4NG7A 5M2VA 4ZE9A 4ESWA 4YKKA 3KFMA 1D9QA 3MPKA 4OXVA 1FBDA 3MP8A 4MNPA 4F1UA 1URSA 4HW8A 3IB1A 3RTFB 3FZVA 4RK2A 4DIGA 3TTLA 2CEYA 2I48A 2XXXA 3RUMA 2KR0A 4U21A 5H8HB 3PMWA 1PBPA 1FQFA 3TFLA 3FJGA 2UVHA 1DPPA 4O3CA 4Q8RA 2O7IA 4IO5A 3CI8A 1JP4A 4IGRA 1NNPA 2Z8FA 5ET5A 4HE1A 4ELRA 1EH3A 1B9JA 3LSWA 1CB6A 3MVWA 4GF8A 2VOZA 1FPKA 1S9TA 3TKDA 3U92A 4HXVA 1N7XA 3Q26A 4JVCA 2Q8JA 5DVFA 2F97A 2Q9TA 4G68A 2VHAA 1NV5A 4LZ7A 4QXDA 3LSXA 4YU0A 4BDRA 2VGQA 1B4ZA 2RINA 1B58A 1OLCA 2RKMA 4OVJA 5H8FA 1JETA 1LAGE 3LUZA 4LVQA 4FBPA 1ZTYA 3PUWE 1ZKBA 4IO3A 1L5TA 1P1OA 5I59A 4HCWA 4JSDA 1URGA 1KZ8A 1JW4A 3HCQA 3IOWA 2I58A 4DXBA 1DCUA 1AWBA 1FRPA 1BIYA 2QS1A 1XVXA 3KN3A 3H6UA 1Q35A 3LV0A 3M3KA 4NF0A 4KYDA 4H5GA 5EYGA 2F6GA 3FVOA 4L17A 5I58B 1MY4A 1YXIA 5FHOA 1NV0A 2THIA 3EHUA 5FHMA 4K3FA 4EQBA 4TQUQ 2F34A 3K6UA 3L6GA 4RY1A 3Q28A 5EYFA 2B3BA 2XWOA 4PGPA 5L8DA 1UIVA 4AS4A 3V83A 4H46A 4IO6A 4U1OA 2F3BA 3ZKKA 3EN3A 4DXUA 2HCAA 2B4LA 1A8EA 3G3JA 4IR8A 4O8MA 5H8QB 1AOVA 3IK6B 2XXPA 2PYYA 5H8QA 1SYIA 4M4GA 4OHNA 3RQTA 3KC0A 1N84A 3E13X 3MZ9A 4PF6A 1B5IA 2ZZWA 1RDZA 2PX1A 4EF1A 4QFPA 1YCJA 5EHMA 1IXIA 3B6TA 3K1PA 3TQLA 4P1EA 3OO9A 3DP6A 4Q5TA 3ILTB 3GYYA 3U93A 4ZE8A 1MY0A 1MXUA 3MYUA 5ELVA 3RPLA 2PMSA 4X1DA 4GL8A 3LC8A 4GWUA 3TEPA 1B7ZA 4NF6A 4EF2A 3TCGA 4NF6B 1MQGA 4PF8A 1US5A 1PB8A 5DYHA 1FBFA 3IAZA 2V93A 3MWBA 3V8XB 2DE2A 4X9TA 3T9XB 1FTAA 4LN5A 4OVRA 1RKMA 4KD5A 3K1MA 1WDNA 5B70A 2Q8MA 1FPDA 2DXRA 1LCFA 2XXIA 3HV1A 3TCHA 3HSTA 4WEDA 4M1VA 4F1VA 2W7YA 5IZ1A 1QKAA 3K01A 1GR2A 4P3LA 4KFQA 5CBRA 1OQHA 4OFJA 1I6BA 1AL3A 3KOSA 5A5XB 4GL0A 3OSQA 3KN8A 2CMOA 2UVIA 5DVIA 2ONKE 1LBWA 4BDNA 4ZS9A 3O97A 4XXUA 3UIFA 3K0VA 4GWZA 4LQ2A 2XA5A 3I5OA 4G77A 3BBRA 1BKAA 3CFXA 4P56A 2E0SA 4JWXA 3LBSA 4JBZA 4XIGQ 1S7YA 3FJ7A 4DZ1A 1WODA 2UVGA 4ELPA 4IO7A 3UORA 4MIJA 4OFOA 2O51A 3VDFA 3GLBA 4IY5A 2P1SA 3MVYA 3F11A 1NUWA 4KPTA 4IGTA 1NUXA 3PD9A 2PT1A 3QXMA 2HZLA 1LBVA 4IY6A 2F3DA 3LSLA 4THIA 1B46A 1M5DA 5TP9A 2OJTA 3UK4A 4JXIA 1S50A 4YB6A 5JEIA 4GXSB 4GOTA 4ZEFA 2F78A 1TXFA 3M3FA 2X7QA 3MZ1A 3K6XA 2AIXA 1HSJA 3TDJA 4U1ZA 4MFIA 3OD7A 5IAIA 5K2YA 2HXRA 4NWDA 2Q2AA 3BFTA 5HM4B 1QJMA 2UYFA 4LATA 4I3YA 1B32A 5I56B 3KSJA 1LAHE 3UGWA 1D4NA 3GZGA 3C36A 4I9DA 4LZ8A 2OCUA 2H5YA 4GLIA 2AL5A 4PQJA 3CR9A 3FXBA 3MW0A 2UYEA 1Y1MA 3FXQA 4HTGA 3IOTA 5L9SA 5ESYA 1B40A 2V4CA 3H03A 4PBQA 1XS5A 2RCBA 5ICQA 1B0LA 3QK6A 2ZZXA 3E4RA 3K02A 3BIHA 4MH5A 4G61A 5FTIA 4OFLA 3JV9A 4EQ7A 4U4SA 4KR5A 4QBAA 3B6QA 1EYKA 1HSLA 5IZ3A 5DEXB 2ZMBA 4NEDA 1LLSA 1NH7A 4G8MA 4OVQA 4RPOA 1ZIUA 2FNCA 2ZNTA 4GX6A 2OZZA 1IMBA 1FTMA 1Z7NE 3CRBA 1SVXB 3TUSA 4RPNA 4OVSA 5EQAA 4QFOA 1FPJA 3EHSA 1QULA 1JVXA 3TYHA 4TLLB 1UTHB 4H0WA 4G8NA 3O2AA 4EXKA 3FVKA 1QGXA 4H8JA 4O7MA 2HQ0A 3SZPA 1N3WA 2DSFA 4I8CA 1IMDA 2B65A 2Y7PA 2Z23A 1DPEA 2F7CA 1N3XA 4N6KA 2P2AA 4ELQA 3ROJA 4ZZEA 4R9FA 4EQ9A 3CIJA 3PGFA 4G68B 4TOZA 4MF3A 3RT6B 3PU5A 1B52A 5ET6A 1O64A 3VV5A 4P47A 3W9WA 3MPLA 1MY2A 1MQDA 5F1QA 2Y5KA 2MKZA 3TTKA 3C9HA 4PP0A 2E1SA 4I40A 1NNFA 1USYE 2ESNA 4I62A 3GXAA 2Q89A 4GWWA 4RA1A 1I6AA 4WEPA 1T0KA 4MLQA 4MBPA 1D9VA 4GVOA 2DVZA 2X7PA 3JZJA 3E78A 3VXCA 4FAJA 4HE2A 5K2XA 4DXCA 1CNQA 3H3GA 4IO2A 1FQAA 1NV6A 1Y4TA 2FIXA 4MEVA 4YICA 4PFRA 4ELOA 2I0CA 1FPEA 2NUVA 3C31A 2O68A 1INPA 2R9JA 3FGSA 2V25A 5DVJA 4PTKA 5AA3A 1HSEA 1FQBA 3FVNA 4NQ8A 4GWYA 1SW5A 2NXOA 5BUUA 5IGAA 1Y1ZA 4OENA 2R8TA 4MAGA 3IJOB 2XX9A 2DWHA 5KCJA 2FBPA 2I49A 2M8CA 2QVUA 1B1XA 5KCJB 5I3SA 3MVXA 1B5HA 4MNIA 3G3FA 3RGYA 5H8FB 1G0IA 3PPNA 4DLDA 4O94A 3MQ9A 5LOMA 3THIA 1JVYA 5HBCA 2PCRA 4FEBA 4GRKA 1FPBA 1JW5A 5EHSA 3O66A 2WX9A 4OEUA 3ILUB 2DDKA 4IB2A 5IKBA 4BDMA 2A5TA 2GH9A 4PDHA 4F19A 5L9OA 4OTEA 1BTJA 4PETA 2O84X 3RPWA 3PPQA 3CG1A 4NMYA 1MDP1 2P3VA 1GTKA 2R71A 3SDFA 1LBYA 1FBGA 1MY3A 1LBBA 1Y20A 1VR5A 2XXVA 3KBZA 1US4A 2PFZA 3FXUA 3SEYA 5CC2A 2QPQA 2ANJA 4OWDA 4PFIA 1EYJA 3IFCA 4NF4A
chains in the Genus database with same CATH topology
4ZEIA 2XX7A 2DXYA 3U8QA 4EF2A 1KWHA 3O9PA 3TCGA 1ZBMA 4NF6B 4NWCA 1MQGA 4N6PA 4X48A 1US5A 5I57A 2D5WA 5AE4A 4F2QA 1LCTA 1PB8A 1MXYA 2UVJA 5DYHA 3WAEA 5CM6A 4E0WA 2BJJX 3FV2A 3SERA 2DS9A 1XOCA 3PD8A 2QS2A 1B6HA 2IA4A 3IAZA 2Z8EA 2YLNA 1IUDA 2V93A 3MWBA 2O6AA 4HCYA 1WVJA 3V8XB 2DE2A 3IB0A 4X9TA 3SEUA 3JYRA 3T9XB 3QIMA 1FTLA 4RK9A 3H6VA 1B3GA 2GHAA 1B2HA 4LA9A 4RXLA 3S4UA 4POXA 3T9HB 4ZEKA 3LSFB 1H45A 1RKMA 1TFAA 1FQDA 2ALUA 3FJMA 3LUYA 3K1MA 1SDXA 1WDNA 1ZMGA 3Q29A 1UTBA 1B4HA 3PPRA 4KD5A 1H3DA 3FXRA 5B70A 4P11A 2XHDA 2QJEA 5KZTA 1IITA 3EHTA 3Q25A 5J1DA 1NH8A 1QUJA 2DXRA 3PUXE 1LCFA 4QRZA 4PFYA 1UTBB 2XXIA 4ESXA 3G3HA 3HV1A 3EQ1A 3TCHA 4R2FA 4H5FA 3HSTA 4QSEA 2DE3A 4WEDA 5CMBA 3FIRA 4KYEA 4M1VA 2DWAA 4U22A 4F1VA 2W7YA 2V3QA 3TQWA 3HPIA 3U1OA 1QKAA 3K01A 1FW0A 1GR2A 5F7VA 1JEUA 2DOJA 3MVZA 4R6KA 3H6TA 1NNKA 4NF5A 2XXUA 4WKMA 5I2NA 3AXFA 1P1QA 2Z22A 4KFQA 1Y3QA 5CBRA 2DYXA 3VVFA 1A8FA 1PEBA 5CMCA 1OQHA 1IXGA 1FTOA 4OFJA 2A5TB 3DM0A 4HS7A 2Y7KA 5I56A 3HHGA 4NF5B 1I6BA 5I2NB 2XXWA 4Z0IA 1BLFA 2ZYKA 4R73A 1AL3A 1YAEA 2GHBA 3IOUA 2YPNA 1DTZA 3KOSA 3PMVA 4Q0CA 4GL0A 1N0TA 2OWTA 3OSQA 3KN8A 3V5AA 2F7AA 1DOTA 1EU8A 3H6WA 2CMOA 2OLBA 2UVIA 3PPOA 5DVIA 1ZJLA 2ONKE 3HHFA 4N07A 3U94A 2RC9A 4FE8A 4GD5A 3U72A 4BDNA 1YPNA 3ECRA 4KHZE 2I3WA 4ZS9A 3O97A 2Y7RA 3C32A 4XKQA 4XXUA 4F3GA 2I6EA 3FV1A 3K0VA 3UIFA 4F3PA 2XX8A 4F22A 1I6QA 2OWSA 1MXWA 3V89B 3G3IA 4LQ2A 3FVGA 1GGGA 3I5OA 2QS3A 3QSLA 3BBRA 4G77A 4ZDMA 3VLWA 3O6GA 2PBWA 4XKNA 1BKAA 4JWOA 2NWJA 2KLFA 5ITPA 2FA7A 3CFXA 3OO6A 4OERA 3C34A 3OSRA 4KYSA 4QHQA 2E0SA 4JWXA 5AA4B 3KJTA 4LP2B 3LBSA 4JBZA 3A3CA 4XIGQ 2NVUB 3IR1A 1BP5A 1S7YA 3FJ7A 4BDLA 4DZ1A 1LAFE 1UIUA 1WODA 2UVGA 3HO7A 3VXBA 4ELPA 2F6PA 3OEKA 4IO7A 3UORA 2LAOA 4KCCA 4OFOA 3FD3A 3A09A 1B3FA 2O51A 3IO6A 4H8IA 4RYAA 3GLBA 4IY5A 3VDFA 2P1SA 3MVYA 4QSCA 5I57B 3F11A 1MXZA 1N76A 1SQYA 4KPTA 2Y7WA 4FJPA 2GFEA 4U23A 4IGTA 1M5EA 1IQ7A 2NOOA 3PD9A 2H9BA 1LFHA 3C35A 2PT1A 3K6WA 4X1BA 4YKJA 4JDFA 3TZAA 3CSGA 3H7MA 4F1YA 3QXMA 1Y9UA 2HZLA 1LSTA 2H25A 4EUOA 2ZYOA 4IY6A 3LSLA 4F39A 2QS4A 3VFJA 4F31B 4P0IA 3IX1A 3N6TA 4THIA 3S9EA 1B46A 3K1NA 1M5DA 5TP9A 4H65A 2DQVA 2OJTA 4H67A 4YAHX 4WXJA 3UK4A 4JXIA 3OOAA 1S50A 4YB6A 5JEIA 4GXSB 1A54A 1P1UA 2PVUA 2QMWA 4GOTA 4PFWA 4ZEFA 1UTHA 2YJPA 2F78A 3ZSFA 1TXFA 1VE4A 3D4GA 2X7QA 3M3FA 4LQ5A 3SKPA 4C0RA 4YMBA 5I2KA 2DVCA 1B51A 1SW2A 3K6XA 2AIXA 1HSJA 2DWIA 3MAMA 3MZ1A 3QUFA 4QFKA 2HXWA 4U1ZA 3TDJA 3ZS6A 4R9GA 2F35A 1MY1A 3OEMA 4MFIA 3LR1A 1GV8A 3N94A 1XT8A 3OD7A 3K00A 4G68C 5K2YA 5IAIA 1PB7A 3IB2A 2P0SA 4NWDA 1OLAA 2Q2AA 2RCAA 3BFTA 3MP1A 3PUYE 4LONB 1PB9A 1F9BA 5HM4B 4Q30B 5H8HA 3O29A 5BWJA 1QJMA 2UYFA 1MXVA 4MLVA 4LATA 3CVGA 1B32A 5I56B 1B3HA 1ZLQA 3R6UA 3KSJA 1LAHE 2QMXA 4UACA 1D4NA 3SETA 3UGWA 1LAXA 3GZGA 2WKYA 1H76A 1QW0A 3C36A 3A3UA 4LZ5A 3SEXA 5A5XA 3VVEA 1JW1A 1NMUA 4I9DA 4LZ8A 2OCUA 1ATGA 3CFLA 3OO7A 1AMFA 1LFIA 2H5YA 3K4UA 1IIWA 3ODBA 4FIMA 4GLIA 3H06B 3W9VA 4DE8A 5L9MA 3BKIB 4GIZA 4IO4A 2AL5A 4PQJA 4U4XA 1O7TA 3IOVA 3MBPA 4LUBA 3MW0A 1EZ9A 3OENA 1JQFA 2QL3A 1Y1MA 2UYEA 1TWYA 3D4CA 1A99A 4ZEBA 2Y84A 3C4MA 5ITOA 3KJ7A 3RTWB 1J1NA 3E9XA 3FXQA 4HTGA 3IOTA 3TTMA 5L9SA 1FQEA 4JWYA 2H99A 1B40A 4QFNA 4O3AA 5ICTA 3T93B 4ONYA 1MQJA 4F18A 4JSOA 5CI5A 3H03A 4BDQA 3FATA 2I4CA 1RYOA 4C1TA 2XXRA 1XS5A 3L6HA 1QUIA 2RCBA 2XXYA 3G3KA 3TCFA 3O6IA 4AB6A 3MC2A 5AA4A 5ICQA 4QSDA 4R2BA 4BDOA 1B0LA 2VP1A 3QK6A 5DEXA 1B0HA 3E4RA 3KZGA 1SI1A 3K02A 4G4PA 4MH5A 5FTIA 5JK4A 3TMGA 1D3KA 4OFLA 1M5CA 3VE1B 3JV9A 3TODA 4EQ7A 1B5JA 1SYHA 4KR5A 4U4SA 1PBQA 3B6QA 3VLVA 4F2OA 4TLMB 1EZOA 1HSLA 4I1DA 4UA8A 3TTRA 3W15C 5DEXB 1B1HA 2ZMBA 1LB9A 1MPCA 4NEDA 1LLSA 1NH7A 2Q2CA 4G8MA 4OETA 4RPOA 1ZIUA 2IEEA 3H4ZA 2REGA 2FNCA 2ZNTA 3SEWA 2OZZA 1DSNA 4KQPA 2ONSA 1PC3A 4FECA 5CMMA 1FTMA 2XD3A 3TTNA 1IXHA 3MZBA 3DLNA 1Z7NE 3PMXA 3R26A 3CRBA 4YMAA 1LB8A 3K6VA 1SVXB 4R6YA 3TUSA 4RPNA 5TP9B 3GBBA 4POWA 2OBGA 2VD3A 4QFOA 1TT1A 3U93A 5M2VA 3VVDA 4BLAA 3EHSA 1Y4CA 4ZE9A 4ESWA 1A40A 2ZNSA 1QULA 2HEUA 3KFMA 1JVXA 4YKKA 5FHNA 3TYHA 3MPKA 4OXVA 3MP8A 5B7DA 1AH5A 4TLLB 4F1UA 1UTHB 3KGCA 4YKIA 4H0WA 3E3KA 3KOTA 3S9MC 4G8NA 3O2AA 5I2KB 1URSA 4EXKA 4HW8A 3PUZE 4G2ZA 3FVKA 1CE2A 3T66A 3IB1A 1POTA 3SESA 4H8JA 4F3SA 4DCXA 3ZKLA 3RTFB 3FZVA 3WAFA 4RK2A 4DIGA 3TTLA 1NFTA 1NKXA 3SEVA 2HQ0A 2I48A 4YB5A 1A55A 1POY1 1N3WA 2XXXA 3RUMA 2DSFA 2AYSA 4U21A 4I8CA 5H8HB 2Z8DA 2XXHA 2B3FA 4F3BA 1IXCA 4FORA 5AA2A 3PMWA 1DMBA 1FQFA 1PBPA 2B65A 2Y7PA 1MDQA 4YB7A 3FJGA 1OVTA 3TFLA 2UVHA 3G7WA 2FYIA 5AA1A 1MXXA 3RY3A 1DPPA 4O3CA 4Q8RA 3R7XA 5CMKA 2O1MA 3O6HA 5DTBA 1O63A 2D21A 2O7IA 5AA2B 2AL4A 3KSXA 4IO5A 5TPAB 5I84A 3CI8A 1R9QA 1Y3PA 5A5XB 2Z23A 1DPEA 5KDTB 3GBAA 2XXQA 3OXNA 4IGRA 5I58A 2F7CA 1N3XA 3P7IA 1B7UA 1M5BA 1NNPA 2Z8FA 5TPAA 3UP9A 2P2AA 1QKBA 1DTGA 3C33A 3HN0A 4ELQA 1EH3A 3CSBA 4ELRA 5KDTA 3B7DA 1USYH 5CRYA 1SD3A 2A5SA 4ZECA 4ZZEA 4ZEDA 4R75A 2RC7A 2UXAA 1MH4A 4R9FA 1LFGA 4EQ9A 1B9JA 3LSWA 1A7LA 1CB6A 3PV0E 3MVWA 4GF8A 2VOZA 4P0GA 2GRVA 3CIJA 1OVBA 3KEIA 4O3BA 1S9TA 4U2RA 3TKDA 3U92A 3MP6A 4OESA 1N7XA 3PGFA 4G68B 3Q26A 4MF3A 4TOZA 4EDPA 1XHYA 1M5FA 2VD2A 3RT6B 3FASA 3PU5A 1B52A 3CG3A 5FTHA 2Q8JA 5DVFA 5JTYA 1O64A 2ZYNA 4XTCQ 1SW1A 2F97A 4PFUA 3VV5A 2Q9TA 3N26A 4R74A 3RN8A 3W9WA 2ZNUA 4G68A 2VHAA 4ECFA 2G93A 1IZ1A 4LZ7A 1FCKA 2H98A 1ZU0A 3MPLA 1MY2A 1MQDA 3LSXA 4YU0A 5F1QA 5HPQA 1N7WA 1UQWA 4OZ9A 2I3VA 1JEVA 2X26A 4BDRA 1MPDA 2HAUA 2VGQA 1B4ZA 3KG2A 2RINA 1B58A 3TTKA 3N5LA 1OLCA 2RKMA 3C9HA 1II5A 3I6VA 4OVJA 2RC8A 4PP0A 4GFRA 5H8FA 1NL5A 1JETA 2E1SA 4H6DA 1LAGE 3TELA 1MM7A 1NNFA 1JNFA 1USYE 2REJA 1SBPA 4NTLA 4KCDA 2ESNA 4I62A 4PE5B 4FEDA 4LVQA 1TFDA 1H43A 3GXAA 3MJNA 5DT6A 1D9YA 1ZTYA 2Q89A 1ZKBA 3PUWE 4IO3A 1L5TA 4N13A 3TAJA 1OIBA 1P1OA 1AIVA 4F29A 4RA1A 5AA2D 1I6AA 2O69A 4WEPA 5I59A 4MLQA 3I3VA 4HCWA 4JSDA 4ZZAA 1T0KA 1URGA 1ELJA 1JW4A 3HCQA 4AQ4A 3RT8A 3DP8A 4MBPA 3OO8A 4ND9A 3IOWA 2I58A 1D9VA 4GVOA 1XC1A 2DVZA 2F36A 2X7PA 4DXBA 3JZJA 4ISUA 3T9UA 3VXCA 2D3IA 4FAJA 5I59B 1FTKA 4EXLA 3S9NC 3B6WA 5K2XA 1VFDA 2Q88A 3K2DA 1MS7A 2OK2A 4DXCA 1MRPA 4FATA 2H4IA 1BIYA 3IO4A 3H3GA 4IO2A 1FQAA 2QS1A 1B7HA 1SI0A 1Y4TA 1XVXA 3KN3A 2DE4A 3H6UA 2HZKA 5H8NB 2V84A 1Q35A 4YICA 4ELOA 2I0CA 3M3KA 5L9OA 1MM6A 2ABHA 4KYDA 1GVCA 2NUVA 2R6GE 4H5GA 3C31A 3EPEA 1B3LA 2O68A 2XXTA 2R9JA 3FGSA 3IORA 1OQGA 2F6GA 2F8DA 3FVOA 4L17A 4AB5A 5I58B 4QF9A 1FQCA 3PUVE 1RYXA 2V25A 5DVJA 1MY4A 2DP8A 1XVYA 1MG1A 3DP4A 1R6ZA 2XD2A 4PFTA 5FHOA 4C1UA 5AA3A 1HSEA 3S9LC 4QFLA 1FQBA 2THIA 3FVNA 3EHUA 3IJXB 5FHMA 4K3FA 3RLFE 4EQBA 4TQUQ 1PDAA 2DWJA 2F34A 3TPAA 1I69A 1SW5A 4YZZA 2NXOA 3K6UA 3L6GA 4RY1A 3Q28A 5BUUA 4NF8B 1Y1ZA 3S2VA 3EF7A 4GXAA 4OENA 4E0XA 4OYVA 5EYFA 3MUQA 4DCYA 2QSXA 2B3BA 4R6HA 1EZPA 3G3GA 1UIVA 5L8DA 3IJOB 4G8HA 2XX9A 2DWHA 3CFZA 3M8UA 5JTYB 5KCJA 3V83A 4NF8A 1MH3A 4IO6A 1MQIA 4U1OA 3IL1B 1Y3NA 2I49A 3T9VA 4NE4A 4OMBA 3ZKKA 3EN3A 2ZYMA 1H44A 2M8CA 2RF1A 4DXUA 1B1XA 3FUZA 5KCJB 2HCAA 2G29A 1MQHA 1OMPA 3O28A 3MVXA 1A8EA 1B5HA 4Z7EA 1LBCA 3G3JA 5H8QB 3G3FA 1AOVA 4RJZA 2HFBA 2V3TA 1B05A 1P1WA 3IK6B 5ISUA 2XXPA 3OELA 3RGYA 2PYYA 5H8FB 2PT2A 1B3EA 1QUKA 3PPNA 4DLDA 1NNTA 3MQ9A 2I0BA 5H8QA 2CZLA 5TU0A 5LOMA 3THIA 4DDDA 1JVYA 2I4BA 1SYIA 3QYTA 4H1XA 4M4GA 5HBCA 4FEBA 1QVSA 2O7UA 4RNSA 4GRKA 1JW5A 1R1NA 4OHNA 5EHSA 3RQTA 3T22A 5H8SA 3O66A 1N84A 1P1NA 3E13X 3KBRA 4OEUA 2HAVA 1P99A 3ILUB 4IB2A 3MZ9A 3T96B 3RNNA 3N6UA 4BDMA 5IKBA 3UA8A 5CBSA 2F5XA 2A5TA 4OQOA 1B5IA 2GH9A 4F19A 3BFUA 4OEVA 2PX1A 2O1LA 4QFPA 4EF1A 3USDA 1YCJA 4OTEA 5EHMA 1BTJA 1IXIA 1Q1KA 4JB7A 3B6TA 1YTVA 3K1PA 4KI0E 4PETA 3TQLA 1R9LA 2O84X 4XKRA 3RPWA 3M3LA 1FTJA 3UN6A 3OO9A 3DP6A 4Q5TA 3ILTB 2QRYA 1N04A 3PPQA 3CG1A 3DELB 3PPPA 1MPBA 4GQOA 4NMYA 2ZXTA 3KN7A 4ZE8A 1MDP1 1SW4A 1LGBC 1MY0A 1MXUA 1GTKA 3ONMA 2R71A 1ANFA 3SDFA 2Y7IA 5ELVA 1VFEA 5H8NA 4X1DA 2PMSA 3QUJA 1MY3A 4R72A 1LBBA 1URDA 1Y20A 2V3UA 4GL8A 1VR5A 2XXVA 3LC8A 2F7BA 2ONRA 1Z7ME 4NF4B 3VLUA 1US4A 3TEPA 3OMBA 3FXUA 1B7ZA 3QAXA 4NF6A 4YKPA 3SEYA 5CC2A 2QPQA 4NF4A 3Q27A 2ANJA 4XKPA 1IEJA 4OWDA 4GWOA 1VSOA 3CR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZEI A;  2XX7 A;  2DXY A;  3U8Q A;  4EF2 A;  1KWH A;  3O9P A;  3TCG A;  1ZBM A;  4NF6 B;  4NWC A;  1MQG A;  4N6P A;  4X48 A;  1US5 A;  5I57 A;  2D5W A;  5AE4 A;  4F2Q A;  1LCT A;  1PB8 A;  1MXY A;  2UVJ A;  5DYH A;  3WAE A;  5CM6 A;  4E0W A;  2BJJ X;  3FV2 A;  3SER A;  2DS9 A;  1XOC A;  3PD8 A;  2QS2 A;  1B6H A;  2IA4 A;  3IAZ A;  2Z8E A;  2YLN A;  1IUD A;  2V93 A;  3MWB A;  2O6A A;  4HCY A;  1WVJ A;  3V8X B;  2DE2 A;  3IB0 A;  4X9T A;  3SEU A;  3JYR A;  3T9X B;  3QIM A;  1FTL A;  4RK9 A;  3H6V A;  1B3G A;  2GHA A;  1B2H A;  4LA9 A;  4RXL A;  3S4U A;  4POX A;  3T9H B;  4ZEK A;  3LSF B;  1H45 A;  1RKM A;  1TFA A;  1FQD A;  2ALU A;  3FJM A;  3LUY A;  3K1M A;  1SDX A;  1WDN A;  1ZMG A;  3Q29 A;  1UTB A;  1B4H A;  3PPR A;  4KD5 A;  1H3D A;  3FXR A;  5B70 A;  4P11 A;  2XHD A;  2QJE A;  5KZT A;  1IIT A;  3EHT A;  3Q25 A;  5J1D A;  1NH8 A;  1QUJ A;  2DXR A;  3PUX E;  1LCF A;  4QRZ A;  4PFY A;  1UTB B;  2XXI A;  4ESX A;  3G3H A;  3HV1 A;  3EQ1 A;  3TCH A;  4R2F A;  4H5F A;  3HST A;  4QSE A;  2DE3 A;  4WED A;  5CMB A;  3FIR A;  4KYE A;  4M1V A;  2DWA A;  4U22 A;  4F1V A;  2W7Y A;  2V3Q A;  3TQW A;  3HPI A;  3U1O A;  1QKA A;  3K01 A;  1FW0 A;  1GR2 A;  5F7V A;  1JEU A;  2DOJ A;  3MVZ A;  4R6K A;  3H6T A;  1NNK A;  4NF5 A;  2XXU A;  4WKM A;  5I2N A;  3AXF A;  1P1Q A;  2Z22 A;  4KFQ A;  1Y3Q A;  5CBR A;  2DYX A;  3VVF A;  1A8F A;  1PEB A;  5CMC A;  1OQH A;  1IXG A;  1FTO A;  4OFJ A;  2A5T B;  3DM0 A;  4HS7 A;  2Y7K A;  5I56 A;  3HHG A;  4NF5 B;  1I6B A;  5I2N B;  2XXW A;  4Z0I A;  1BLF A;  2ZYK A;  4R73 A;  1AL3 A;  1YAE A;  2GHB A;  3IOU A;  2YPN A;  1DTZ A;  3KOS A;  3PMV A;  4Q0C A;  4GL0 A;  1N0T A;  2OWT A;  3OSQ A;  3KN8 A;  3V5A A;  2F7A A;  1DOT A;  1EU8 A;  3H6W A;  2CMO A;  2OLB A;  2UVI A;  3PPO A;  5DVI A;  1ZJL A;  2ONK E;  3HHF A;  4N07 A;  3U94 A;  2RC9 A;  4FE8 A;  4GD5 A;  3U72 A;  4BDN A;  1YPN A;  3ECR A;  4KHZ E;  2I3W A;  4ZS9 A;  3O97 A;  2Y7R A;  3C32 A;  4XKQ A;  4XXU A;  4F3G A;  2I6E A;  3FV1 A;  3K0V A;  3UIF A;  4F3P A;  2XX8 A;  4F22 A;  1I6Q A;  2OWS A;  1MXW A;  3V89 B;  3G3I A;  4LQ2 A;  3FVG A;  1GGG A;  3I5O A;  2QS3 A;  3QSL A;  3BBR A;  4G77 A;  4ZDM A;  3VLW A;  3O6G A;  2PBW A;  4XKN A;  1BKA A;  4JWO A;  2NWJ A;  2KLF A;  5ITP A;  2FA7 A;  3CFX A;  3OO6 A;  4OER A;  3C34 A;  3OSR A;  4KYS A;  4QHQ A;  2E0S A;  4JWX A;  5AA4 B;  3KJT A;  4LP2 B;  3LBS A;  4JBZ A;  3A3C A;  4XIG Q;  2NVU B;  3IR1 A;  1BP5 A;  1S7Y A;  3FJ7 A;  4BDL A;  4DZ1 A;  1LAF E;  1UIU A;  1WOD A;  2UVG A;  3HO7 A;  3VXB A;  4ELP A;  2F6P A;  3OEK A;  4IO7 A;  3UOR A;  2LAO A;  4KCC A;  4OFO A;  3FD3 A;  3A09 A;  1B3F A;  2O51 A;  3IO6 A;  4H8I A;  4RYA A;  3GLB A;  4IY5 A;  3VDF A;  2P1S A;  3MVY A;  4QSC A;  5I57 B;  3F11 A;  1MXZ A;  1N76 A;  1SQY A;  4KPT A;  2Y7W A;  4FJP A;  2GFE A;  4U23 A;  4IGT A;  1M5E A;  1IQ7 A;  2NOO A;  3PD9 A;  2H9B A;  1LFH A;  3C35 A;  2PT1 A;  3K6W A;  4X1B A;  4YKJ A;  4JDF A;  3TZA A;  3CSG A;  3H7M A;  4F1Y A;  3QXM A;  1Y9U A;  2HZL A;  1LST A;  2H25 A;  4EUO A;  2ZYO A;  4IY6 A;  3LSL A;  4F39 A;  2QS4 A;  3VFJ A;  4F31 B;  4P0I A;  3IX1 A;  3N6T A;  4THI A;  3S9E A;  1B46 A;  3K1N A;  1M5D A;  5TP9 A;  4H65 A;  2DQV A;  2OJT A;  4H67 A;  4YAH X;  4WXJ A;  3UK4 A;  4JXI A;  3OOA A;  1S50 A;  4YB6 A;  5JEI A;  4GXS B;  1A54 A;  1P1U A;  2PVU A;  2QMW A;  4GOT A;  4PFW A;  4ZEF A;  1UTH A;  2YJP A;  2F78 A;  3ZSF A;  1TXF A;  1VE4 A;  3D4G A;  2X7Q A;  3M3F A;  4LQ5 A;  3SKP A;  4C0R A;  4YMB A;  5I2K A;  2DVC A;  1B51 A;  1SW2 A;  3K6X A;  2AIX A;  1HSJ A;  2DWI A;  3MAM A;  3MZ1 A;  3QUF A;  4QFK A;  2HXW A;  4U1Z A;  3TDJ A;  3ZS6 A;  4R9G A;  2F35 A;  1MY1 A;  3OEM A;  4MFI A;  3LR1 A;  1GV8 A;  3N94 A;  1XT8 A;  3OD7 A;  3K00 A;  4G68 C;  5K2Y A;  5IAI A;  1PB7 A;  3IB2 A;  2P0S A;  4NWD A;  1OLA A;  2Q2A A;  2RCA A;  3BFT A;  3MP1 A;  3PUY E;  4LON B;  1PB9 A;  1F9B A;  5HM4 B;  4Q30 B;  5H8H A;  3O29 A;  5BWJ A;  1QJM A;  2UYF A;  1MXV A;  4MLV A;  4LAT A;  3CVG A;  1B32 A;  5I56 B;  1B3H A;  1ZLQ A;  3R6U A;  3KSJ A;  1LAH E;  2QMX A;  4UAC A;  1D4N A;  3SET A;  3UGW A;  1LAX A;  3GZG A;  2WKY A;  1H76 A;  1QW0 A;  3C36 A;  3A3U A;  4LZ5 A;  3SEX A;  5A5X A;  3VVE A;  1JW1 A;  1NMU A;  4I9D A;  4LZ8 A;  2OCU A;  1ATG A;  3CFL A;  3OO7 A;  1AMF A;  1LFI A;  2H5Y A;  3K4U A;  1IIW A;  3ODB A;  4FIM A;  4GLI A;  3H06 B;  3W9V A;  4DE8 A;  5L9M A;  3BKI B;  4GIZ A;  4IO4 A;  2AL5 A;  4PQJ A;  4U4X A;  1O7T A;  3IOV A;  3MBP A;  4LUB A;  3MW0 A;  1EZ9 A;  3OEN A;  1JQF A;  2QL3 A;  1Y1M A;  2UYE A;  1TWY A;  3D4C A;  1A99 A;  4ZEB A;  2Y84 A;  3C4M A;  5ITO A;  3KJ7 A;  3RTW B;  1J1N A;  3E9X A;  3FXQ A;  4HTG A;  3IOT A;  3TTM A;  5L9S A;  1FQE A;  4JWY A;  2H99 A;  1B40 A;  4QFN A;  4O3A A;  5ICT A;  3T93 B;  4ONY A;  1MQJ A;  4F18 A;  4JSO A;  5CI5 A;  3H03 A;  4BDQ A;  3FAT A;  2I4C A;  1RYO A;  4C1T A;  2XXR A;  1XS5 A;  3L6H A;  1QUI A;  2RCB A;  2XXY A;  3G3K A;  3TCF A;  3O6I A;  4AB6 A;  3MC2 A;  5AA4 A;  5ICQ A;  4QSD A;  4R2B A;  4BDO A;  1B0L A;  2VP1 A;  3QK6 A;  5DEX A;  1B0H A;  3E4R A;  3KZG A;  1SI1 A;  3K02 A;  4G4P A;  4MH5 A;  5FTI A;  5JK4 A;  3TMG A;  1D3K A;  4OFL A;  1M5C A;  3VE1 B;  3JV9 A;  3TOD A;  4EQ7 A;  1B5J A;  1SYH A;  4KR5 A;  4U4S A;  1PBQ A;  3B6Q A;  3VLV A;  4F2O A;  4TLM B;  1EZO A;  1HSL A;  4I1D A;  4UA8 A;  3TTR A;  3W15 C;  5DEX B;  1B1H A;  2ZMB A;  1LB9 A;  1MPC A;  4NED A;  1LLS A;  1NH7 A;  2Q2C A;  4G8M A;  4OET A;  4RPO A;  1ZIU A;  2IEE A;  3H4Z A;  2REG A;  2FNC A;  2ZNT A;  3SEW A;  2OZZ A;  1DSN A;  4KQP A;  2ONS A;  1PC3 A;  4FEC A;  5CMM A;  1FTM A;  2XD3 A;  3TTN A;  1IXH A;  3MZB A;  3DLN A;  1Z7N E;  3PMX A;  3R26 A;  3CRB A;  4YMA A;  1LB8 A;  3K6V A;  1SVX B;  4R6Y A;  3TUS A;  4RPN A;  5TP9 B;  3GBB A;  4POW A;  2OBG A;  2VD3 A;  4QFO A;  1TT1 A;  3U93 A;  5M2V A;  3VVD A;  4BLA A;  3EHS A;  1Y4C A;  4ZE9 A;  4ESW A;  1A40 A;  2ZNS A;  1QUL A;  2HEU A;  3KFM A;  1JVX A;  4YKK A;  5FHN A;  3TYH A;  3MPK A;  4OXV A;  3MP8 A;  5B7D A;  1AH5 A;  4TLL B;  4F1U A;  1UTH B;  3KGC A;  4YKI A;  4H0W A;  3E3K A;  3KOT A;  3S9M C;  4G8N A;  3O2A A;  5I2K B;  1URS A;  4EXK A;  4HW8 A;  3PUZ E;  4G2Z A;  3FVK A;  1CE2 A;  3T66 A;  3IB1 A;  1POT A;  3SES A;  4H8J A;  4F3S A;  4DCX A;  3ZKL A;  3RTF B;  3FZV A;  3WAF A;  4RK2 A;  4DIG A;  3TTL A;  1NFT A;  1NKX A;  3SEV A;  2HQ0 A;  2I48 A;  4YB5 A;  1A55 A;  1POY 1;  1N3W A;  2XXX A;  3RUM A;  2DSF A;  2AYS A;  4U21 A;  4I8C A;  5H8H B;  2Z8D A;  2XXH A;  2B3F A;  4F3B A;  1IXC A;  4FOR A;  5AA2 A;  3PMW A;  1DMB A;  1FQF A;  1PBP A;  2B65 A;  2Y7P A;  1MDQ A;  4YB7 A;  3FJG A;  1OVT A;  3TFL A;  2UVH A;  3G7W A;  2FYI A;  5AA1 A;  1MXX A;  3RY3 A;  1DPP A;  4O3C A;  4Q8R A;  3R7X A;  5CMK A;  2O1M A;  3O6H A;  5DTB A;  1O63 A;  2D21 A;  2O7I A;  5AA2 B;  2AL4 A;  3KSX A;  4IO5 A;  5TPA B;  5I84 A;  3CI8 A;  1R9Q A;  1Y3P A;  5A5X B;  2Z23 A;  1DPE A;  5KDT B;  3GBA A;  2XXQ A;  3OXN A;  4IGR A;  5I58 A;  2F7C A;  1N3X A;  3P7I A;  1B7U A;  1M5B A;  1NNP A;  2Z8F A;  5TPA A;  3UP9 A;  2P2A A;  1QKB A;  1DTG A;  3C33 A;  3HN0 A;  4ELQ A;  1EH3 A;  3CSB A;  4ELR A;  5KDT A;  3B7D A;  1USY H;  5CRY A;  1SD3 A;  2A5S A;  4ZEC A;  4ZZE A;  4ZED A;  4R75 A;  2RC7 A;  2UXA A;  1MH4 A;  4R9F A;  1LFG A;  4EQ9 A;  1B9J A;  3LSW A;  1A7L A;  1CB6 A;  3PV0 E;  3MVW A;  4GF8 A;  2VOZ A;  4P0G A;  2GRV A;  3CIJ A;  1OVB A;  3KEI A;  4O3B A;  1S9T A;  4U2R A;  3TKD A;  3U92 A;  3MP6 A;  4OES A;  1N7X A;  3PGF A;  4G68 B;  3Q26 A;  4MF3 A;  4TOZ A;  4EDP A;  1XHY A;  1M5F A;  2VD2 A;  3RT6 B;  3FAS A;  3PU5 A;  1B52 A;  3CG3 A;  5FTH A;  2Q8J A;  5DVF A;  5JTY A;  1O64 A;  2ZYN A;  4XTC Q;  1SW1 A;  2F97 A;  4PFU A;  3VV5 A;  2Q9T A;  3N26 A;  4R74 A;  3RN8 A;  3W9W A;  2ZNU A;  4G68 A;  2VHA A;  4ECF A;  2G93 A;  1IZ1 A;  4LZ7 A;  1FCK A;  2H98 A;  1ZU0 A;  3MPL A;  1MY2 A;  1MQD A;  3LSX A;  4YU0 A;  5F1Q A;  5HPQ A;  1N7W A;  1UQW A;  4OZ9 A;  2I3V A;  1JEV A;  2X26 A;  4BDR A;  1MPD A;  2HAU A;  2VGQ A;  1B4Z A;  3KG2 A;  2RIN A;  1B58 A;  3TTK A;  3N5L A;  1OLC A;  2RKM A;  3C9H A;  1II5 A;  3I6V A;  4OVJ A;  2RC8 A;  4PP0 A;  4GFR A;  5H8F A;  1NL5 A;  1JET A;  2E1S A;  4H6D A;  1LAG E;  3TEL A;  1MM7 A;  1NNF A;  1JNF A;  1USY E;  2REJ A;  1SBP A;  4NTL A;  4KCD A;  2ESN A;  4I62 A;  4PE5 B;  4FED A;  4LVQ A;  1TFD A;  1H43 A;  3GXA A;  3MJN A;  5DT6 A;  1D9Y A;  1ZTY A;  2Q89 A;  1ZKB A;  3PUW E;  4IO3 A;  1L5T A;  4N13 A;  3TAJ A;  1OIB A;  1P1O A;  1AIV A;  4F29 A;  4RA1 A;  5AA2 D;  1I6A A;  2O69 A;  4WEP A;  5I59 A;  4MLQ A;  3I3V A;  4HCW A;  4JSD A;  4ZZA A;  1T0K A;  1URG A;  1ELJ A;  1JW4 A;  3HCQ A;  4AQ4 A;  3RT8 A;  3DP8 A;  4MBP A;  3OO8 A;  4ND9 A;  3IOW A;  2I58 A;  1D9V A;  4GVO A;  1XC1 A;  2DVZ A;  2F36 A;  2X7P A;  4DXB A;  3JZJ A;  4ISU A;  3T9U A;  3VXC A;  2D3I A;  4FAJ A;  5I59 B;  1FTK A;  4EXL A;  3S9N C;  3B6W A;  5K2X A;  1VFD A;  2Q88 A;  3K2D A;  1MS7 A;  2OK2 A;  4DXC A;  1MRP A;  4FAT A;  2H4I A;  1BIY A;  3IO4 A;  3H3G A;  4IO2 A;  1FQA A;  2QS1 A;  1B7H A;  1SI0 A;  1Y4T A;  1XVX A;  3KN3 A;  2DE4 A;  3H6U A;  2HZK A;  5H8N B;  2V84 A;  1Q35 A;  4YIC A;  4ELO A;  2I0C A;  3M3K A;  5L9O A;  1MM6 A;  2ABH A;  4KYD A;  1GVC A;  2NUV A;  2R6G E;  4H5G A;  3C31 A;  3EPE A;  1B3L A;  2O68 A;  2XXT A;  2R9J A;  3FGS A;  3IOR A;  1OQG A;  2F6G A;  2F8D A;  3FVO A;  4L17 A;  4AB5 A;  5I58 B;  4QF9 A;  1FQC A;  3PUV E;  1RYX A;  2V25 A;  5DVJ A;  1MY4 A;  2DP8 A;  1XVY A;  1MG1 A;  3DP4 A;  1R6Z A;  2XD2 A;  4PFT A;  5FHO A;  4C1U A;  5AA3 A;  1HSE A;  3S9L C;  4QFL A;  1FQB A;  2THI A;  3FVN A;  3EHU A;  3IJX B;  5FHM A;  4K3F A;  3RLF E;  4EQB A;  4TQU Q;  1PDA A;  2DWJ A;  2F34 A;  3TPA A;  1I69 A;  1SW5 A;  4YZZ A;  2NXO A;  3K6U A;  3L6G A;  4RY1 A;  3Q28 A;  5BUU A;  4NF8 B;  1Y1Z A;  3S2V A;  3EF7 A;  4GXA A;  4OEN A;  4E0X A;  4OYV A;  5EYF A;  3MUQ A;  4DCY A;  2QSX A;  2B3B A;  4R6H A;  1EZP A;  3G3G A;  1UIV A;  5L8D A;  3IJO B;  4G8H A;  2XX9 A;  2DWH A;  3CFZ A;  3M8U A;  5JTY B;  5KCJ A;  3V83 A;  4NF8 A;  1MH3 A;  4IO6 A;  1MQI A;  4U1O A;  3IL1 B;  1Y3N A;  2I49 A;  3T9V A;  4NE4 A;  4OMB A;  3ZKK A;  3EN3 A;  2ZYM A;  1H44 A;  2M8C A;  2RF1 A;  4DXU A;  1B1X A;  3FUZ A;  5KCJ B;  2HCA A;  2G29 A;  1MQH A;  1OMP A;  3O28 A;  3MVX A;  1A8E A;  1B5H A;  4Z7E A;  1LBC A;  3G3J A;  5H8Q B;  3G3F A;  1AOV A;  4RJZ A;  2HFB A;  2V3T A;  1B05 A;  1P1W A;  3IK6 B;  5ISU A;  2XXP A;  3OEL A;  3RGY A;  2PYY A;  5H8F B;  2PT2 A;  1B3E A;  1QUK A;  3PPN A;  4DLD A;  1NNT A;  3MQ9 A;  2I0B A;  5H8Q A;  2CZL A;  5TU0 A;  5LOM A;  3THI A;  4DDD A;  1JVY A;  2I4B A;  1SYI A;  3QYT A;  4H1X A;  4M4G A;  5HBC A;  4FEB A;  1QVS A;  2O7U A;  4RNS A;  4GRK A;  1JW5 A;  1R1N A;  4OHN A;  5EHS A;  3RQT A;  3T22 A;  5H8S A;  3O66 A;  1N84 A;  1P1N A;  3E13 X;  3KBR A;  4OEU A;  2HAV A;  1P99 A;  3ILU B;  4IB2 A;  3MZ9 A;  3T96 B;  3RNN A;  3N6U A;  4BDM A;  5IKB A;  3UA8 A;  5CBS A;  2F5X A;  2A5T A;  4OQO A;  1B5I A;  2GH9 A;  4F19 A;  3BFU A;  4OEV A;  2PX1 A;  2O1L A;  4QFP A;  4EF1 A;  3USD A;  1YCJ A;  4OTE A;  5EHM A;  1BTJ A;  1IXI A;  1Q1K A;  4JB7 A;  3B6T A;  1YTV A;  3K1P A;  4KI0 E;  4PET A;  3TQL A;  1R9L A;  2O84 X;  4XKR A;  3RPW A;  3M3L A;  1FTJ A;  3UN6 A;  3OO9 A;  3DP6 A;  4Q5T A;  3ILT B;  2QRY A;  1N04 A;  3PPQ A;  3CG1 A;  3DEL B;  3PPP A;  1MPB A;  4GQO A;  4NMY A;  2ZXT A;  3KN7 A;  4ZE8 A;  1MDP 1;  1SW4 A;  1LGB C;  1MY0 A;  1MXU A;  1GTK A;  3ONM A;  2R71 A;  1ANF A;  3SDF A;  2Y7I A;  5ELV A;  1VFE A;  5H8N A;  4X1D A;  2PMS A;  3QUJ A;  1MY3 A;  4R72 A;  1LBB A;  1URD A;  1Y20 A;  2V3U A;  4GL8 A;  1VR5 A;  2XXV A;  3LC8 A;  2F7B A;  2ONR A;  1Z7M E;  4NF4 B;  3VLU A;  1US4 A;  3TEP A;  3OMB A;  3FXU A;  1B7Z A;  3QAX A;  4NF6 A;  4YKP A;  3SEY A;  5CC2 A;  2QPQ A;  4NF4 A;  3Q27 A;  2ANJ A;  4XKP A;  1IEJ A;  4OWD A;  4GWO A;  1VSO A;  3CR9 A; 
#chains in the Genus database with same CATH topology
 2DXY A;  4NWC A;  5I57 A;  2D5W A;  4E0W A;  4MMP A;  2IA4 A;  1NUZ A;  5ET8 A;  2Z8E A;  1IUD A;  1WVJ A;  3JYR A;  3QIM A;  3T9H B;  3LSF B;  1H45 A;  3FJM A;  4E0X A;  4XF5 A;  1B4H A;  1H3D A;  3FXR A;  4N8Y A;  4H45 A;  4I3E A;  5J1D A;  3PUX E;  4PCD A;  5F24 A;  4ESX A;  4R2F A;  4H5F A;  2L5V A;  2DE3 A;  4KYE A;  3U1O A;  1JEU A;  2DOJ A;  3MVZ A;  4NF5 A;  5I2N A;  3AXF A;  1Y3Q A;  4PAK A;  2JJK A;  1A8F A;  1FTO A;  3KC1 A;  4PC9 A;  3HHG A;  4NF5 B;  5I2N B;  4Z0I A;  1BLF A;  1YAE A;  4Q0C A;  3V5A A;  1N0T A;  2OWT A;  2BJI A;  1NV7 A;  3PPO A;  4N07 A;  1YPN A;  4KHZ E;  2I3W A;  3C32 A;  4F3G A;  2I6E A;  4F3P A;  4F22 A;  1I6Q A;  2KLF A;  5I7I A;  4LP2 B;  3A3C A;  2WYK A;  3VXB A;  2F6P A;  2LAO A;  4KCC A;  1FPL A;  1SPI A;  2WBB A;  4QSC A;  5A5L A;  1YYZ A;  1MXZ A;  1N76 A;  4GBV A;  2Y7W A;  2GFE A;  2NOO A;  3K6W A;  4JDF A;  3H7M A;  1Y9U A;  4F31 B;  2H25 A;  4DI4 B;  2QS4 A;  3VFJ A;  4P0I A;  1NI9 A;  3S9E A;  4H65 A;  4YAH X;  3OOA A;  4PFW A;  2QFL A;  4C0R A;  5I2K A;  2PFY A;  1B51 A;  2F35 A;  3OEM A;  3LR1 A;  3N94 A;  1XT8 A;  3K00 A;  1PB7 A;  3PUY E;  2XWV A;  5H8H A;  4N15 A;  1LAX A;  3A3U A;  5A5X A;  1FJ6 A;  3CFL A;  3OO7 A;  3K4U A;  3W9V A;  5L9M A;  1O7T A;  4OVP A;  4LUB A;  1EZ9 A;  1JQF A;  4P8B A;  5ITO A;  2Y84 A;  3RTW B;  3TTM A;  2H99 A;  5ICT A;  1NUY A;  4ONY A;  4NGU A;  4JSO A;  4C1T A;  2XXR A;  3TCF A;  5LDZ A;  4R2B A;  5DEX A;  3KZG A;  3TMG A;  1D3K A;  1B5J A;  4F2O A;  1EZO A;  1PBQ A;  4UA8 A;  3W15 C;  3TTR A;  5DW8 A;  1B1H A;  1MPC A;  4OET A;  2IEE A;  4PBH A;  3SEW A;  4KQP A;  1PC3 A;  2XD3 A;  3K6V A;  4R6Y A;  5TP9 B;  3GBB A;  4POW A;  2OBG A;  1TT1 A;  2HEU A;  5FHN A;  5B7D A;  1AH5 A;  3KGC A;  1NV4 A;  1FBC A;  3PUZ E;  1POT A;  3SES A;  4F3S A;  4DCX A;  3ZKL A;  1FBP A;  4PFB A;  1POY 1;  4OAN A;  2AYS A;  4MNC A;  2Z8D A;  2B3F A;  4F3B A;  1IXC A;  4YB7 A;  1MDQ A;  3G7W A;  2O1M A;  2AL4 A;  3KSX A;  5TPA B;  3PTY A;  5I84 A;  1R9Q A;  5KDT B;  2OX3 A;  5I58 A;  3P7I A;  1M5B A;  5TPA A;  1QKB A;  1DTG A;  3HN0 A;  5KDT A;  3FBP A;  1USY H;  5CRY A;  1SD3 A;  2A5S A;  4GX3 A;  4ZEC A;  4R75 A;  2RC7 A;  1MH4 A;  1LFG A;  3PV0 E;  2GRV A;  3MST A;  4U2R A;  4XEQ A;  1XHY A;  1M5F A;  2VD2 A;  5JTY A;  1SW1 A;  4R74 A;  3RN8 A;  2G93 A;  1IZ1 A;  1FCK A;  4PE3 A;  1ZU0 A;  5J16 A;  1N7W A;  2I3V A;  2HAU A;  3KG2 A;  3B8B A;  3N5L A;  1II5 A;  4GFR A;  1NL5 A;  4N81 A;  4H6D A;  4NTL A;  4KCD A;  2CEX A;  4PE5 B;  1TFD A;  5DT6 A;  1D9Y A;  1LBX A;  3TAJ A;  1AIV A;  2O69 A;  2Q74 A;  1ELJ A;  2CZI A;  4AQ4 A;  3RT8 A;  1RDX A;  2F36 A;  3T9U A;  4PAI A;  1FTK A;  4EXL A;  1VFD A;  2Q88 A;  3K2D A;  2OK2 A;  1MRP A;  4FAT A;  3IO4 A;  1B7H A;  5FBP A;  2DE4 A;  2HZK A;  5H8N B;  5I5P A;  1MM6 A;  3QMF A;  2R6G E;  2XXT A;  3IOR A;  2F8D A;  1NV2 A;  3PUV E;  1RYX A;  1MG1 A;  1R6Z A;  2XD2 A;  3RLF E;  1NV1 A;  2DWJ A;  4YZZ A;  3S2V A;  4OYV A;  4R6H A;  1EZP A;  3G3G A;  4G8H A;  3M8U A;  4NF8 A;  1MH3 A;  3IL1 B;  1Y3N A;  1DBZ A;  3T9V A;  4NE4 A;  4OMB A;  2ZYM A;  2RF1 A;  1LEV A;  3FUZ A;  2G29 A;  1MQH A;  1OMP A;  1LBC A;  4OA4 A;  2XWI A;  4RJZ A;  2V3T A;  1B05 A;  1P1W A;  5ISU A;  3OEL A;  2PT2 A;  1QUK A;  1FPI A;  3ISP A;  1NNT A;  5TU0 A;  3QYT A;  4H1X A;  2O7U A;  4MCO A;  1R1N A;  3IFA A;  5H8S A;  1DK4 A;  3T96 B;  3RNN A;  1IMC A;  1G0H A;  4OQO A;  4XFE A;  3BFU A;  2O1L A;  1Q1K A;  3UN6 A;  3M3L A;  1FTJ A;  2HPG A;  2QRY A;  3DEL B;  1MPB A;  3T1B A;  5IM2 A;  3ONM A;  1EYI A;  1ANF A;  2Y7I A;  1VFE A;  2ONR A;  4NF4 B;  3VLU A;  3QAX A;  4XKP A;  4N6D A;  4GWO A;  3SEV A;  1QVS A;  2XX7 A;  3O9P A;  4UAB A;  1ZBM A;  4F2Q A;  1LCT A;  1FJ9 A;  2BJJ X;  2DS9 A;  1B6H A;  2YLN A;  4HCY A;  3D1R A;  2Y5L A;  3IB0 A;  3SEU A;  2ZZV A;  1FTL A;  1B3G A;  3S4U A;  1B2H A;  4RXL A;  4POX A;  4ZEK A;  1TFA A;  2ALU A;  1ZMG A;  3Q29 A;  2QJE A;  3EHT A;  3Q25 A;  1UTB B;  3G3H A;  5EQ8 A;  5CMB A;  4U22 A;  3TQW A;  1FW0 A;  5F7V A;  1NNK A;  1P1Q A;  1Q9D A;  2Z22 A;  3VVF A;  1PEB A;  1IXG A;  2A5T B;  3EKI A;  4HS7 A;  2Y7K A;  2XXW A;  2ZYK A;  4R73 A;  4PAF A;  2GHB A;  2YPN A;  1DTZ A;  2F7A A;  1DOT A;  2OWZ A;  1LBZ A;  2OLB A;  3U94 A;  2RC9 A;  4FE8 A;  1FBH A;  3ECR A;  4XKQ A;  3FV1 A;  2XX8 A;  3RPL B;  3V89 B;  3FVG A;  1GGG A;  4NHB A;  4ZDM A;  3O6G A;  2PBW A;  4XKN A;  2NWJ A;  5ITP A;  4OER A;  4NAP A;  5AA4 B;  3IR1 A;  1LAF E;  4GWS A;  3OEK A;  4PDD A;  4WKM A;  3A09 A;  1B3F A;  5I57 B;  1SQY A;  4FJP A;  4OVT A;  1M5E A;  1IQ7 A;  4MJO A;  2H9B A;  1LFH A;  3TZA A;  4X1B A;  4YKJ A;  3CSG A;  3E79 A;  1LST A;  3N6T A;  2DQV A;  4H67 A;  4WXJ A;  2PVU A;  2YJP A;  1VE4 A;  3D4G A;  4LQ5 A;  3SKP A;  3QUF A;  2DWI A;  2QVR A;  4NX1 A;  4R9G A;  1MY1 A;  5EYH A;  2P0S A;  3MP1 A;  1F9B A;  3O29 A;  5BWJ A;  1MXV A;  3CVG A;  1ZLQ A;  3SET A;  1H76 A;  1QW0 A;  4LZ5 A;  3VVE A;  1ATG A;  1LFI A;  1AMF A;  3ODB A;  3H06 B;  4GIZ A;  4IO4 A;  4U4X A;  3OEN A;  3C4M A;  3KJ7 A;  4GX4 A;  2QVV A;  4QFN A;  4O3A A;  1MQJ A;  5CI5 A;  5LTC A;  3FAT A;  2I4C A;  4PGN A;  3L6H A;  1QUI A;  3G3K A;  4AB6 A;  3O6I A;  3MC2 A;  4BDO A;  2VP1 A;  1B0H A;  1M5C A;  3TOD A;  1SYH A;  3VLV A;  4TLM B;  1LB9 A;  2Q2C A;  3H4Z A;  2REG A;  4MHF A;  4FEC A;  5CMM A;  3TTN A;  1IXH A;  3DLN A;  3R26 A;  4YMA A;  1LB8 A;  4BLA A;  3VVD A;  1Y4C A;  1A40 A;  2ZNS A;  4GBW A;  4YKI A;  3E3K A;  3KOT A;  3S9M C;  5I2K B;  4G2Z A;  4X04 A;  1CE2 A;  3T66 A;  3WAF A;  2VT5 A;  1NFT A;  1NKX A;  4YB5 A;  1A55 A;  2XXH A;  5AA2 A;  4FOR A;  3T0J A;  3RYD A;  1DMB A;  4P1L A;  1OVT A;  2FYI A;  5AA1 A;  1MXX A;  3RY3 A;  5CMK A;  5DTB A;  3O6H A;  1O63 A;  2D21 A;  5AA2 B;  1Y3P A;  3GBA A;  2XXQ A;  3OXN A;  1B7U A;  2P3N A;  4X8R A;  3UP9 A;  3C33 A;  3CSB A;  3B7D A;  4ZED A;  2UXA A;  1A7L A;  4P0G A;  1XI6 A;  1OVB A;  3KEI A;  4O3B A;  3MP6 A;  4OES A;  4GWX A;  4EDP A;  3FAS A;  3CG3 A;  5FTH A;  4XTC Q;  2ZYN A;  4PFU A;  1VDW A;  3N26 A;  3NOH A;  2ZNU A;  4ECF A;  1RDY A;  2H98 A;  4N91 A;  5HPQ A;  1UQW A;  4OZ9 A;  1JEV A;  2X26 A;  1MPD A;  2WEF A;  3I6V A;  2RC8 A;  3TEL A;  1KA1 A;  1MM7 A;  1JNF A;  2REJ A;  1SBP A;  4FED A;  1H43 A;  3MJN A;  4N13 A;  3U65 A;  1OIB A;  5IZZ A;  4F29 A;  5AA2 D;  3I3V A;  4ZZA A;  3DP8 A;  4ND9 A;  3OO8 A;  2B4M A;  1BK4 A;  1XC1 A;  4O7I A;  4ISU A;  2D3I A;  5I59 B;  3S9N C;  3B6W A;  4DI3 D;  1MS7 A;  2GQ1 A;  2H4I A;  1SI0 A;  2V84 A;  2FVZ A;  2ABH A;  1GVC A;  3EPE A;  1B3L A;  1OQG A;  3CHG A;  4AB5 A;  4QF9 A;  1FQC A;  2FIE A;  2DP8 A;  1XVY A;  3DP4 A;  4PFT A;  2VPN A;  4C1U A;  3S9L C;  4QFL A;  3IJX B;  1PDA A;  3TPA A;  1I69 A;  2HHM A;  4NF8 B;  3EF7 A;  4GXA A;  3MUQ A;  4DCY A;  2QSX A;  5JTY B;  3CFZ A;  1MQI A;  1H44 A;  1IMA A;  3O28 A;  4Z7E A;  2HFB A;  4N4U A;  1B3E A;  5ET7 A;  2I0B A;  2CZL A;  4DDD A;  2I4B A;  4RNS A;  3T22 A;  4N17 A;  1P1N A;  3KBR A;  2HAV A;  1P99 A;  3N6U A;  3UA8 A;  5CBS A;  2F5X A;  4OEV A;  3USD A;  1IMF A;  4JB7 A;  1YTV A;  4KI0 E;  1R9L A;  4XKR A;  2WBD A;  3PPP A;  4GQO A;  1N04 A;  2WYP A;  2ZXT A;  3KN7 A;  1SW4 A;  1LGB C;  4P9K A;  5H8N A;  3QUJ A;  5T3J A;  4R72 A;  1URD A;  2V3U A;  2F7B A;  1Z7M E;  3OMB A;  4JVD A;  4YKP A;  3Q27 A;  1IEJ A;  4ZEI A;  3U8Q A;  1FBE A;  1NV3 A;  1KWH A;  4N6P A;  4X48 A;  5AE4 A;  5CM6 A;  1MXY A;  2UVJ A;  3WAE A;  3FV2 A;  3SER A;  1XOC A;  3PD8 A;  2QS2 A;  1FPG A;  2O6A A;  4RK9 A;  3H6V A;  2GHA A;  4LA9 A;  4N8G A;  1K9Y A;  3LUY A;  1FQD A;  1SDX A;  1UTB A;  3PPR A;  1IME A;  2XXK A;  4P11 A;  1YZ0 A;  2XHD A;  5KZT A;  1IIT A;  1NH8 A;  1QUJ A;  4QRZ A;  4PFY A;  3EQ1 A;  4QSE A;  3FIR A;  2DWA A;  1FSA A;  2V3Q A;  3HPI A;  4R6K A;  3H6T A;  2XXU A;  1VSO A;  5EQ9 A;  2DYX A;  5CMC A;  3DM0 A;  5I56 A;  3BIG A;  3IOU A;  3PMV A;  3H6W A;  1EU8 A;  1ZJL A;  2CZK A;  3HHF A;  4GD5 A;  3U72 A;  2Y7R A;  4AS5 A;  4KXP A;  2OWS A;  1MXW A;  3G3I A;  3VLW A;  3QSL A;  2QS3 A;  4JWO A;  2FA7 A;  3OO6 A;  3C34 A;  3OSR A;  4KYS A;  4QHQ A;  3KJT A;  2NVU B;  4BDL A;  1BP5 A;  1UIU A;  3HO7 A;  1KA0 A;  3FD3 A;  4H8I A;  3IO6 A;  4RYA A;  5IZ3 B;  2FHY A;  4NN3 A;  2CZH A;  4U23 A;  3C35 A;  4HE0 A;  4F1Y A;  4EUO A;  4F39 A;  2ZYO A;  3IX1 A;  3K1N A;  4MX6 A;  1A54 A;  1P1U A;  2QMW A;  1UTH A;  3ZSF A;  4YMB A;  3B50 A;  2DVC A;  1SW2 A;  4QFK A;  3R7X A;  3MAM A;  2HXW A;  3ZS6 A;  1GV8 A;  5EQ7 A;  4G68 C;  3HFU A;  3IB2 A;  1OLA A;  2RCA A;  4LON B;  1K9Z A;  1PB9 A;  4Q30 B;  4MLV A;  1B3H A;  3R6U A;  2QMX A;  4UAC A;  2WKY A;  3SEX A;  4JVI A;  1JW1 A;  1NMU A;  2XWK A;  4FIM A;  1IIW A;  4DE8 A;  3BKI B;  3IOV A;  3MBP A;  3D4C A;  2QL3 A;  1TWY A;  1A99 A;  4ZEB A;  1J1N A;  3E9X A;  1FQE A;  4JWY A;  3T93 B;  4F18 A;  4BDQ A;  1RYO A;  1FPF A;  2XXY A;  5AA4 A;  4QSD A;  4G4P A;  1SI1 A;  5JK4 A;  3VE1 B;  2KQZ A;  4I1D A;  1DSN A;  2ONS A;  3MZB A;  3PMX A;  2VPO A;  3A29 A;  2VD3 A;  4NG7 A;  5M2V A;  4ZE9 A;  4ESW A;  4YKK A;  3KFM A;  1D9Q A;  3MPK A;  4OXV A;  1FBD A;  3MP8 A;  4MNP A;  4F1U A;  1URS A;  4HW8 A;  3IB1 A;  3RTF B;  3FZV A;  4RK2 A;  4DIG A;  3TTL A;  2CEY A;  2I48 A;  2XXX A;  3RUM A;  2KR0 A;  4U21 A;  5H8H B;  3PMW A;  1PBP A;  1FQF A;  3TFL A;  3FJG A;  2UVH A;  1DPP A;  4O3C A;  4Q8R A;  2O7I A;  4IO5 A;  3CI8 A;  1JP4 A;  4IGR A;  1NNP A;  2Z8F A;  5ET5 A;  4HE1 A;  4ELR A;  1EH3 A;  1B9J A;  3LSW A;  1CB6 A;  3MVW A;  4GF8 A;  2VOZ A;  1FPK A;  1S9T A;  3TKD A;  3U92 A;  4HXV A;  1N7X A;  3Q26 A;  4JVC A;  2Q8J A;  5DVF A;  2F97 A;  2Q9T A;  4G68 A;  2VHA A;  1NV5 A;  4LZ7 A;  4QXD A;  3LSX A;  4YU0 A;  4BDR A;  2VGQ A;  1B4Z A;  2RIN A;  1B58 A;  1OLC A;  2RKM A;  4OVJ A;  5H8F A;  1JET A;  1LAG E;  3LUZ A;  4LVQ A;  4FBP A;  1ZTY A;  3PUW E;  1ZKB A;  4IO3 A;  1L5T A;  1P1O A;  5I59 A;  4HCW A;  4JSD A;  1URG A;  1KZ8 A;  1JW4 A;  3HCQ A;  3IOW A;  2I58 A;  4DXB A;  1DCU A;  1AWB A;  1FRP A;  1BIY A;  2QS1 A;  1XVX A;  3KN3 A;  3H6U A;  1Q35 A;  3LV0 A;  3M3K A;  4NF0 A;  4KYD A;  4H5G A;  5EYG A;  2F6G A;  3FVO A;  4L17 A;  5I58 B;  1MY4 A;  1YXI A;  5FHO A;  1NV0 A;  2THI A;  3EHU A;  5FHM A;  4K3F A;  4EQB A;  4TQU Q;  2F34 A;  3K6U A;  3L6G A;  4RY1 A;  3Q28 A;  5EYF A;  2B3B A;  2XWO A;  4PGP A;  5L8D A;  1UIV A;  4AS4 A;  3V83 A;  4H46 A;  4IO6 A;  4U1O A;  2F3B A;  3ZKK A;  3EN3 A;  4DXU A;  2HCA A;  2B4L A;  1A8E A;  3G3J A;  4IR8 A;  4O8M A;  5H8Q B;  1AOV A;  3IK6 B;  2XXP A;  2PYY A;  5H8Q A;  1SYI A;  4M4G A;  4OHN A;  3RQT A;  3KC0 A;  1N84 A;  3E13 X;  3MZ9 A;  4PF6 A;  1B5I A;  2ZZW A;  1RDZ A;  2PX1 A;  4EF1 A;  4QFP A;  1YCJ A;  5EHM A;  1IXI A;  3B6T A;  3K1P A;  3TQL A;  4P1E A;  3OO9 A;  3DP6 A;  4Q5T A;  3ILT B;  3GYY A;  3U93 A;  4ZE8 A;  1MY0 A;  1MXU A;  3MYU A;  5ELV A;  3RPL A;  2PMS A;  4X1D A;  4GL8 A;  3LC8 A;  4GWU A;  3TEP A;  1B7Z A;  4NF6 A;  4EF2 A;  3TCG A;  4NF6 B;  1MQG A;  4PF8 A;  1US5 A;  1PB8 A;  5DYH A;  1FBF A;  3IAZ A;  2V93 A;  3MWB A;  3V8X B;  2DE2 A;  4X9T A;  3T9X B;  1FTA A;  4LN5 A;  4OVR A;  1RKM A;  4KD5 A;  3K1M A;  1WDN A;  5B70 A;  2Q8M A;  1FPD A;  2DXR A;  1LCF A;  2XXI A;  3HV1 A;  3TCH A;  3HST A;  4WED A;  4M1V A;  4F1V A;  2W7Y A;  5IZ1 A;  1QKA A;  3K01 A;  1GR2 A;  4P3L A;  4KFQ A;  5CBR A;  1OQH A;  4OFJ A;  1I6B A;  1AL3 A;  3KOS A;  5A5X B;  4GL0 A;  3OSQ A;  3KN8 A;  2CMO A;  2UVI A;  5DVI A;  2ONK E;  1LBW A;  4BDN A;  4ZS9 A;  3O97 A;  4XXU A;  3UIF A;  3K0V A;  4GWZ A;  4LQ2 A;  2XA5 A;  3I5O A;  4G77 A;  3BBR A;  1BKA A;  3CFX A;  4P56 A;  2E0S A;  4JWX A;  3LBS A;  4JBZ A;  4XIG Q;  1S7Y A;  3FJ7 A;  4DZ1 A;  1WOD A;  2UVG A;  4ELP A;  4IO7 A;  3UOR A;  4MIJ A;  4OFO A;  2O51 A;  3VDF A;  3GLB A;  4IY5 A;  2P1S A;  3MVY A;  3F11 A;  1NUW A;  4KPT A;  4IGT A;  1NUX A;  3PD9 A;  2PT1 A;  3QXM A;  2HZL A;  1LBV A;  4IY6 A;  2F3D A;  3LSL A;  4THI A;  1B46 A;  1M5D A;  5TP9 A;  2OJT A;  3UK4 A;  4JXI A;  1S50 A;  4YB6 A;  5JEI A;  4GXS B;  4GOT A;  4ZEF A;  2F78 A;  1TXF A;  3M3F A;  2X7Q A;  3MZ1 A;  3K6X A;  2AIX A;  1HSJ A;  3TDJ A;  4U1Z A;  4MFI A;  3OD7 A;  5IAI A;  5K2Y A;  2HXR A;  4NWD A;  2Q2A A;  3BFT A;  5HM4 B;  1QJM A;  2UYF A;  4LAT A;  4I3Y A;  1B32 A;  5I56 B;  3KSJ A;  1LAH E;  3UGW A;  1D4N A;  3GZG A;  3C36 A;  4I9D A;  4LZ8 A;  2OCU A;  2H5Y A;  4GLI A;  2AL5 A;  4PQJ A;  3CR9 A;  3FXB A;  3MW0 A;  2UYE A;  1Y1M A;  3FXQ A;  4HTG A;  3IOT A;  5L9S A;  5ESY A;  1B40 A;  2V4C A;  3H03 A;  4PBQ A;  1XS5 A;  2RCB A;  5ICQ A;  1B0L A;  3QK6 A;  2ZZX A;  3E4R A;  3K02 A;  3BIH A;  4MH5 A;  4G61 A;  5FTI A;  4OFL A;  3JV9 A;  4EQ7 A;  4U4S A;  4KR5 A;  4QBA A;  3B6Q A;  1EYK A;  1HSL A;  5IZ3 A;  5DEX B;  2ZMB A;  4NED A;  1LLS A;  1NH7 A;  4G8M A;  4OVQ A;  4RPO A;  1ZIU A;  2FNC A;  2ZNT A;  4GX6 A;  2OZZ A;  1IMB A;  1FTM A;  1Z7N E;  3CRB A;  1SVX B;  3TUS A;  4RPN A;  4OVS A;  5EQA A;  4QFO A;  1FPJ A;  3EHS A;  1QUL A;  1JVX A;  3TYH A;  4TLL B;  1UTH B;  4H0W A;  4G8N A;  3O2A A;  4EXK A;  3FVK A;  1QGX A;  4H8J A;  4O7M A;  2HQ0 A;  3SZP A;  1N3W A;  2DSF A;  4I8C A;  1IMD A;  2B65 A;  2Y7P A;  2Z23 A;  1DPE A;  2F7C A;  1N3X A;  4N6K A;  2P2A A;  4ELQ A;  3ROJ A;  4ZZE A;  4R9F A;  4EQ9 A;  3CIJ A;  3PGF A;  4G68 B;  4TOZ A;  4MF3 A;  3RT6 B;  3PU5 A;  1B52 A;  5ET6 A;  1O64 A;  3VV5 A;  4P47 A;  3W9W A;  3MPL A;  1MY2 A;  1MQD A;  5F1Q A;  2Y5K A;  2MKZ A;  3TTK A;  3C9H A;  4PP0 A;  2E1S A;  4I40 A;  1NNF A;  1USY E;  2ESN A;  4I62 A;  3GXA A;  2Q89 A;  4GWW A;  4RA1 A;  1I6A A;  4WEP A;  1T0K A;  4MLQ A;  4MBP A;  1D9V A;  4GVO A;  2DVZ A;  2X7P A;  3JZJ A;  3E78 A;  3VXC A;  4FAJ A;  4HE2 A;  5K2X A;  4DXC A;  1CNQ A;  3H3G A;  4IO2 A;  1FQA A;  1NV6 A;  1Y4T A;  2FIX A;  4MEV A;  4YIC A;  4PFR A;  4ELO A;  2I0C A;  1FPE A;  2NUV A;  3C31 A;  2O68 A;  1INP A;  2R9J A;  3FGS A;  2V25 A;  5DVJ A;  4PTK A;  5AA3 A;  1HSE A;  1FQB A;  3FVN A;  4NQ8 A;  4GWY A;  1SW5 A;  2NXO A;  5BUU A;  5IGA A;  1Y1Z A;  4OEN A;  2R8T A;  4MAG A;  3IJO B;  2XX9 A;  2DWH A;  5KCJ A;  2FBP A;  2I49 A;  2M8C A;  2QVU A;  1B1X A;  5KCJ B;  5I3S A;  3MVX A;  1B5H A;  4MNI A;  3G3F A;  3RGY A;  5H8F B;  1G0I A;  3PPN A;  4DLD A;  4O94 A;  3MQ9 A;  5LOM A;  3THI A;  1JVY A;  5HBC A;  2PCR A;  4FEB A;  4GRK A;  1FPB A;  1JW5 A;  5EHS A;  3O66 A;  2WX9 A;  4OEU A;  3ILU B;  2DDK A;  4IB2 A;  5IKB A;  4BDM A;  2A5T A;  2GH9 A;  4PDH A;  4F19 A;  5L9O A;  4OTE A;  1BTJ A;  4PET A;  2O84 X;  3RPW A;  3PPQ A;  3CG1 A;  4NMY A;  1MDP 1;  2P3V A;  1GTK A;  2R71 A;  3SDF A;  1LBY A;  1FBG A;  1MY3 A;  1LBB A;  1Y20 A;  1VR5 A;  2XXV A;  3KBZ A;  1US4 A;  2PFZ A;  3FXU A;  3SEY A;  5CC2 A;  2QPQ A;  2ANJ A;  4OWD A;  4PFI A;  1EYJ A;  3IFC A;  4NF4 A; 
#chains in the Genus database with same CATH homology
 4ZEI A;  2XX7 A;  2DXY A;  3U8Q A;  4EF2 A;  1KWH A;  3O9P A;  3TCG A;  1ZBM A;  4NF6 B;  4NWC A;  1MQG A;  4N6P A;  4X48 A;  1US5 A;  5I57 A;  2D5W A;  5AE4 A;  4F2Q A;  1LCT A;  1PB8 A;  1MXY A;  2UVJ A;  5DYH A;  3WAE A;  5CM6 A;  4E0W A;  2BJJ X;  3FV2 A;  3SER A;  2DS9 A;  1XOC A;  3PD8 A;  2QS2 A;  1B6H A;  2IA4 A;  3IAZ A;  2Z8E A;  2YLN A;  1IUD A;  2V93 A;  3MWB A;  2O6A A;  4HCY A;  1WVJ A;  3V8X B;  2DE2 A;  3IB0 A;  4X9T A;  3SEU A;  3JYR A;  3T9X B;  3QIM A;  1FTL A;  4RK9 A;  3H6V A;  1B3G A;  2GHA A;  1B2H A;  4LA9 A;  4RXL A;  3S4U A;  4POX A;  3T9H B;  4ZEK A;  3LSF B;  1H45 A;  1RKM A;  1TFA A;  1FQD A;  2ALU A;  3FJM A;  3LUY A;  3K1M A;  1SDX A;  1WDN A;  1ZMG A;  3Q29 A;  1UTB A;  1B4H A;  3PPR A;  4KD5 A;  1H3D A;  3FXR A;  5B70 A;  4P11 A;  2XHD A;  2QJE A;  5KZT A;  1IIT A;  3EHT A;  3Q25 A;  5J1D A;  1NH8 A;  1QUJ A;  2DXR A;  3PUX E;  1LCF A;  4QRZ A;  4PFY A;  1UTB B;  2XXI A;  4ESX A;  3G3H A;  3HV1 A;  3EQ1 A;  3TCH A;  4R2F A;  4H5F A;  3HST A;  4QSE A;  2DE3 A;  4WED A;  5CMB A;  3FIR A;  4KYE A;  4M1V A;  2DWA A;  4U22 A;  4F1V A;  2W7Y A;  2V3Q A;  3TQW A;  3HPI A;  3U1O A;  1QKA A;  3K01 A;  1FW0 A;  1GR2 A;  5F7V A;  1JEU A;  2DOJ A;  3MVZ A;  4R6K A;  3H6T A;  1NNK A;  4NF5 A;  2XXU A;  4WKM A;  5I2N A;  3AXF A;  1P1Q A;  2Z22 A;  4KFQ A;  1Y3Q A;  5CBR A;  2DYX A;  3VVF A;  1A8F A;  1PEB A;  5CMC A;  1OQH A;  1IXG A;  1FTO A;  4OFJ A;  2A5T B;  3DM0 A;  4HS7 A;  2Y7K A;  5I56 A;  3HHG A;  4NF5 B;  1I6B A;  5I2N B;  2XXW A;  4Z0I A;  1BLF A;  2ZYK A;  4R73 A;  1AL3 A;  1YAE A;  2GHB A;  3IOU A;  2YPN A;  1DTZ A;  3KOS A;  3PMV A;  4Q0C A;  4GL0 A;  1N0T A;  2OWT A;  3OSQ A;  3KN8 A;  3V5A A;  2F7A A;  1DOT A;  1EU8 A;  3H6W A;  2CMO A;  2OLB A;  2UVI A;  3PPO A;  5DVI A;  1ZJL A;  2ONK E;  3HHF A;  4N07 A;  3U94 A;  2RC9 A;  4FE8 A;  4GD5 A;  3U72 A;  4BDN A;  1YPN A;  3ECR A;  4KHZ E;  2I3W A;  4ZS9 A;  3O97 A;  2Y7R A;  3C32 A;  4XKQ A;  4XXU A;  4F3G A;  2I6E A;  3FV1 A;  3K0V A;  3UIF A;  4F3P A;  2XX8 A;  4F22 A;  1I6Q A;  2OWS A;  1MXW A;  3V89 B;  3G3I A;  4LQ2 A;  3FVG A;  1GGG A;  3I5O A;  2QS3 A;  3QSL A;  3BBR A;  4G77 A;  4ZDM A;  3VLW A;  3O6G A;  2PBW A;  4XKN A;  1BKA A;  4JWO A;  2NWJ A;  2KLF A;  5ITP A;  2FA7 A;  3CFX A;  3OO6 A;  4OER A;  3C34 A;  3OSR A;  4KYS A;  4QHQ A;  2E0S A;  4JWX A;  5AA4 B;  3KJT A;  4LP2 B;  3LBS A;  4JBZ A;  3A3C A;  4XIG Q;  2NVU B;  3IR1 A;  1BP5 A;  1S7Y A;  3FJ7 A;  4BDL A;  4DZ1 A;  1LAF E;  1UIU A;  1WOD A;  2UVG A;  3HO7 A;  3VXB A;  4ELP A;  2F6P A;  3OEK A;  4IO7 A;  3UOR A;  2LAO A;  4KCC A;  4OFO A;  3FD3 A;  3A09 A;  1B3F A;  2O51 A;  3IO6 A;  4H8I A;  4RYA A;  3GLB A;  4IY5 A;  3VDF A;  2P1S A;  3MVY A;  4QSC A;  5I57 B;  3F11 A;  1MXZ A;  1N76 A;  1SQY A;  4KPT A;  2Y7W A;  4FJP A;  2GFE A;  4U23 A;  4IGT A;  1M5E A;  1IQ7 A;  2NOO A;  3PD9 A;  2H9B A;  1LFH A;  3C35 A;  2PT1 A;  3K6W A;  4X1B A;  4YKJ A;  4JDF A;  3TZA A;  3CSG A;  3H7M A;  4F1Y A;  3QXM A;  1Y9U A;  2HZL A;  1LST A;  2H25 A;  4EUO A;  2ZYO A;  4IY6 A;  3LSL A;  4F39 A;  2QS4 A;  3VFJ A;  4F31 B;  4P0I A;  3IX1 A;  3N6T A;  4THI A;  3S9E A;  1B46 A;  3K1N A;  1M5D A;  5TP9 A;  4H65 A;  2DQV A;  2OJT A;  4H67 A;  4YAH X;  4WXJ A;  3UK4 A;  4JXI A;  3OOA A;  1S50 A;  4YB6 A;  5JEI A;  4GXS B;  1A54 A;  1P1U A;  2PVU A;  2QMW A;  4GOT A;  4PFW A;  4ZEF A;  1UTH A;  2YJP A;  2F78 A;  3ZSF A;  1TXF A;  1VE4 A;  3D4G A;  2X7Q A;  3M3F A;  4LQ5 A;  3SKP A;  4C0R A;  4YMB A;  5I2K A;  2DVC A;  1B51 A;  1SW2 A;  3K6X A;  2AIX A;  1HSJ A;  2DWI A;  3MAM A;  3MZ1 A;  3QUF A;  4QFK A;  2HXW A;  4U1Z A;  3TDJ A;  3ZS6 A;  4R9G A;  2F35 A;  1MY1 A;  3OEM A;  4MFI A;  3LR1 A;  1GV8 A;  3N94 A;  1XT8 A;  3OD7 A;  3K00 A;  4G68 C;  5K2Y A;  5IAI A;  1PB7 A;  3IB2 A;  2P0S A;  4NWD A;  1OLA A;  2Q2A A;  2RCA A;  3BFT A;  3MP1 A;  3PUY E;  4LON B;  1PB9 A;  1F9B A;  5HM4 B;  4Q30 B;  5H8H A;  3O29 A;  5BWJ A;  1QJM A;  2UYF A;  1MXV A;  4MLV A;  4LAT A;  3CVG A;  1B32 A;  5I56 B;  1B3H A;  1ZLQ A;  3R6U A;  3KSJ A;  1LAH E;  2QMX A;  4UAC A;  1D4N A;  3SET A;  3UGW A;  1LAX A;  3GZG A;  2WKY A;  1H76 A;  1QW0 A;  3C36 A;  3A3U A;  4LZ5 A;  3SEX A;  5A5X A;  3VVE A;  1JW1 A;  1NMU A;  4I9D A;  4LZ8 A;  2OCU A;  1ATG A;  3CFL A;  3OO7 A;  1AMF A;  1LFI A;  2H5Y A;  3K4U A;  1IIW A;  3ODB A;  4FIM A;  4GLI A;  3H06 B;  3W9V A;  4DE8 A;  5L9M A;  3BKI B;  4GIZ A;  4IO4 A;  2AL5 A;  4PQJ A;  4U4X A;  1O7T A;  3IOV A;  3MBP A;  4LUB A;  3MW0 A;  1EZ9 A;  3OEN A;  1JQF A;  2QL3 A;  1Y1M A;  2UYE A;  1TWY A;  3D4C A;  1A99 A;  4ZEB A;  2Y84 A;  3C4M A;  5ITO A;  3KJ7 A;  3RTW B;  1J1N A;  3E9X A;  3FXQ A;  4HTG A;  3IOT A;  3TTM A;  5L9S A;  1FQE A;  4JWY A;  2H99 A;  1B40 A;  4QFN A;  4O3A A;  5ICT A;  3T93 B;  4ONY A;  1MQJ A;  4F18 A;  4JSO A;  5CI5 A;  3H03 A;  4BDQ A;  3FAT A;  2I4C A;  1RYO A;  4C1T A;  2XXR A;  1XS5 A;  3L6H A;  1QUI A;  2RCB A;  2XXY A;  3G3K A;  3TCF A;  3O6I A;  4AB6 A;  3MC2 A;  5AA4 A;  5ICQ A;  4QSD A;  4R2B A;  4BDO A;  1B0L A;  2VP1 A;  3QK6 A;  5DEX A;  1B0H A;  3E4R A;  3KZG A;  1SI1 A;  3K02 A;  4G4P A;  4MH5 A;  5FTI A;  5JK4 A;  3TMG A;  1D3K A;  4OFL A;  1M5C A;  3VE1 B;  3JV9 A;  3TOD A;  4EQ7 A;  1B5J A;  1SYH A;  4KR5 A;  4U4S A;  1PBQ A;  3B6Q A;  3VLV A;  4F2O A;  4TLM B;  1EZO A;  1HSL A;  4I1D A;  4UA8 A;  3TTR A;  3W15 C;  5DEX B;  1B1H A;  2ZMB A;  1LB9 A;  1MPC A;  4NED A;  1LLS A;  1NH7 A;  2Q2C A;  4G8M A;  4OET A;  4RPO A;  1ZIU A;  2IEE A;  3H4Z A;  2REG A;  2FNC A;  2ZNT A;  3SEW A;  2OZZ A;  1DSN A;  4KQP A;  2ONS A;  1PC3 A;  4FEC A;  5CMM A;  1FTM A;  2XD3 A;  3TTN A;  1IXH A;  3MZB A;  3DLN A;  1Z7N E;  3PMX A;  3R26 A;  3CRB A;  4YMA A;  1LB8 A;  3K6V A;  1SVX B;  4R6Y A;  3TUS A;  4RPN A;  5TP9 B;  3GBB A;  4POW A;  2OBG A;  2VD3 A;  4QFO A;  1TT1 A;  3U93 A;  5M2V A;  3VVD A;  4BLA A;  3EHS A;  1Y4C A;  4ZE9 A;  4ESW A;  1A40 A;  2ZNS A;  1QUL A;  2HEU A;  3KFM A;  1JVX A;  4YKK A;  5FHN A;  3TYH A;  3MPK A;  4OXV A;  3MP8 A;  5B7D A;  1AH5 A;  4TLL B;  4F1U A;  1UTH B;  3KGC A;  4YKI A;  4H0W A;  3E3K A;  3KOT A;  3S9M C;  4G8N A;  3O2A A;  5I2K B;  1URS A;  4EXK A;  4HW8 A;  3PUZ E;  4G2Z A;  3FVK A;  1CE2 A;  3T66 A;  3IB1 A;  1POT A;  3SES A;  4H8J A;  4F3S A;  4DCX A;  3ZKL A;  3RTF B;  3FZV A;  3WAF A;  4RK2 A;  4DIG A;  3TTL A;  1NFT A;  1NKX A;  3SEV A;  2HQ0 A;  2I48 A;  4YB5 A;  1A55 A;  1POY 1;  1N3W A;  2XXX A;  3RUM A;  2DSF A;  2AYS A;  4U21 A;  4I8C A;  5H8H B;  2Z8D A;  2XXH A;  2B3F A;  4F3B A;  1IXC A;  4FOR A;  5AA2 A;  3PMW A;  1DMB A;  1FQF A;  1PBP A;  2B65 A;  2Y7P A;  1MDQ A;  4YB7 A;  3FJG A;  1OVT A;  3TFL A;  2UVH A;  3G7W A;  2FYI A;  5AA1 A;  1MXX A;  3RY3 A;  1DPP A;  4O3C A;  4Q8R A;  3R7X A;  5CMK A;  2O1M A;  3O6H A;  5DTB A;  1O63 A;  2D21 A;  2O7I A;  5AA2 B;  2AL4 A;  3KSX A;  4IO5 A;  5TPA B;  5I84 A;  3CI8 A;  1R9Q A;  1Y3P A;  5A5X B;  2Z23 A;  1DPE A;  5KDT B;  3GBA A;  2XXQ A;  3OXN A;  4IGR A;  5I58 A;  2F7C A;  1N3X A;  3P7I A;  1B7U A;  1M5B A;  1NNP A;  2Z8F A;  5TPA A;  3UP9 A;  2P2A A;  1QKB A;  1DTG A;  3C33 A;  3HN0 A;  4ELQ A;  1EH3 A;  3CSB A;  4ELR A;  5KDT A;  3B7D A;  1USY H;  5CRY A;  1SD3 A;  2A5S A;  4ZEC A;  4ZZE A;  4ZED A;  4R75 A;  2RC7 A;  2UXA A;  1MH4 A;  4R9F A;  1LFG A;  4EQ9 A;  1B9J A;  3LSW A;  1A7L A;  1CB6 A;  3PV0 E;  3MVW A;  4GF8 A;  2VOZ A;  4P0G A;  2GRV A;  3CIJ A;  1OVB A;  3KEI A;  4O3B A;  1S9T A;  4U2R A;  3TKD A;  3U92 A;  3MP6 A;  4OES A;  1N7X A;  3PGF A;  4G68 B;  3Q26 A;  4MF3 A;  4TOZ A;  4EDP A;  1XHY A;  1M5F A;  2VD2 A;  3RT6 B;  3FAS A;  3PU5 A;  1B52 A;  3CG3 A;  5FTH A;  2Q8J A;  5DVF A;  5JTY A;  1O64 A;  2ZYN A;  4XTC Q;  1SW1 A;  2F97 A;  4PFU A;  3VV5 A;  2Q9T A;  3N26 A;  4R74 A;  3RN8 A;  3W9W A;  2ZNU A;  4G68 A;  2VHA A;  4ECF A;  2G93 A;  1IZ1 A;  4LZ7 A;  1FCK A;  2H98 A;  1ZU0 A;  3MPL A;  1MY2 A;  1MQD A;  3LSX A;  4YU0 A;  5F1Q A;  5HPQ A;  1N7W A;  1UQW A;  4OZ9 A;  2I3V A;  1JEV A;  2X26 A;  4BDR A;  1MPD A;  2HAU A;  2VGQ A;  1B4Z A;  3KG2 A;  2RIN A;  1B58 A;  3TTK A;  3N5L A;  1OLC A;  2RKM A;  3C9H A;  1II5 A;  3I6V A;  4OVJ A;  2RC8 A;  4PP0 A;  4GFR A;  5H8F A;  1NL5 A;  1JET A;  2E1S A;  4H6D A;  1LAG E;  3TEL A;  1MM7 A;  1NNF A;  1JNF A;  1USY E;  2REJ A;  1SBP A;  4NTL A;  4KCD A;  2ESN A;  4I62 A;  4PE5 B;  4FED A;  4LVQ A;  1TFD A;  1H43 A;  3GXA A;  3MJN A;  5DT6 A;  1D9Y A;  1ZTY A;  2Q89 A;  1ZKB A;  3PUW E;  4IO3 A;  1L5T A;  4N13 A;  3TAJ A;  1OIB A;  1P1O A;  1AIV A;  4F29 A;  4RA1 A;  5AA2 D;  1I6A A;  2O69 A;  4WEP A;  5I59 A;  4MLQ A;  3I3V A;  4HCW A;  4JSD A;  4ZZA A;  1T0K A;  1URG A;  1ELJ A;  1JW4 A;  3HCQ A;  4AQ4 A;  3RT8 A;  3DP8 A;  4MBP A;  3OO8 A;  4ND9 A;  3IOW A;  2I58 A;  1D9V A;  4GVO A;  1XC1 A;  2DVZ A;  2F36 A;  2X7P A;  4DXB A;  3JZJ A;  4ISU A;  3T9U A;  3VXC A;  2D3I A;  4FAJ A;  5I59 B;  1FTK A;  4EXL A;  3S9N C;  3B6W A;  5K2X A;  1VFD A;  2Q88 A;  3K2D A;  1MS7 A;  2OK2 A;  4DXC A;  1MRP A;  4FAT A;  2H4I A;  1BIY A;  3IO4 A;  3H3G A;  4IO2 A;  1FQA A;  2QS1 A;  1B7H A;  1SI0 A;  1Y4T A;  1XVX A;  3KN3 A;  2DE4 A;  3H6U A;  2HZK A;  5H8N B;  2V84 A;  1Q35 A;  4YIC A;  4ELO A;  2I0C A;  3M3K A;  5L9O A;  1MM6 A;  2ABH A;  4KYD A;  1GVC A;  2NUV A;  2R6G E;  4H5G A;  3C31 A;  3EPE A;  1B3L A;  2O68 A;  2XXT A;  2R9J A;  3FGS A;  3IOR A;  1OQG A;  2F6G A;  2F8D A;  3FVO A;  4L17 A;  4AB5 A;  5I58 B;  4QF9 A;  1FQC A;  3PUV E;  1RYX A;  2V25 A;  5DVJ A;  1MY4 A;  2DP8 A;  1XVY A;  1MG1 A;  3DP4 A;  1R6Z A;  2XD2 A;  4PFT A;  5FHO A;  4C1U A;  5AA3 A;  1HSE A;  3S9L C;  4QFL A;  1FQB A;  2THI A;  3FVN A;  3EHU A;  3IJX B;  5FHM A;  4K3F A;  3RLF E;  4EQB A;  4TQU Q;  1PDA A;  2DWJ A;  2F34 A;  3TPA A;  1I69 A;  1SW5 A;  4YZZ A;  2NXO A;  3K6U A;  3L6G A;  4RY1 A;  3Q28 A;  5BUU A;  4NF8 B;  1Y1Z A;  3S2V A;  3EF7 A;  4GXA A;  4OEN A;  4E0X A;  4OYV A;  5EYF A;  3MUQ A;  4DCY A;  2QSX A;  2B3B A;  4R6H A;  1EZP A;  3G3G A;  1UIV A;  5L8D A;  3IJO B;  4G8H A;  2XX9 A;  2DWH A;  3CFZ A;  3M8U A;  5JTY B;  5KCJ A;  3V83 A;  4NF8 A;  1MH3 A;  4IO6 A;  1MQI A;  4U1O A;  3IL1 B;  1Y3N A;  2I49 A;  3T9V A;  4NE4 A;  4OMB A;  3ZKK A;  3EN3 A;  2ZYM A;  1H44 A;  2M8C A;  2RF1 A;  4DXU A;  1B1X A;  3FUZ A;  5KCJ B;  2HCA A;  2G29 A;  1MQH A;  1OMP A;  3O28 A;  3MVX A;  1A8E A;  1B5H A;  4Z7E A;  1LBC A;  3G3J A;  5H8Q B;  3G3F A;  1AOV A;  4RJZ A;  2HFB A;  2V3T A;  1B05 A;  1P1W A;  3IK6 B;  5ISU A;  2XXP A;  3OEL A;  3RGY A;  2PYY A;  5H8F B;  2PT2 A;  1B3E A;  1QUK A;  3PPN A;  4DLD A;  1NNT A;  3MQ9 A;  2I0B A;  5H8Q A;  2CZL A;  5TU0 A;  5LOM A;  3THI A;  4DDD A;  1JVY A;  2I4B A;  1SYI A;  3QYT A;  4H1X A;  4M4G A;  5HBC A;  4FEB A;  1QVS A;  2O7U A;  4RNS A;  4GRK A;  1JW5 A;  1R1N A;  4OHN A;  5EHS A;  3RQT A;  3T22 A;  5H8S A;  3O66 A;  1N84 A;  1P1N A;  3E13 X;  3KBR A;  4OEU A;  2HAV A;  1P99 A;  3ILU B;  4IB2 A;  3MZ9 A;  3T96 B;  3RNN A;  3N6U A;  4BDM A;  5IKB A;  3UA8 A;  5CBS A;  2F5X A;  2A5T A;  4OQO A;  1B5I A;  2GH9 A;  4F19 A;  3BFU A;  4OEV A;  2PX1 A;  2O1L A;  4QFP A;  4EF1 A;  3USD A;  1YCJ A;  4OTE A;  5EHM A;  1BTJ A;  1IXI A;  1Q1K A;  4JB7 A;  3B6T A;  1YTV A;  3K1P A;  4KI0 E;  4PET A;  3TQL A;  1R9L A;  2O84 X;  4XKR A;  3RPW A;  3M3L A;  1FTJ A;  3UN6 A;  3OO9 A;  3DP6 A;  4Q5T A;  3ILT B;  2QRY A;  1N04 A;  3PPQ A;  3CG1 A;  3DEL B;  3PPP A;  1MPB A;  4GQO A;  4NMY A;  2ZXT A;  3KN7 A;  4ZE8 A;  1MDP 1;  1SW4 A;  1LGB C;  1MY0 A;  1MXU A;  1GTK A;  3ONM A;  2R71 A;  1ANF A;  3SDF A;  2Y7I A;  5ELV A;  1VFE A;  5H8N A;  4X1D A;  2PMS A;  3QUJ A;  1MY3 A;  4R72 A;  1LBB A;  1URD A;  1Y20 A;  2V3U A;  4GL8 A;  1VR5 A;  2XXV A;  3LC8 A;  2F7B A;  2ONR A;  1Z7M E;  4NF4 B;  3VLU A;  1US4 A;  3TEP A;  3OMB A;  3FXU A;  1B7Z A;  3QAX A;  4NF6 A;  4YKP A;  3SEY A;  5CC2 A;  2QPQ A;  4NF4 A;  3Q27 A;  2ANJ A;  4XKP A;  1IEJ A;  4OWD A;  4GWO A;  1VSO A;  3CR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...