3G49A

N-(pyridin-2-yl) arylsulfonamide inhibitors of 11b-hydroxysteroid dehydrogenase type 1: discovery of pf-915275
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-(Pyridin-2-yl) arylsulfonamide inhibitors of 11beta-hydroxysteroid dehydrogenase type 1: Discovery of PF-915275.
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords 11-beta-hydroxysteroid dehydrogenase 1
total genus 96
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3g49A00
1P1HA 3OIFA 4FFMA 1P31A 4BMSA 2OP1A 5CG2A 2HUNA 2ZB3A 4Z3KA 4ZVVA 5I9NA 3PWZA 2P5UA 3HDJA 2A9FA 4Z3DA 5I7FA 2HSDA 3EGOA 3TFOA 2GYYA 5FI5A 4XR9A 3TZHA 3RFXA 1O5IA 5IF3A 3JYPA 4C4OA 1ISGA 3GUCA 3VH4A 5LCXA 3H5RA 4E33A 4U0JA 4OKIA 5IJZA 3JQAA 2DT5A 4I1IA 2AHRA 4J6FA 4RPHA 4M8SA 3RUIA 4HFJA 3TPCA 4OYRA 2LDXA 3HZZA 1GPDG 3EY4A 4R51A 3OEYA 5LC1A 2NLOA 2WD7A 4JN6B 3S1LA 3ZCXA 3GAFA 4YCAA 4OQZA 3KYBA 1N92A 3DAFA 3EUWA 4XYGA 5JDCC 3KSZO 2JCYA 1DLJA 1Z75A 3AU8A 2ZCVA 3I52A 3HFSA 4L76A 5L4NA 3NTOA 2GN4A 5JBIA 3Q1LA 2NWQA 3G17A 4K9DA 5KJEA 5I9LA 1YB5A 3PIDA 1P77A 4PLYA 3RC1A 3TRIA 3OMLA 5U1PA 2FR1A 3VPHA 1ZBQA 4BNZA 1B3BA 2JCXA 2EIHA 5DBGA 4D79A 2VQ3A 3WGHA 1T26A 1IULA 4Z9FA 3GVPA 3IP1A 3VVCA 4JP2A 1KVSA 2TMGA 4XQGA 1UXIA 4AJ4A 3BIOA 5CEFA 2FMUA 2BGLA 1CETA 2GN8A 1I0ZA 3IOYA 1YXMA 3K92A 4E21A 1RM5A 1R4NB 2Q2VA 3TFQA 2NUAA 1NHGA 4C7KA 4PG5A 2B4QA 3I1JA 2FOIA 4XCVA 2E49A 3IKVA 4XDZA 4XQCA 2P5YA 3GA0A 2Q4BA 4E32A 1NX6A 3OH8A 4RQTA 1K6XA 4GX2A 1LJ8A 1DOHA 2VUSA 3EW7A 1FK8A 1PJTA 1NTOA 5ADHA 1RJWA 1T2DA 2YYYA 3BTOA 3AUAA 1Q1NA 5A4DA 4NH4A 1YRLA 4E2ZA 1IHYA 1BG6A 1PJLA 3ICPA 3A28A 5GMOA 3WIDA 4BNUA 3ZWXA 4D45A 4HADA 2AEFA 1ZMTA 3PJEA 4DA9A 3GNTA 4NFHA 3DFUA 4QUKA 4F46A 1E92A 1W73A 2EJWA 3BTSA 3CXRA 4EEXA 2DTDA 2EW8A 2IDZA 4PLCA 3ROPA 1EVYA 1VSUA 4Q3AA 1QR6A 3RUDA 1BDMA 3CE6A 3U9LA 1MP0A 1JAXA 1R16A 2VWHA 4J0FA 4QX6A 3IS3A 3N74A 4DC0A 4D0RA 1G6KA 3K30A 3HUDA 1ZO8A 1E3WB 2PGDA 3DBHB 4L4XA 4CMKA 1P33A 5EMHA 4JROA 3IQDB 3HN2A 2A92A 2GSDA 4NK4A 1L1FA 4CV2A 1RYEA 2GN6A 3NAQA 1E7SA 2CNBA 4XB1A 5HS4A 4WJZA 2UV8A 1PGNA 1HLPA 3WJ7A 3EHEA 4CQLB 2I3AA 3QWIA 4IIVA 1DDOA 1T1SA 2V6FA 3GVIA 3NDJA 4OOEA 3AM4A 1R0LA 4RF4A 3GHYA 3R0IA 4A26A 1YGYA 4IDDA 4CM5A 1M6WA 5EIOA 5H82A 4DC1A 3LYLA 1SPXA 3C1TA 3TL3A 5JC1A 3WTBA 1ZSVA 1QYVA 4I9NA 4HFRA 1XR3A 1MC4A 4I08A 1CWUA 4IJKA 4AJJA 3OA2A 1LSOA 4BO3A 1VKOA 2PKQP 5CFZA 4YJGA 1EVZA 4PLVA 3DAGA 3LLSA 5DNAA 1HXHA 1JN0A 4NU5A 4M86A 4YEDA 5G0UA 4BB6A 4YRDA 1NP3A 4OXYA 4D42A 5F3RA 4IGFA 1ZVMA 1B8UA 1A27A 1GTMA 4L4SA 5DOZA 3C8MA 4NQZA 5K6AA 2J3HA 1WDKA 5F1OA 4YQYA 5EN4A 1QV6A 3W8FA 4IDGA 1IY8A 3S2FA 1F0YA 5JY1A 1LI4A 3ZW9A 4U8GA 3JYLA 4Y98A 1UDCA 4CMBA 3WWYA 5DP1A 2YHIA 4ITUA 3GGPA 3NYWA 4PLWA 3X2FA 5B4UA 1OMOA 2HMTA 4XR4A 3GLQA 3O4RA 2PH5A 4ALIA 3FR7A 2WDZA 2B5VA 4EUHA 1ZJYA 1GY8A 3KUXA 4J43A 1ID1A 4R16A 4DL9A 4MDHA 3H9GA 2XAAA 3K2BA 4QO7A 3ZWCA 2YFHA 4W7IA 5C7OO 3NGXA 4CQMA 3L4SO 1GV1A 1PU2A 3O26A 3ADOA 3NKLA 4FJ1A 1UH5A 3WYEA 4CMGA 2W2LA 3GMSA 3ICCA 4CMEA 5IFLA 4GSLA 3U49A 2YUTA 5DF1A 1NAIA 4DIFA 1YL5A 1TXGA 2ZATA 3DOJA 4IJWA 3GVHA 2QYTA 1P1RA 3FNEA 1U3WA 1NPTO 1ZUD1 2IYPA 3WR5A 2DU8A 4DREA 1MXHA 1V8BA 4QO8A 3H4VA 3WBFA 4BNLA 3ENKA 5IG2A 3DTTA 1K89A 2F1KA 2EERA 4W6ZA 3JQFA 1Y1PA 3OQBA 3ZWVA 3OP4A 2W2KA 1XWFA 5K9ZA 2C2XA 3H3FA 5DBIA 1Q0HA 1HZZA 2ZQZA 3DZFA 2PTGA 4IUYA 1PR9A 3ZWMA 2ZB7A 2RAFA 3BMCA 1WP4A 3T4XA 4CM4B 1T2FA 3WIEA 3QJ5A 4KDEA 5ILGA 3OJFA 2JFFA 2VCYA 1H6BA 1LQTA 3KRTA 2Y1EA 2IODA 3OFSA 2W90A 4AL4A 3LT1A 2AE1A 4KUGA 1ZK3A 4FN4A 4I5FA 2E48A 4OAQA 4R69A 2Y1DA 2P9CA 3DO5A 4HXYA 1JLLA 1GCUA 4IMPA 1LRKA 5AXBA 1SBYA 1ORRA 3L6OO 3NTQA 3PXXA 4B8WA 1PJ2A 1VE9A 4IDEA 4RPLA 3ZW8A 7ADHA 1PGOA 4Y9DA 1QG6A 1PIWA 1UDAA 2VHXA 3GPDG 3IJRA 4H16A 4NI5A 4PCVA 1R4NA 1R0KA 1KVRA 1A72A 3I5MA 4KUEA 2P4QA 4N54A 2J6IA 4RJTA 4B4OA 1WZIA 4R1TA 3P19A 3K5PA 1R66A 3JQGA 4L75A 3TWOA 4LVCA 2XOXA 1NNUA 3JQ7B 3V1YA 3WTCA 2DAPA 3F4LA 3PI7A 4XYEA 4FGSA 3I83A 1XU9A 1YE3A 1KVTA 3U5TA 3NJ4A 5BSFA 5HRUA 2QQ5A 4MOWA 4YAKA 1GR0A 3EDMA 3V1UA 3KO8A 4FJ2A 1PL7A 4YJDA 3LF1A 1SCUA 5A3JA 2WD8A 3IIEA 1U9JA 4BO8A 2Y99A 2FY8A 2O23A 3F4BA 3B6ZA 3H9UA 2NQ8A 3EYWA 3K6JA 3V2HA 1NASA 3PYMA 1LQUA 4MVJD 4Z0PA 2BELA 1Q0QA 4TSKA 3DZIA 2CDAA 2G1UA 2JKVA 4RORA 1LDMA 4WOKA 4M49A 1I3MA 1KY4A 4BNGA 4ZQBA 4DIOA 2WJPA 4XIJA 1HETA 2Z95A 3NT5A 1C1XA 2DM6A 5T64A 1W8DA 2IEDA 1M66A 3MTJA 4PG8A 4JBGA 2X5KO 4U5QA 3AI1A 4KDFA 4WCFC 5CDSA 2I66A 2FPIA 4UUPA 3GR6A 4QTZA 3ANMA 3I9OA 1KS9A 4R4JA 1K6IA 3A14A 4CQMD 3GC6A 3E48A 1WDMA 4P8RA 4E2XA 1C14A 4B4WA 3WGIA 4QEDA 3CPSA 4RVGA 3JQBA 2BRUA 2W2KB 3GF4A 3VHRA 4MVJM 4E12A 1N5DA 1PGPA 2BFPA 4CMCA 1V0JA 3DHNA 1DFHA 1EE2A 1NM5A 4DTIA 3RIHA 3FBGA 3EZLA 1LDBA 1CRWG 1YOVA 3WQSB 2EJVA 2QW8A 3DZHA 4BGEA 2Q2QA 1ADFA 3ONDA 3LU1A 1ZIDA 1GCOA 4J4HA 4TVBA 1E7YA 5I7EA 4AG3A 2OORA 4YR9A 3KYCB 1UZLA 4TROA 1QLHA 1QKIA 3AK4A 1NFFA 2B36A 4IY1A 1QYWA 3BA1A 2VRCD 1N1EA 1TB4A 4XX0A 2VRBA 3CIFA 4O59O 4M87A 1F17A 4E3ZA 1TEHA 4D0SA 3H2ZA 2AEJA 3FNFA 4HV4A 2P68A 2VHVA 4LMPA 3JQEA 5DZSA 4E5NA 4Q9NA 1LLDA 3NDIA 3PGXA 4B8ZA 4EZBA 4WNCA 4R1NA 4ID9A 3VZRA 1ULUA 4HBGA 3JD1A 2GZ1A 3GG2A 1MGOA 3FNHA 2ZYDA 4OH1A 4FC6A 4GX1A 4A73A 1WNTA 2ET6A 1YS4A 1GZ3A 1P0FA 4UAGA 2O4UX 4XEHA 3PJFA 1PQWA 5DT9A 1UDBA 3RC9A 3W8DA 2YW9A 4LCEA 4Q3DA 1NHWA 1PWZA 2PH3A 5BSGA 1E7MA 1BSVA 3D5TA 3BTVA 4B3IA 3F5QA 2P9GA 1S6YA 4GQAA 4MPDA 3L9XA 3ZHYA 3S55A 2YV1A 4TVOA 1BMDA 3L6EA 4DMLA 1MUUA 3R1IA 4DVJA 4LISA 2AA3A 4RO0A 3VKVA 3K31A 1WAMA 3U4IA 3VZPA 3RD5A 2JHFA 2Q50A 5T57A 3DHEA 1RYDA 3VC7A 3QW2A 2HMSA 1PGJA 2FPPA 4BQRA 3DONA 4CM9D 2O3JA 3D4PA 5F5LA 3V8BA 2NU6A 1LDYA 4MINA 1Y8QB 2R00A 4EJMA 3TZCA 1B3RA 3BHIA 3IUSA 2E37A 3AY6A 3WGOA 4BHTA 4B7CA 2I9PA 4KWHA 5KVVA 4IQ8A 4JJGA 5JLAA 2VUTA 4EEZA 3ASUA 4CQLA 4TMFA 3LC7O 3F47A 1T2AA 1XG5A 3NT4A 4ND4A 4PZEA 2FR0A 4XGIA 4DBZA 4BO0A 1N2SA 1NXQA 1OI7A 2D5CA 1CEQA 1KC1A 2B37A 1NVGA 1DRWA 1VSVA 1Y81A 3RU7A 4GL4A 1DBVO 2NQTA 4ZQFA 1QYDA 2CDCA 3CUKA 3DBLB 4MVJH 2QZ9A 1WZEA 3JSAA 3RUCA 2ZB8A 1P44A 3MWEB 1UZNA 4IS2A 5ITVA 4FW8A 1I2ZA 4CR6A 3E5RA 3MZ0A 3PLRA 4BS9A 5DBFA 4BNXA 5A9RA 3JQAB 1A71A 3UHAA 4EJ6A 3QHAA 3DBHA 4ZQGA 5BR7A 4YACA 3RUHA 4B7XA 1PZEA 1OBFO 2DUWA 5KJCA 3L07A 4ZQHA 3DOCA 3Q0EA 4Z9YA 4DWVA 2GN9A 1MFPA 3F1KA 3VH3A 1YBAA 1T1RA 4KQWA 5LDHA 2NTVA 3ZDFA 3ZWYA 3KM0A 1VJ0A 3UKOA 3ZH2A 2YFQA 1UXKA 2NVUA 3UICA 1VL0A 3WOHA 4B79A 5AYVA 2GO1A 3H9QA 2Q99A 3RAJA 1DSSG 1GQYA 1WMBA 3BHJA 4FSHA 4BO7A 4D3SA 4QFCA 2BI7A 1PL6A 3UCEA 3ZWWA 3ZNPA 4JX8A 4CODB 5JSFA 1E6EA 3VKUA 3OBBA 1X0XA 3BMQB 1Q7BA 1YL6A 3B1FA 1HDYA 4Y6PA 2H63A 4X54A 4ALLA 2X9GA 2ZTUA 4ND5A 2YZ7A 2B69A 3ZHZA 1KIFA 5G0SA 3CSDA 4QQRA 3Q9NA 5AOVA 5GZ1A 5ENDA 4IXTA 4KTVE 2ZK7A 4PGFA 1HE2A 3LZ6A 5IN4A 2JL1A 1XDWA 1PL8A 4J4TA 1C1XB 3DWFA 3CZMA 1ADBA 2HKIA 4LVUA 2OBYA 3MJTA 3WMXA 4GGOA 3E9MA 4FOSA 1PJSA 2D0IA 2EKLA 1B26A 2VT3A 5JDCA 1HDCA 1ZEMA 1DC5A 2PD4A 2O3SA 4AJ2A 4AJOA 5JCJA 3BMNB 2JAHA 2Q49A 4RPJA 1C3VA 1H6DA 3X2EA 1DJQA 2J3IA 1I3LA 2RH4A 3D3WA 3LVFO 3JD4A 1BW9A 2BFOA 3HB4X 4AJLA 4R68A 1UXHA 1IUKA 1F06A 2OHXA 4PVCA 3U62A 2BLLA 5I9MA 3NT2A 4ALNA 1WW8A 1WWKA 1ZK2A 1A7KA 3GDOA 1IYZA 4B3JA 1MLDA 1JVBA 1XA0A 1YB4A 3DHYA 1JU9A 2RHCA 4B3HA 4JGBA 2NACA 1U1IA 2GR9A 1LXCA 3C7CB 5JO9A 2X23A 3H5NA 3S8MA 1P1IA 2ZTVA 2HAEA 4LCJA 3FR8A 2VN8A 3OJEA 4FFLA 1LRJA 5JO0A 2ZB4A 1D4FA 3R6DA 4R3NA 3P2OA 4MKXA 2BFMA 2DTXA 3WG9A 5KJFA 2I76A 4BO5A 1ZXBA 3WMWA 2H9IA 3WYCA 1DJNA 4H7PA 4CL8A 3W6UA 4BNIA 1BHSA 2YHUA 2PNFA 3E9NA 1QLJA 5KNLA 4XYMA 1H9BA 3DBLA 4G65A 3UF0A 3R3JA 5BQFA 1IPFA 2YY7A 3GGGA 5IXYA 3GUYA 2R2GA 4RZHA 1Y9AA 3SLKA 1KEWA 3DBVO 1V35A 3GVXA 1DIHA 4CLOB 4W99A 5IZCA 4UVGA 1NPDA 5T8KC 2IZ1A 1D3AA 2W4QA 3L6DA 4YB8A 1JA9A 1E7RA 3SBOA 4B7UA 5EJ2A 3AY3A 3GNSA 4L0QA 4Y6SA 1ISJA 5A02A 1RPNA 3ST7A 1E77A 4H15A 1GDHA 1XQ1A 4CMIB 1E3WA 3DZBA 4LK3A 3RKRA 4NBTA 4OHUA 4PZCA 2Q46A 4OQYA 1AHIA 1GU7A 4E5KA 3OSUA 4PLZA 1I24A 4RQUA 4RVHA 1SO8A 3OJOA 3OF2A 4E5MA 3RU9A 1EK5A 4WASA 2EKPA 4QT0A 4HKTA 2RCYA 5A03A 1I33A 2OO5A 4QFDA 4RL6A 2VYND 3FTPA 3MTGA 5BSHA 1VPDA 4NFSA 4IBOA 1L7EA 2DBQA 3RUFA 3VVBA 2Q45A 2E4AA 2ZKLA 4MP3A 3JQ8B 4IZIA 4RDHA 4RDIA 3HE3A 3L9WA 3ZZNA 1N9GA 2EF1A 1B15A 1LSUA 2O3QA 4HUJA 8LDHA 5JXWA 4DYDA 5AXDA 2VWPA 4YAJA 5T5QA 3L0DA 3PZBA 2AE2A 1S7CA 2CFCA 2FHSA 4GPD1 4LW8A 4PVDA 3VH1A 4MIOA 4G5HA 1CIVA 1U5AA 1IE3A 4GKVA 4EITA 4RVFA 3M6IA 4BV8A 4FB5A 4MVJE 4CMJA 1J4AA 4K28A 5KVQA 1NBOA 3UVEA 4M1QA 1XELA 2OOSA 5JW6A 1V9LA 3CMCO 4IIUA 1LBEA 4YQZA 3DFZA 4HY3A 2CZCA 3M1LA 3GY0A 1B8PA 1YJ8A 4OIMA 5G2OA 1GZ4A 1NWCA 1QMGA 1M76A 3GZ4A 3PWKA 1JVSA 3W4IA 1QRRA 1MXFA 5JYDA 5AXAA 1TLTA 4M54A 1F14A 1Y5MA 1E6WA 3KSDO 1CERA 1A4UA 3PVZA 1BWSA 3NUGA 1PJQA 4TZTA 4ZRMA 4EJ0A 1PZHA 4MVJG 1WPQA 4WKGA 3SXPA 2QZZA 5KKAA 2PY6A 3VPFA 4E0BA 2O7QA 3RFVA 3DMYA 1C0IA 3K73O 3A4VA 3IDSA 4JQCA 2WM3A 4J0EA 1H6AA 1DPGA 1DHRA 1FDSA 4FS3A 2EV9A 5ICSA 1BVRA 2Y1OA 4GMGA 4INAA 1NFRA 1I36A 3E18A 4TKLA 3GDGA 2OGUA 2UVDA 3QWAA 3UFXA 5HBRA 4CLEA 3D3EA 4GBJA 4PG7A 3NEPX 3UN1A 2C2YA 1FDWA 3ONFA 4UVHA 3UW3A 3TZQA 4CR7A 1X14A 2PK3A 4HX5A 4I5EA 2NTJA 3FTNA 1Y5RA 3OEWA 4BNNA 3LT4A 2E6UX 4DLLA 5CHEA 3FF4A 2B5WA 4U0KA 1ZEJA 1U7TA 4IQGA 4TRMA 2A4KA 2GD1O 2DBZA 4MVJP 1GL3A 1ENOA 3RVDA 2EG9A 4Y6RA 2DQ4A 2X4GA 1GEEA 3OJLA 4R1UA 1LEHA 4E2YA 4WGGA 5L4SA 1I3NA 1X7DA 3F5SA 4FGWA 1HDXA 4MKZA 5CEJA 5TLSA 3DDNA 4YTEA 4JIGA 2YQ5A 2PGJA 4PIVA 4BV9A 3PJDA 3AUTA 5U4QA 3UAGA 2D4AA 2OFPA 2EGHA 1E6UA 5CDUA 5JFOA 4NPCA 4EUEA 4W9NA 3I9MA 2YDXA 3OQ6A 3GEDA 5HTOA 2VNSA 2X0NA 3MOIA 4NK5A 1P74A 1DB3A 5LDGA 4DPKA 3ZN2A 1GZ6A 3D1LA 1XSEA 1EVIA 1K0UA 2FP4A 4MVJA 4RPKA 4WCFA 4BNFA 5TX7A 1CQIA 1SB9A 2UDPA 4BIIA 4YAGA 4N5MA 4CM9A 3QSGA 4ALKA 4TRNA 3K96A 4AJEA 2Y0EA 1YQGA 3KYDA 3DZKA 4GH5A 3ZU2A 1YOVB 2PD3A 2EKQA 5AQ1A 1EZ4A 1K5HA 1IL0A 1DLIA 1N9GB 2YV3A 3DR3A 3PHJA 4O63O 2BI8A 3NRCA 3NX4A 1E1NA 4OMUA 4FDAA 3E1KA 3ZNOA 4BO1A 1HKUA 1R4MA 2O48X 2TMDA 1R6DA 3GGOA 1P3DA 2Q1WA 3DL2A 1C0PA 3KHUA 1T2EA 2YDYA 4GWKA 3WGZA 4ALJA 1MG5A 2CF5A 2O2SA 4IJVA 3WGGA 1KERA 3VDRA 5C7LO 1DEHA 2Y0CA 1UUFA 3N58A 4YA6A 5TF4A 3ZWNA 3SEFA 1Y6JA 2V6BA 2HK9A 1NR1A 1RM0A 1U3TA 1XEAA 2I65A 3GRPA 1JAYA 1BVUA 4Z0HO 2HCTA 3AM3A 4MJLA 3FN4A 4I9HA 4CLHA 4GLLA 3AU9A 4ESOA 1RKXA 2HJRA 3AM5A 4CMIA 3TOZA 1ENZA 1UP4A 4ZHSA 5ES3A 3KB6A 1NYTA 4DUPA 1SAYA 4Q3EA 3QQPA 3UXYA 4YBZA 2X86A 3DBRA 1QP8A 1H94A 4JBIA 1HE4A 4BGVA 4D3DA 5JAIA 2CVQA 2HK7A 4CLRB 4XGNA 4BL5A 5L7TA 1IOLA 2C82A 1NVMB 8ADHA 1B7GO 1VJ1A 2BKAA 2NTNA 3RKUA 2XPCA 4EBFA 2NU7A 4IS3A 2EP7A 4R41A 1EVJA 4ZJUA 3PFFA 5TRTA 3JYQA 3MJ4A 3ZU3A 4UVDA 4KMSA 4YT4A 1U28A 1H93A 1LA2A 4FFNA 2OUIA 2P91A 4JBHA 4K26A 1HDZA 3TF5A 3LC2O 4NBUA 4NNJA 1J49A 3OICA 1C1DB 5AVOA 3WS7A 1G0NA 5KIAA 2O50A 3ANLA 3B1JA 2ZJ1A 2Y1CA 1D7OA 3QRWA 3WLEA 4PLPA 3W4JA 4CLXA 2OL4A 4IPTA 4PG6A 1JKFA 5IDXA 3PDUA 4XB2A 3TQHA 1XHLA 2W2LD 4JJFA 4FJ0A 4U6SA 3ZWBA 4RCVA 1I5RA 4TKMA 5CP8A 2CDBA 2JCVA 4CV0A 1VC2A 4GAEA 2DLDA 5TC4A 4K1LA 5IXSA 3UCXA 1YDWA 2DTEA 3GMDA 4W4TA 2JFGA 4FCCA 5I8WA 5EESA 1G1AA 1YQXA 3CINA 2O3TA 4YRBA 5A5EA 1KVQA 3HFGA 4MIYA 3ZGYA 4NBWA 3TJRA 4NMHA 2B4TO 3VPXA 2C5AA 1VL8A 1U8FO 4A5OA 2QIOA 1PZFA 1K6JA 5JE8A 4EYEA 1N8KA 5G0VA 1ZH8A 3RUEA 3HDQA 2GCGA 1JKIA 2IRWA 2Q1UA 4UEJA 4YT5A 4WPGA 1D1TA 4RVUA 1LLUA 2I99A 3ETEA 4WEQA 2DBRA 4E30A 2GGSA 2IZ0A 4HNHA 1T24A 2V65A 1HWYA 1XU7A 2W98A 3ORFA 2C0CA 3C1AA 1P1JA 3SX2A 1AE1A 5ICMA 2C07A 4W82A 1GEGA 1GD1O 3QWHA 4IMRA 3G49A 4FFPA 5G4LA 3MJEA 4BNTA 3D5QA 4D46A 3I6QA 6ADHA 3MCVA 5BNTA 5CDTA 4N18A 1FJHA 3KOUA 4YXFA 3UOGA 3GZNB 3V1TC 4BNKA 5C5IA 3AUUA 3KEQA 4W9NC 1R12A 2FSVA 2NU9A 1DC3A 2AQIA 4ZGWA 5CG1A 3WNVA 1N7HA 1LTHR 4J1NA 1LUAA 3PHLA 4A7PA 4I9UA 1OFGA 3LQFA 4JK3A 4BKPA 4BQPA 2BHLA 4BNVA 3FPLA 4UUOA 5DULA 3AOEA 4E13A 4CLOA 4JP3A 1Q0LA 4CL3A 5EPOA 2HMWA 1ONNA 1I10A 4CJXA 4Z6KA 2DVMA 3QVWA 4OM8A 1DAPA 3TZKA 4R5HA 3OQ1A 1IPEA 1F8FA 1A9YA 1R0SA 2C7VA 4GSKA 4YJHB 1J6UA 1GAEO 3FWNA 1BGVA 1E3EA 3GFBA 3EC7A 5G4KB 1LNQA 2PGLA 3DZGA 2I67A 3HSKA 3PQDA 2Q1TA 3WB9A 3C7DB 1A4IA 3K9QO 3P7MA 2G17A 4G81A 4RLSA 1F8GA 2J8ZA 3CKYA 5TJ9A 3ANNA 3V2GA 1I2CA 3HWRA 2VHZA 4FC7A 3LF2A 3KLMX 1Z7BA 3G3EA 3ONEA 3FD8A 3RROA 5DDIP 5HM8A 1OAAA 1NVTA 3K2EA 4FBGA 5TSDA 5JDIA 1PJCA 3ZWPA 4C7JA 2WTBA 1LU9A 3DQPA 5A06A 3JQAD 1DHTA 1ENYA 4MP6A 2POQX 4BO2A 4YJFB 3O8QA 4P22A 3WLFA 4CMAA 2AQHA 4EI2A 2JD2A 2X5OA 5L95A 1EK6A 1P1KA 1I30A 4OKNA 2C29D 1OC4A 2D8AA 1KC3A 3IL2A 2NV6A 3SJUA 1KEUA 3Q9UA 4IQ0A 4D43A 1SMKA 4D3FA 1CQJA 2ZJ0A 5HWSA 3DZJA 3ZHBA 1DIBA 1B2LA 4CM4A 3DB2A 3ZWAA 2O2YA 3AUSA 3HN7A 1BTOA 3IC5A 2J5QA 4URFA 1ZSNA 2GASA 3BMNA 1U2DA 2DPGA 4KUHA 2IE0A 2Z1NA 1YJQA 2X1HA 4XDYA 1TT5A 1Y8RB 4CLDA 4E5YA 2G76A 4TQGA 2OXIA 4O0LA 1UXGA 4MVJF 4CM8A 4EW6A 1HE3A 3I9NA 5FF9A 4K6FA 2PKRA 4Z0TA 5B12A 3LT0A 3I9KA 3ROMA 1BXGA 4J7CA 4IXWA 3U4DA 3K8ZA 3DC2A 3SLGA 1U3VA 3QP9A 1SOVA 2D59A 3PHGA 4ND2A 3JQGB 4PLGA 1EBUA 1G0OA 2AEMA 2VOJA 3AFMA 2Q1SA 3D4OA 3RBZA 1P9LA 2AQKA 4YDRA 1GYPA 3HG7A 4UEKA 1JQBA 4KWIA 5IDYA 4BGIA 5KKCA 1KEPA 3BMQA 5JCXA 1Q7GA 5ER9A 4GI2A 4NG5A 1U2GA 4F6LA 1Q7CA 2CY0A 4PRKA 3ZU5A 1ISMA 1UZMA 5B37A 4S1VA 2Q2WA 2X0JA 2J3JA 3EVTA 3CMMA 3LC1O 1K3TA 2O7SA 4XD2A 4E2WA 4RF3A 3SVTA 1YDEA 4FFOA 4DPMA 4J1TA 3V5NA 1IHXA 3BMOA 1E3LA 2DKNA 1ZKMA 3GG9A 3IAHA 1NQOA 2AMFA 2UAGA 2VTDA 3WQRA 1HDRA 2ZQYA 1YH3A 1JWAB 2PZJA 2A35A 1LDGA 1JWBB 1ZMOA 2JJYA 1C0KA 1YKFA 3OJ0A 4XZ3A 1XQ6A 2DBVO 3JV7A 3Q2IA 4BKOA 5ENVA 1MA0A 2E82A 3QIVA 2R6JA 1EDZA 1W4ZA 3I9LA 4BKRA 1VKNA 3FHLA 1C1DA 4FIZA 5TQVA 5HS6A 3LSYA 1QORA 2GLXA 2Z1MA 3T4EA 1W0CA 3GAZA 1LLCA 2FPGA 3RFTA 3ON5A 1UXJA 4P4NA 1NR7A 3NTRA 2X22A 5T67A 1SEPA 4WOJA 1CJCA 3DBRB 3RBVA 4GKBA 1E1LA 4ZICA 1FF9A 3E8XA 3HJAA 1GYRA 4WE3A 4CLRA 3E6AA 1AXEA 4N7RA 2NU8A 5CAEA 1KEVA 3CEAA 3RC2A 3JYOA 4R9SA 1ISHA 1DAOA 3JD0A 1A7AA 4WLVA 1UAYA 3E03A 1EQ2A 4BMVA 1E5QA 4Q39A 5IDWA 2Y67A 1MX3A 3RWBA 4G2NA 5JYEA 1EDOA 2WYWA 3FI9A 3ZV4A 4S3MA 4RPGA 3JQ7A 4GLOA 1Z6ZA 4ILKA 1EQUA 1SB8A 4R5MA 5JC8A 3LLVA 5EINA 3H9JA 4I5DA 1PJ4A 1XCBA 4PN3A 1Z74A 3I6IA 1DFGA 1KYQA 3NDRA 2RBEA 1E1MA 1VRWA 1P45A 4NJOA 3JQFC 4PG4A 2BD0A 2GRAA 5CDYA 1UR5A 4LGVA 1E1KA 5I7SA 5F1KA 3JD3A 1NQAO 2VYVA 3JTMA 1O6ZA 5G0TA 3UH1A 1E7QA 4GX5A 1DIAA 4J2HA 3O9ZA 3PFWO 2X5JO 2JAPA 2Y68A 3F9IA 1ULSA 4WCDA 5C3MA 2I5PO 3KZVA 1ADGA 2I6TA 4BNYA 1A5ZA 1O8CA 3Q6IA 4BB5A 5EQFA 4UVEA 4FQ8A 3F3SA 2OZPA 3PDJA 4R3WA 1XIVA 2IZZA 4XGKA 3T7CA 3W4KA 1X7GA 2QHXA 4E5PA 5IDQA 2H6EA 2YJZA 2NNLD 2EGGA 3H65A 5T8KA 2FRDA 3A06A 4GWGA 1OOEA 3D0OA 3PRJA 5FYDA 5MGBA 1Z45A 1N7GA 1RM3A 2HU2A 3ROKA 4R54A 4GGPA 4II3A 1HTBA 5KJ6A 1TT7A 3WDSA 2G5CA 1EMDA 4MO2A 2WMDA 3JCZA 3PYXA 4IDAA 5FWNA 1HSZA 1PGQA 3LK7A 5JPIA 4Q3CA 2X6TA 5B1YA 4KQXA 1GQQA 4U6QA 4XQEA 4WLOA 2X58A 5THQA 1HT0A 2NVUB 1JTVA 4JLWA 3WICA 5JS6A 1H9AA 1VI2A 1KBZA 1SZJG 1Z73A 1ENPA 2X0RA 3M2PA 3OETA 4AICA 3BMCB 3FBTA 4RZIA 4A0SA 3HB5X 3N7UA 2HJSA 3EZYA 5TS3A 5FFFA 4AJKA 3ENNA 4NDNE 2XXBA 2GPTA 2Y05A 1RWBA 1SEVA 2Q3EA 2HDHA 3HADA 3L77A 1ZW1A 5JCJD 5TNXA 4AJNA 3QVSA 2VUUA 5DCWA 3I23A 2FN7A 2WD7B 3WFIA 2DUUA 6LDHA 5GY7A 3ZI0A 5C37A 3D64A 1YONA 3MOGA 4PZDA 5HA5A 5KJ1A 1E3JA 2B4RO 1ZCJA 1M67A 3E9QA 1ISIA 2PZMA 1PEDA 4BMNA 3S2EA 3RUAA 3ZV6A 1EUDA 2HK8A 4F6CA 4OJNA 5KVSA 1RM4A 1MFZA 3WSWA 2DFDA 1U5CA 3MJVA 4AJHA 1LDEA 1EFKA 4YVFA 3TN7A 3ZNNA 4OOFA 4UVIA 4GVXA 1PQPA 4NFYA 4BUCA 2QX7A 1LC3A 2VT2A 3NGLA 3WNQA 3HHPA 1LRLA 5L3ZA 4AJIA 4WUVA 1KETA 3C7AA 2NVWA 3GOHA 3DMTA 3PGJA 2BGMA 1JW9B 2UUOA 4M89A 2BF7A 2X7HA 3OIGA 1T2CA 4XRRA 4J1SA 4KTTE 5K6AC 4HFNA 4BGUA 2NADA 5CPFA 1BDBA 4D41A 1GUZA 4YJFA 1WMAA 4YJHA 5G4KA 3P5SA 1I01A 4BNHA 2VWQA 1ZZEA 3G1UA 2CUKA 3QWFA 1VM6A 4BNMA 4ZA2A 4PFJA 3C85A 4EUFA 1DC6A 3GNQA 3L4BC 4RVDA 1BXZA 3ETDA 5B4TA 3F1LA 4E6PA 3GEMA 2AW5A 2WE7A 2O3RA 4MP8A 1YL7A 4OL9A 2HQ1A 5KVCA 3RSHA 1T25A 1IZ0A 4DBVO 1I3KA 3FSRA 1E7WA 3U0BA 1Z82A 3GN2A 1I8TA 4KP7A 5L7YA 4TRRA 4ND3A 4YJGB 3WWZA 1WDLA 2JHGA 1XGKA 3IMFA 4RF2A 4XKJA 3EK2A 4ZD6A 2J5KA 1O89A 5L4LA 3KTDA 3R3SA 3VAZA 1DO8A 3BZUA 1BW9B 4CUJA 2YV2A 3MJCA 4FD3A 4HFMA 2PFGA 3WGYA 1CDOA 2ZTMA 1PJ3A 4IZHA 2RHRA 3A1NA 1XKQA 3S2GA 3UGKA 1ZJZA 5L45A 3JQ9A 4XJTA 4WECA 1PX0A 1DRUA 2ZYGA 4YAEA 2VZ8A 5BNIA 3GH3A 3SJ7A 5F5NA 5L7WA 2OBNA 4UUNA 3GT0A 4XYBA 4XYLA 1E5LA 4XA8A 1R37A 3ZHXA 1V3VA 1ZK0A 2ILTA 2VWGA 3LDHA 3W6ZA 4J9VA 4IINA 4MKRA 2VNAA 5L9AA 2IYOA 4P38A 2PD6A 1E0DA 3RJ5A 5L51A 3ZU4A 3SC4A 4ONEA 4CM8B 4D7AA 2NVBA 2V6GA 4GVLA 4DXHA 3PQFA 3TOXA 5JDIC 1E3IA 2DC1A 4YYZA 1PTJA 5FI3A 2J3KA 2ZYAA 4BOYA 2Y66A 3EAGA 1TI7A 2FZEA 4FOOA 1H2BA 2X9NA 4CUZA 2CD9A 4NR0A 4TRJA 3DTYA 2X0IA 5I7VA 1X1TA 3KYCA 4O6VA 4J2OA 1O0SA 4XJSA 2CVZA 3NV9A 3AI2A 1SC6A 1HDGO 3KV3O 4JXKA 2O3UA 4UUMA 1Z7EA 4Y67A 2WYVA 3PHIA 4TZKA 2GZ3A 1J5PA 1GUFA 4LN1A 4CV1A 2ZIZA 1I32A 4IDBA 2HO5A 1PWXA 2B35A 3PK0A 2Q4EA 2WSBA 1OC2A 4NZ9A 4WK6A 3U09A 2WWRA 3LT2A 4LMRA 2VTEA 5JMWA 5COQA 3WX0A 1X0VA 2R00C 4GMFA 3FRJA 4NHEA 3GHHA 3ULKA 2ZCUA 3B70A 3GVCA 4ZQEA 1FDUA 3AWDA 4HNGA 5IZCC 4BO9A 4CM3A 2X9VA 2AQ8A 1AUPA 4ROSA 1AXGA 2VRCA 5DOVA 2HMVA 3VPSA 2CF6A 2NSDA 3HDHA 3P2YA 3OIDA 3TNLA 1U7HA 3RASA 1H2HA 4DQXA 1PSDA 4XWYA 5CDGA 3B1KA 3O8QB 1LC0A 1PJBA 5BT9A 3PWSA 4B4VA 4J7XA 3ZV3A 4BNJA 1VJTA 2EP5A 3AOEC 1HE5A 3C24A 5F1PA 4N5LA 3IP3A 2HMUA 3OECA 5DP2A 4DQVA 1QXSA 2RH8A 3WJAA 3OHSX 1ZSYA 4D44A 4XQ9A 3VOSA 1QYXA 2QYSA 2Z5LA 1DIRA 1H6CA 3IJPA 2PR2A 3RC7A 5JAQA 2JFHA 1FDTA 1LSJA 2FSSA 3AW9A 4CMEC 3FNGA 4L9RA 3ZNQA 1VLLA 3ROQA 2OP0A 3GQVA 2V6MA 5C7IO 2UYYA 4CPDA 2EXXA 4M55A 5CEEA 4MVJI 1ARZA 2Y1FA 1KY5A 5A04A 5BSEA 3H8VA 2D1YA 3UUWA 3COSA 4J1QA 1HL3A 5U9CA 4FR5A 4OXNA 5L53A 1MV8A 2P2SA 4CM1A 1PS9A 5JAZA 2H1SA 3UCFA 1V3TA 1DRVA 2GUGA 1D8AA 1DXYA 2LDBA 1ONOA 3DXFA 4WEOA 4GX0A 4NJMB 4DGSA 4L74A 4OSOA 1NFQA 3JQ6A 3PIIA 4YWJA 1BXKA 4A03A 5COAA 5IN5A 1LDNA 3BTUA 3STHA 1Y7TA 3DMTC 2JD1A 3EVNA 3G0OA 5ER6A 2D2IA 4O1MA 2FWMX 1LX6A 5KCZA 4Z9XA 2Y93A 2VZ0A 2YQ4A 1XYGA 1MB4A 5A9TA 1AHHA 4IDFA 4XRGA 4CM7A 5GZ3A 1H0KA 4IM7A 3WGQA 2QRJA 1B16A 1CF2O 2V7PA 3ADPA 5A5FA 2NM0A 3OA0A 3IUPA 4F3YA 3DAPA 2QRKA 5JMPA 1X15A 3U4CA 2VOEA 4WLFA 3JQ9C 1OZAA 1PS8A 4DLAA 2PKQO 1KVUA 1D1SA 1YVEI 3HQ4O 4R01A 2RIRA 4I8XA 4NIMA 4J7UA 1B8VA 3EMKA 2W8ZA 1PQUA 2PZLA 4EDFA 4RGBA 1U3UA 1U4OA 1HSOA 5TIIA 3PLNA 5CPBA 5THKA 5H83A 5A9SA 5A05A 4CM6A 3BAZA 3WGTA 3ZV5A 4NBRA 2GDZA 3TDKA 4TWRA 3ZWOA 3PHHA 3QA9A 4Y8VA 2Y0DA 5H81A 4BKUA 3KSUA 1C0LA 2C59A 3KVOA 3RJ9A 5A3VA 4CQMB 3VDQA 3GK3A 3WSVA 1U8XX 1DC4A 3I4FA 3Q3CA 2WE8A 3CTMA 3AFNA 1HYGA 1HYHA 3AI3A 3I9JA 4II2A 4DQUA 1YBVA 2B0JA 1F12A 4FPXA 4OO3A 3U4HA 3VTFA 5IAAA 2VHWA 4J3FA 2UUPA 4QXMA 4WNIA 1EE9A 2A94A 4RVSA 5ITWA 3I4CA 4BKQA 4YT2A 4P4LA 3KXDA 1GYQA 1PZGA 2VYNA 4I5GA 4A2CA 1ML3A 4LRSB 3VZQA 4BO4A 1Y9EA 1IZ9A 3JQCA 2IXAA 5TT1A 5F21A 4J4BA 4QSMA 1M2WA 3E82A 1FXSA 1UP7A 5DCYA 4AFNA 1WXDA 1P0CA 2FR8A 4RLHA 3W8EA 1T4BA 2EEZA 5TJHA 3ABIA 1R4MB 2WYUA 5A9SB 3CH6A 2H5LA 3QVOA 3WXBA 3C1OA 1BRMA 4CUKA 3VTZA 1LLQA 2GERA 1MC5A 4L73A 4UULA 2SCUA 1J0XO 2P9EA 3RQSA 1QV7A 2CSUA 3PQEA 1NAHA 1FDVA 4WCFB 3AY7A 4Q3BA 3RI3A 1K2WA 1X7HA 3QVTA 4EGFA 2ZTLA 1ISFA 1JDJA 3GFGA 1N1GA 3HDYA 4L8VA 4NJMA 4OGWA 4CR8A 1O95A 4YPOA 5B4VA 1QSGA 1WLYA 1ZNQO 4HP8A 1DIGA 2C54A 3INRA 1HDOA 3MJSA 2B83A 3GZNA 4R9RA 3WFJA 5G0WA 2PA3A 3INGA 5EERA 4DIBA 3GRKA 1HZJA 3O03A 5MDHA 1HRDA 3SC6A 2I3GA 4BNWA 2BMAA 2BH9A 3GPIA 4W7HA 4A10A 2GNAA 4K6CA 3T7EA 3JQ8A 3JYNA 1M6HA 1TT5B 1Y8RA 4YRAA 3FCOA 4DMMA 3G79A 1VL6A 9LDBA 5JAMA 1UAGA 1FMCA 5J23A 3DEYX 1NPYA 3A9WA 3L4BA 2AG8A 3E5MA 1T4DA 3PPIA 3M2TA 1H5QA 3MEQA 1GUYA 1O94A 1HF3A 1P1FA 4AVYA 3VPGA 3KEOA 2DFVA 1UJMA 4FFRA 4ZRNA 3H3JA 2EW2A 2IEBA 2G82A 4J90A 1EBFA 5COBA 1EEHA 4JJIA 2XF8A 1QYCA 3BYZA 3KETA 1ZK4A 5KWEA 3KLPX 2PV7A 4AJPA 5GZ6A 1EUZA 1YO6A 4LSMA 4KZPA 4QECA 1AGNA 3CZRA 1YQDA 2C5EA 2HLPA 1UP6A 1E3SA 3NJ8A 5EQDA 1DFIA 5AXCA 2C20A 1ONPA 4O5OA 3WQQA 4J49A 3M1AA 5JNLA 5KTKA 2GF2A 2CVOA 3QWBA 4PRLA 3TZ6A 4CMHA 4MIEA 3D7LA 1V3UA 4PLTA 2CMDA 2IXBA 2WEKA 1MG0A 1SOWA 3WYBA 3OM9A 5TT0A 1HLDA 1TA4A 2FZWA 2J5RA 2OMEA 1B14A 3G1TA 2EWMA 4L4RA 4PLHA 5I8ZA 1L7DA 2YHIB 1X13A 1GADO 3GEGA 3JD2A 3FPCA 4WLNA 4A27A 2VZ9A 1YBMA 2F00A 3H6KA 4Q3NA 3VH2A 4F45A 4DPLA 4WLUA 3D3WB 4KOAA 1ZK1A 3Q2KA 3I3OA 1B0AA 3U3XA 2X8LA 2GZ2A 5KOIA 3PTZA 3GDFA 1AN9A 2QG4A 1EFLA 4B4UA 3O38A 4OSPA 1YWGO 3H5AA 1NQTA 3ASVA 4LRTB 4ZN6A 1Q2XA 3B20A 3H2SA 5IZ4A 3D4NA 5ILOA 3QLJA 1Y8QA 3H7AA 2EHDA 3ETGA 1NQ5A 2D5AA 3HNPA 1GV0A 4DLBA 4YT8A 2QRLA 2HRZA 4ALMA 4E31A 2XXJA 2BFAA 3MWDB 3RCBA 3QV1A 4HWKA 5T6BA 4UREA 3GN1A 3AOGA 3H9EO 4IGEA 3BHMA 1X1EA 3S2IA 3Q11A 3QY9A 4WLEA 2VHYA 4J91A 3PP8A 5L40A 2BGKA 1A9ZA 3JQDA 3ITDA 3INTA 5BNFA 1U4SA 2AG5A 3TL2A 2VYVD 3F6YA 1JKJA 3PYLA 5DN9A 4JCOA 4BVAA 1EUCA 3ITKA 4J9UE 2D3TA 4YAIA 4ZU3A 4NBVA 1SNYA 3BMOB 3PEFA 3PZRA 4DRYA 2O4CA 4XIYA 1ZXLA 3V2UA 1BXGB 4CV3A 7MDHA 1GQ2A 2HRBA 1HYEA 2P4HX 5DCUA 2PLAA 2PWZA 1KOLA 4DYVA 1ADCA 1XLTA 3BXXA 3C3XA 2C7GA 2G0TA 5EL0A 1TVEA 3RBXA 4E4YA 5JY6A 9LDTA 3PJGA 4N5NA 4RV9A 1LSSA 2Y1GA 4BO6A 4LSWA 1R15A 4P4GA 3JQBC 1O9BA 3KYDB 4R1SA 4OXKA 3TSCA 1M75A 4U7WA 4UEOA 1PS0A 3QE3A 1W6UA 1GFSA 1YB1A 1ZFNA 3WBBA 2DPHA 4H3VA 1I2BA 4AJ1A 4IDCA 3KBOA 2AXQA 3QVXA 5K0ZA 4RF5A 4JNKA 1GPJA 2PZKA 3DOOA 4J16A 1HEUA 1IB6A 3F46A 4IJUA 1V6AA 3AJRA 4NU6A 4PLFA 1NWHA 5A1TA 1CYDA 1PR3A 5TGDA 2JD0A 3FWZA 3W1VA 3IKTA 1WVGA 3VZSA 5FEUA 4ND1A
chains in the Genus database with same CATH superfamily
5E2BA 2CK3D 3OQMA 4REOA 5BORA 5D7BA 1J0DA 1DX9A 3LUFA 4RD0A 4ABYA 1HO3A 3D8UA 4FXPA 2XTJA 4ZI2A 1OYOA 2OP1A 3OU7A 2GZAA 2IU4A 4F71A 1DCTA 2XUFA 2UZ1B 3PQ3A 4EPTA 4Z3KA 1SKAA 2PXCA 5JH7B 4Z8YA 5LWHA 3HRHA 1CUYA 5AVVA 3H04A 3T3MB 5LQKA 2HA5A 2W9XA 3C6BA 1Y5IA 5ALGA 3ROEA 1SPBS 1XN1A 1NMXA 2GYYA 5FI5A 3KR9A 5GONA 3TZHA 2JIDA 2EATA 3I42A 2VJQA 4DM7A 3DMDA 1U2SA 3WK6A 2XVMA 3OPQA 1ISGA 2GN2A 3O4JA 3H5RA 1E63A 1RWNA 2E4VA 1Z88A 4OKIA 4UQOA 5AIAA 4IUDS 1U7XA 3OD1A 4J6FA 2YASA 9ATCA 3INNA 2O5VA 4QYSA 2C5BA 2ZWPA 1VIAA 1C3EA 4JC0A 4M8SA 3DC7A 3U7GA 2ATCA 3ZOZA 4IH1A 4NDAA 2LDXA 3R7BA 3HZZA 4EIWA 1EHCA 3AONB 3NTLA 1GPDG 2Z6VA 1JXOA 2WD7A 4JEUA 1Q3KA 2OEPA 4IFBA 3N07A 2WOJA 3COVA 5KQRA 3OQNA 3C3MA 2PBFA 2WD9A 4OQZA 1N92A 1CUDA 1FEZA 2PX8A 3DAFA 3EPRA 1ZI6A 3EUWA 4N0MA 1PRYA 1DLJA 3AU8A 1ZS9A 4L76A 4DDUA 4BMZA 2YS6A 2UZIR 3SZGA 1L6IA 4JBWA 4DLVA 3O83A 4U63A 3THXA 3QX8A 3G17A 5CFRA 1Z18A 1ZQ1A 5E1BA 5TS2A 5HKAA 4OB6A 2QAJA 3GJ5A 1U2EA 4EPRA 3FPEA 2A1TS 3OMLA 4CG1A 4O4LA 5U1PA 3L1VA 3VI4B 5IXJA 2OHHA 3W2IA 4HVLA 5K7SA 3AF2A 4B81A 1CY8A 1B3BA 3EVFA 2EIHA 3MCTA 3T3PB 4L02A 4EY5A 1RAEA 5DXFA 3WGHA 1SCJA 3FLEA 1CUZA 1IULA 4MR8B 2B2XA 1K08A 1OLXB 1GPAA 3RYFA 1NLFA 3IP1A 4JP2A 3NS7A 4V0MA 3SS7X 4B9EA 2RG1A 4AJ4A 2FMUA 2BGLA 1CETA 5HF6A 1AKEA 3IOYA 1KORA 4X71A 1EGQA 4ZDWA 3FGZA 4Q4AB 4E21A 1RM5A 1R4NB 4N3CA 3TFQA 3ZU6A 3GWGA 1JEJA 3I1JA 421PA 3MTEA 1P2GA 4HDSB 3OH8A 3NORA 2ZJZA 3UK1A 4FDUA 5BSEA 1K6XA 1XAJA 3QV2A 3TS1A 1XJWA 3W3AH 1FTWA 3EW7A 3DB1A 2QD3A 1WMEA 3JU3A 3ZE2B 1BC5A 4P0QB 2C8JA 4IXDA 4HUQA 3T7KA 2AC2A 4H27A 4IHJF 1OD6A 3EXHC 2E87A 1VRVA 1YRLA 2QZ4A 3FPSA 3FTFA 1BG6A 4PO1A 2CGEA 3QLVA 3SYMA 2OBXA 1L5LA 1GCIA 3DD5A 3IBCA 4WZZA 4HADA 2AEFA 5HBGA 1PFVA 3R23A 5LQAA 1K7FB 1NIJA 4DLSA 1HGXA 4G1CA 4RJJA 3TTTA 4F46A 3GP8A 1KFKB 4JUBA 1W85B 4DMRA 2IVZA 4KAJA 5B5SA 1BAPA 1Q3HA 2EW8A 2IDZA 3ROPA 1HV8A 4X7RA 4BC1A 1EVYA 1TMGE 1VSUA 3ANSA 4TLEA 4Z9BA 4F21A 3O84A 3RUDA 1AG9A 3MTDA 1F0PA 3WE7A 2C31A 4DFDA 3EOAI 1MOZA 3LM8A 3EGVA 1GPNA 1Y4DE 3SLRA 1N0IA 4J0FA 1NBHA 4FZ3A 4AKSA 3EC1A 2IH5A 1XL0A 1FTSA 1MKYA 4TMTA 1AGYA 3HNOA 3WWCA 3K30A 1LB1B 3HUDA 2COUA 4P4SB 4XD7A 2PGDA 3DBHB 3TLYA 4CMKA 1P33A 4QQKA 5EMHA 4K81B 1QZTA 1NN1A 1P6QA 3LYHA 1ML4A 1NXPA 1ZJ5A 2HRCA 2JKYA 1BQ3A 2EFDB 5TDHA 1L1FA 2GN6A 3MTAA 4EPXA 4F2GA 2A5LA 5DE3A 1N5RA 2JPDA 1XQ9A 2PUGA 2P41A 4LYDA 2YUIA 1ZGJA 5IC4A 3WKAA 2OD9A 1Z8DA 2PUCA 1EP2B 1PGNA 2UV8A 2HUPA 3CPEA 2C2MA 3EHEA 5KYYB 2R8XA 1GFIA 3A3NA 3QWIA 4FUTA 4Q3LA 4EPVA 4O4JA 1UT6A 1SKYE 2P4EA 2YXPX 5AH0A 4YMUA 2B21A 1YGYA 1M6WA 2FE1A 2QENA 4Y6GB 4GF5A 2BGIA 2C88A 1NI4A 2WIKA 3CZAA 2BEJA 1BKYA 4LZWA 3Q7PA 2ZIUB 5C2JB 1L3CA 3E7DA 3TL3A 3IBFA 2JF0A 3K6SA 1MO6A 4I9NA 2J4FA 3IMKA 1ZXXA 4MR8A 1XR3A 2I1WA 1EDBA 5CM9C 1JQEA 1PEYA 3E3MA 4IJKA 4OGGA 2O2EA 1TTPB 2P1RA 3BORA 4I50F 5EC8A 4ZC8A 2QX9A 1LSOA 3OMXA 1NI5A 4MRMA 1P5RA 5JARA 1B1CA 1D0VA 3LLSA 4NU5A 4GRDA 1V45E 3N6VA 4LNHA 4AYWA 1DAGA 2O6LA 2R8BA 4MMXB 1O9GA 1XA3A 3RTEA 4IGFA 3S70A 4C4XA 4C7VA 4D42A 5JWOA 4DNOA 1U8YA 5J1TB 4W8GA 5PNTA 4OHZA 4RPCA 1V7CA 1A27A 1C81A 1JDSA 3IAUA 4JBXA 1GTMA 4Y0VA 5A7HA 4BFWA 2FU5C 3H13A 4L4SA 4DA7A 4EKNB 1EUYA 3I62A 4NQZA 2QV7A 3AERA 5CHYA 4UHFA 3MTIA 1RADA 3BD8A 4I66A 4QOFA 2ECPA 4LQLA 4TTSA 5A3RA 3EA0A 4MGIR 4CLOA 3QPBA 3E22B 1RP7A 1W4BA 3S2FA 4UUAA 2E85A 1F0YA 3BSFA 1UK6A 3FSEA 3G0GA 3BT7A 2FSVC 2LGJA 2ZFUA 4Y98A 3M82A 3ZDRA 4LC1A 2A5YB 3ZW9A 1WCYA 1XPOA 3HU2A 4H3SA 5DP1A 3GLHB 1JHDA 1Z5ZA 1W5AA 3CXUA 1DX6A 1K3FA 2P5SA 2B7LA 4D96A 4DLRA 4PLWA 2PRSA 1SXJA 3RARA 1W0KD 2B1IA 3P2MA 1RQRA 4JUCA 4XR4A 3VDMA 5BSWA 3GLQA 1XC7A 3O4RA 3K71B 3FR7A 1W4LA 3Q5GA 2FDRA 3MGAA 1ZJYA 4M46A 2ZW9A 4DL9A 3C74A 3RT9A 4MDHA 3WGMA 3H9GA 3K2BA 1ZWKA 1C4XA 4P3OA 4QO7A 4R8LA 2YMMA 2L18A 4W7IA 4ZEWA 4EA9A 4Z5XA 5C7OO 4JI0B 3AUYA 2GM5A 4B46A 1PU2A 1DZ3A 4FJ1A 4MUNA 4C2UA 3WYEA 2Q3JA 2W2LA 1JEOA 3ICCA 5DLEA 5C1BA 2XUKA 1P2VA 1Z6GA 2YUTA 3MIZA 3MT8A 5DF1A 4E2FA 1TXGA 2QNRA 1SBNE 1S3SA 3GVHA 1HZZC 4MGYR 2I6UA 1LNSA 2Y2VA 1U5BA 1MO3A 3MFYA 1T15A 3MUOA 5E3JA 1A9RA 1P4GA 2HZBA 2KI5A 3EG5A 2IYPA 4MR9B 1SBQA 3FNBA 1LW6E 3OZDA 4N8SA 1E69A 4IRUB 1ZBDA 4BNLA 1RXSA 4EFNA 1K89A 4Y3UA 4IUBS 4M53A 3FSGD 3HY4A 2G9VA 2KHZA 3QTLA 1T2UA 2EJCA 4AIRA 2GZHA 5LA6B 3O8CA 2VP6A 2ZJBA 5DU2A 4DILA 3NOVA 2LIVA 3RADC 1OXUA 3G7SA 4QJ4A 1KARA 2W2KA 4N82A 1XWFA 3E15A 4UEWA 2F67A 3GJ7A 3BIFA 3O91A 4I5IA 4KH0A 3QBJA 1JB9A 4LWPA 1N4AA 2H0RA 3SG0A 4QZVA 5HE8A 1HA3A 1YS1X 2BFDB 5REQA 2RAFA 3WNBA 1NVXQ 1WP4A 3Q7TA 5JSYA 2ORWA 3T4XA 4CM4B 1T2FA 3NUZA 3FCCA 1Y82A 2JBAA 1BX0A 4DDVA 4PCUA 4MV7A 3R7AA 3LX5A 1E66A 2VF8A 2IODA 3OFSA 3OVMA 4BP3A 3ZD8A 5CMLA 5J4YA 3OZAA 4QDKA 5DFAA 5FX2A 4G23A 5J43A 1JNYA 5KAPA 3HCBA 1SBZA 3T06B 3W9BA 2C9OA 2WWFA 5KNDH 4XM2A 1AHNA 2ZCJA 1JLLA 1LRKA 4HDMA 1V37A 4PBRA 4Q6WA 4I6GA 1I6MA 1ORRA 1TL7C 2X2EA 4B8WA 3V1KA 3TVDA 3WK5A 3ZW8A 3QVKA 4UQLA 2BTOA 2OGWA 3R3ZA 4HQ0A 2VHXA 4NESA 1G7TA 4H16A 1S9HA 4PCVA 3P9QA 1R4NA 4B0PA 4IKOA 2ZUSA 3I73A 4C0KA 1R0KA 2H2GA 5FUBA 3RG8A 4UQPA 1XZJA 1OLUA 1I51A 2DHRA 3RYCB 1Y1TA 5EY5B 2CMGA 4R1TA 4JC8A 4G4IA 2CYAA 1TUBA 1R66A 4HLUC 1T8WA 4LXYA 1E1CA 1NNUA 3E9CA 4P82A 4HC4A 4AUMA 3PI7A 2IEGA 5DLQC 2C5LA 2WAAA 2X3UA 5EFZA 4C0WA 3L82B 1TJYA 3GXOA 4M9SA 1WPGA 4U7TB 5BSFA 1PCXA 2FE4A 5HRUA 1C8KA 2AC4A 4ZVSA 4ZOLA 2M6SA 4TUYB 1GR0A 1IJFA 3EDMA 3ZD6A 4IOJA 4YJDA 4C3VA 3VHXA 1H0HA 1TZBA 3QELB 1S7GA 2R7AA 2VXOA 4QYIB 3HR8A 4MUFA 1NF2A 3HB0A 1N3LA 5MN5A 5J2TA 4GXRA 1X86B 1C2TA 4HR7A 4DRXA 3H2BA 4JR1A 1LPPA 2NQ8A 2CV0A 4R2JA 2WMOB 3G5UA 4GM4A 4MVJD 5BXYA 1V2HE 2XJ9A 2R1VA 1Q0QA 3EZ6A 4BLSA 3DZIA 3QVMA 1Z12A 5LXTB 3P97A 3L0ZA 2JKVA 5LLDA 4BFSA 1LDMA 2HMYB 5K99A 5CB4B 1M6VB 4HDQB 5EE5B 3V7FA 2HU5A 2W2QA 4ZIRA 4DIOA 2BMVA 2IZ5A 4HEA6 5ICCA 2ZYWX 5FTMA 3TNDA 1R0ZA 3NT5A 3K8QA 1C1XA 4OKSA 4RSMA 1M66A 3ABRB 4HDMB 3GMIA 4U39A 2CUZA 5LMNB 10MHA 2IY7A 1GRCA 2OPBA 2X5KO 4U5QA 5H4GA 5IWAB 1RABA 3JWEA 2ZULA 3WLPA 2G77B 1H66A 3PUIA 3QIAA 2C2HA 4QTZA 3I9OA 3F7TA 4V0RA 2DFLA 2I54A 2Q6VA 3GC6A 4E2XA 4LF6B 2YWCA 1EFVA 3FPKA 4B4WA 3WGIA 1TZ2A 5E9AA 3CPSA 5B7GA 3JYHA 3CLTD 2BRUA 1BFDA 3HZRA 3PITA 3IUYA 1Z4IA 3VHRA 2CXHA 2FHPA 4WK2B 3RK4A 1U8TA 3JASA 1G59A 3DHNA 4RKEA 1VPLA 4BJHB 1DFHA 2C7OA 2D1FA 1QGDA 2E4YA 2A33A 1Q5PA 3QKRB 4PPFA 3QKIA 3EZLA 4KIFA 2NO9A 1CRWG 4UTRA 2EJVA 1BCRA 2QW8A 3DZHA 3QEJA 4BPRA 2BUAA 3NEAA 3ONDA 4DSOA 3KSMA 3UJAA 3IAAA 4PINA 2VDVE 3TKAA 3VR1A 3ZHOA 2ZSEA 5I7EA 1GAQA 2CEAA 3CX8A 4YR9A 1IZYA 1P3Y1 3KYCB 4GP6A 4UDXX 3B38A 1QLHA 1N7IA 1QKIA 4L57A 1QQTA 4IY1A 3V55A 3HI6A 3JAWB 2WFAA 1N1EA 4XOIA 4CKBB 2ZUWA 1BE8A 3FNRA 3CIFA 1RIFA 1TEHA 3F71A 4RELA 4AF7A 1CUVA 2O2JA 3B7WA 3OTOB 4AS1A 1Q14A 1W25A 3H2ZA 5IJAA 3KAJA 3R6GA 1YFKA 2P68A 3B36A 4HV4A 4M1SA 1RZUA 3KD3A 2XYGA 1KMNA 4MV9A 5DZSA 3T5BA 1MJFA 4XE5A 4W1PA 2KMLA 3NDIA 1Y48E 3WBJA 5E7JA 3CWQA 3GP5A 2B30A 4KODA 4HBGA 2CFSA 3HWSA 3JD1A 2OK7A 4L16A 3K6KA 4L6AA 4TTAA 5A62A 3IT2A 2Q0XA 3C48A 2ZYDA 4FC6A 1BQ4A 1IC6A 1E1DA 2ET6A 1P0IA 3QYFA 4JNCA 5ALZA 3HKEB 1NR5A 4O02B 5HZKA 4UAGA 1Y98A 2O5EA 1G16A 4LJKA 3DWGA 4Z9AA 2CL6X 4HB4A 4E46A 2P2DA 4LPSA 1A8PA 3RC9A 4CDRA 5AK3A 3AX6A 4Q3DA 1NHWA 4TVKA 2NGRA 2PH3A 3BXFA 3TTSA 3OAAA 3L2OB 3F5QA 5J4VA 1U11A 1YQUA 2P9GA 4UPDA 3BH6A 2VJKA 3L9XA 3OZGA 1Q95A 1JHXA 2GNPA 3AERB 3STWA 2A8YA 4TVOA 1BMDA 2FVYA 1BMTA 4G0NA 1YJBA 4FDLA 4MVCA 5FOXA 1G21E 4IW3B 4EDHA 1YDFA 2VP9A 4DBLC 4DVJA 3MNFA 3VKVA 3I04M 3K31A 3K9HA 5ECYA 2C5HA 3U4IA 2WUVA 3V3KA 3W9SA 3JY6A 2QR5A 4XI9A 3IVCA 2Q50A 5JRDS 3L43A 2H0AA 1QOPB 3L6CA 1YC5A 2HMSA 3OLWA 4R1QA 3UUGA 3D4PA 3ZDCA 5SY6A 5I01A 3V8BA 5E9WA 5PGMA 4S0XA 4MINA 3H1PA 4AQDA 3TZCA 4EJMA 2IS1A 1B3RA 1Z5UA 2W22A 3IUSA 3KJQA 6GPBA 5LLSA 4BHTA 5CIWA 1A8IA 2I9PA 3KAQA 4KWHA 5KYVA 4JJGA 2Y0PA 4BJ1A 4IHAA 1OFVA 1AGRA 3KQHA 2DR2A 4NARA 4M37A 1PN3A 4TMFA 3WLQA 3LC7O 3V46A 4DMUB 1XG5A 2ANCA 2O1XA 1V11A 4F5ZA 2ROQA 4JLKA 1N2SA 5K3CA 1NXQA 3HMQA 4ZTBA 3ZGOA 1CEQA 2LR0A 1EA7A 3BWEA 4GL4A 4MA0A 3RU7A 1YR2A 3WHLA 4ZQFA 1JPJA 5EUQB 1APBA 4FYWA 3CUKA 1IRIA 1UT5A 2XUDA 4MICA 4CTJA 1NZFA 3E0XA 1TJ3A 3P94A 5E6UA 2FSHA 2PWAA 1TCUA 2AG0A 2G8NA 3E5RA 3H75A 4WX2B 4B6JA 3PLRA 1AGXA 4BS9A 1Z2OX 2A0KA 4G97A 5SV2A 4DJAA 1A71A 1ETUA 1UBOS 5DB4A 3DBHA 4EJ6A 3O4FA 1WMDA 2AOUB 4YACA 4BUJA 5ALTA 1GPH1 3Q3IA 2QZSA 1CULC 2QUBA 4WZAA 2WKRA 3GO4A 1BE0A 1LK0A 1KYVA 4IDPA 5LD2C 4Z4IA 2Q8PA 5D87A 2FUKA 2E5WA 4Z9YA 4DWVA 1MFPA 5IAEA 1WD5A 2GH1A 3C8HA 1A1VA 4NFLA 4UJ3A 3W1WA 4FE3A 2E7ZA 3GT7A 1DAIA 3ZDBA 2NTVA 4I4CA 3RRZA 1U8CB 3ZWYA 4A8TA 1YHZA 5ICEA 1VJ0A 1ODFA 1BO6A 1BJKA 1QE5A 1FDOA 3CRNA 2EBUA 3SIXA 2Z9BA 1XWIA 1I4TD 1VL0A 1YBFA 3UICA 2H2HA 4DDWA 4NZOA 1W7AA 4Y2TA 3ZJUA 1L4HA 5LLTA 2WSSD 3ND8A 4H3HB 4IOMA 3ADDA 1RFGE 1N0VC 1TQ8A 4L5YA 1JDVA 3ZLJA 1WMBA 4FSHA 4DZRA 4QFCA 1QNFA 2PRZA 4P58A 5HKBA 4MTCA 1S0UA 4QVKA 2FEKA 1QZZA 3R7WA 3TKYA 3FKSD 4ZYWA 1ODLA 4H1UA 5IVPA 1X0XA 1YHYA 2H7VA 3N0VA 5B1EA 3CWZA 4L3WA 5E6RA 5ANRB 3DH0A 4ZDIA 4X54A 4RD3A 5E4FA 4CKWA 3GT3A 3UK7A 3D8HA 1RYFA 2NV2B 3ZHZA 1KIFA 5G0SA 3CSDA 4IIJF 5AOVA 5EXPA 3ILSA 5F33A 5DI9A 3R7LA 4L8YA 5C31A 1DOAA 1F0KA 4A0QA 3RVMA 4PGFA 4AXBA 3DLBA 1A9XA 1S4MA 1TCBA 2SKEA 3TOCA 4X66B 2JL1A 1CJVC 2NQ2C 1XDWA 4TM7A 3ZLBA 1PL8A 1TPZA 2UVQA 1AS2A 4J4TA 1CRQA 1Z6QA 3R6WA 1UDWA 2UXBB 4PZ9A 1Z33A 2N1MA 5JBNA 1A4RA 1AQUA 1AZWA 1L4MA 2ZZMA 4GGOA 3E9MA 2QZJA 3ND5A 3RW9A 5JPCA 2ZRIA 2ZJ5A 4H0NA 3DS8A 5JDCA 1HDCA 1VPEA 2QVBA 3KQNA 2VAXA 5EJ4A 3T5AA 2Q07A 4AJOA 1BMFD 2RHWA 3BMNB 1SD5A 2C3MA 2Q49A 2ZOSA 5JZOA 2ZRGA 4H4DA 1BOFA 2JGDA 3W77A 4BZZA 2O8EB 3FXAA 3R7DA 3X2EA 1I3LA 3VYTB 3TXAA 2HIAA 3GAMA 1QR2A 2BFOA 3N8IA 1NNSA 4N6OA 4AJLA 1UXHA 4GYYA 3U62A 2IYLD 4PVCA 4HDNB 4FBLA 2BLLA 1GLNA 2ZYRA 3NT2A 1HBJA 1ZK2A 4K87A 3RREA 4R0VA 1UJNA 4D9GA 1FYEA 3QU7A 3GLFE 1XA0A 3IBSA 2P2NA 4I2VA 4O1HA 2ZRNA 2E5FA 4IX9A 4NBKA 4QASA 1XRJA 5CTAA 1E98A 1PNTA 2NACA 4Q7KA 1U1IA 5JADA 2GR9A 5HMMA 3U6KA 2X23A 3S8MA 3AJAA 2GPWA 4W8HA 1OH6A 2F3SA 5B6IA 5E1OA 2CBGA 4LCJA 2BVNA 4GI3A 2WJ4A 2XDQB 3OC0A 2ZKIA 3UO8B 2X6QA 3QVJA 4CKEB 2BM0A 2ZB4A 1D4FA 2IZ6A 3IP6A 3KAPA 4DLPA 4Q4CA 2QMQA 4QYXA 2BFMA 5FUWA 2DTXA 4ESHA 5KKNB 4XVUA 2L69A 1RU3A 1WCIB 4LYFA 1SQ0A 3WYCA 3D6NB 3BX1A 3ESDA 3UWOA 4H7PA 2N0SA 3OHMA 1BHSA 1OLSA 2VYFA 2VHTA 3ERCA 1BKSB 2YHUA 3MBOA 5BWLA 1QLJA 5KNLA 1BHQ1 1RKVA 2Q3HA 3R44A 4FI3C 4MQ5A 3N39C 4U02A 2ZPUA 1NDUA 4TV8F 2YY7A 2GX6A 4ZJYA 4QAQA 4P36A 4J0DA 3DE4X 4URUR 1CQZA 1EKXA 5EP1A 3J81k 1UC9A 2RJ3A 4NEHB 1TM1E 4R2MA 5F2KA 1Z4LA 2BHTA 2FJ0A 2YWFA 2VHQA 3TD9A 3RLFA 5DEIA 1NUAA 3AVYA 2X4DA 3LUHA 5IZCA 1NPDA 5CNIA 4HQOA 5CVEA 3G88A 1T9AA 4B3RB 1DZIA 2X7JA 1D3AA 5JEEA 4ASUA 1XZCA 4QXOA 1VLMA 1N2CB 2NYUA 1P72A 3F98A 4UXHA 3AY3A 4X65B 5AVXA 1PFUA 3ST7A 3ZK9A 3RVDA 4B87A 4S05A 2WJJA 2FPPB 4RHFA 1XQ1A 4CMIB 5K3FA 5TPWA 2EU8A 4MROA 1M0TA 3MPOA 3NC0C 2K5UA 3F0TA 3TZLA 4M0MA 5K3FB 4G0QA 4EUSA 3TCNA 2YS7A 3BFVA 3S8EA 2V55B 5AJYA 5SZIA 2BHRA 2KBEA 4HVCA 3WLHA 3AF0A 2WUGA 3OSUA 4OHOA 5DSTA 4B6EA 4E5KA 1B74A 1CK4A 3HWX1 1WY5A 3OJOA 2KWIA 2O2ZA 3A3YA 4E5MA 2BYTA 1EK5A 2JGMA 4HLUA 1XK7A 4WASA 4HKTA 2RCYA 4OYLA 1I33A 5AESA 2OO5A 1G8YA 4QFDA 4RGQA 1EDDA 5IVHA 1NLMA 4P32A 2GJAA 2PLFA 2QTTA 4H6WA 4IBOA 3TUIC 1HFKA 4JMLA 3BXPA 3ETHA 4X91A 1Z29A 3RSZA 1E8NA 4MP3A 4YUWA 3ZBUA 3JQ8B 5FULA 5KMGA 4M36A 4IFTA 3L9WA 4A23A 3C6XA 3CRZA 1B15A 4DZTA 3I1FA 1W52X 3QMWA 3N86A 4NCHA 2VK2A 2HIGA 1CZNA 1F8YA 4YAJA 4EPWA 4H08A 4JL5A 3PZBA 4PGHA 3HB9A 2OO3A 3KT6A 4AZ0A 2CFCA 3VGPA 1QK5A 1RPJA 2XTAA 2SBTA 1I4LD 4U7PB 5IAOA 1DRJA 1Z7YA 4G5HA 1CIVA 1OT3A 2QRZA 2V4ZA 3ZY3A 4IXNA 2JLRA 1INLA 3AL0C 1M9NA 3ENWA 4BV8A 1N25A 4IKPA 4KO2S 4MVJE 4CMJA 2PUBA 1DQYA 4K28A 1NBOA 1SUAA 4TQUS 4G0XA 4C4AA 1ST2A 3BM5A 2F3PA 3N8KA 4AUEA 1ZCAA 4G0YA 3CMCO 4IIUA 1CUAA 1LBEA 4N3AA 4REMA 4CF4A 4RULA 5DTMA 3JVDA 1EXDA 1LZLA 4H59A 4LRUA 3SC3A 1R88A 5G2OA 4S1OA 4CEJB 3M9WA 3O8BA 1USVA 3GZ4A 3SD7A 1OI3A 4I9GA 4ZVRA 5JYDA 1QRRA 1MXFA 3UWPA 1WA5A 5CFLA 4QDJA 1BCSA 2GO7A 1Y80A 3EGIA 5KOHB 4WKCA 2XHEA 1F5NA 2HF8A 4M0FA 1PSZA 2OKGA 4P7BA 3GFPA 3QXXA 1CJSA 3RYIB 4F4DA 1A4UA 1MMFB 3PVZA 1QVWA 2WW8A 1NDHA 2X8BA 1Z36A 4KMOA 4MVJG 4RANA 3SXPA 2QMHA 3QEBZ 2PY6A 5F9HA 2IP4A 4EYGA 3HH8A 4X6YA 4E0BA 5BSKA 1FNDA 2O7QA 2QY6A 3IUQA 3RFVA 3DMYA 3CEPB 5HP4A 3KUKA 5D5HA 2ATIA 2X4LA 4C3ZA 1FC0A 4GQBA 1Y0BA 1VJRA 4J0EA 2ONYA 1TQDA 1J0AA 4IV5A 3X2SA 1DHRA 2HW8A 2EV9A 2J3DA 4H3KB 4HDCA 3WHPA 4XWKA 2A78A 2GEKA 1M73E 2O2XA 2W00A 2WSSA 4GMGA 4OIFA 4P80A 3U7RA 1S1CA 1I36A 5LNK6 1T6XA 5LUAA 2NTYC 3IPLA 1JXMA 3QWAA 1FP4B 1JH8A 1UJ5A 2V7VA 5BR1A 4L5IA 5JI2E 1AN0A 4M1KA 1K8ZB 4GBJA 4PG7A 1XHEA 2P2YA 4M6WB 5AICA 5BSUA 4KQ9A 4RJKA 2FRVA 4UVHA 2WNSA 4CR7A 4X1KA 1UM9B 4I5EA 4XTRA 5EKXA 5G02A 3WL6A 1H65A 1JEAA 1DAKA 2E6UX 1WMSA 3LT4A 1YI1A 2QORA 4BY9E 5CHEA 5FWYA 1T0BA 2ZSDA 2XQFA 1FRVA 3H8WA 2AI3A 3NM4A 5WRFA 1K06A 4IQGA 5DYIA 3ADCA 4P35A 3M3DA 2TYSB 1GGHA 2GD1O 2VDMB 1FLNA 2DBZA 4D80A 1RWWA 1Z5VA 3COYA 4HAWA 3O7WA 2PJUA 3TEJA 5KQSA 2DQ4A 3HV2A 2IS2A 3L02A 3AVQA 4M1OA 4R1UA 5AD1A 2OCYC 3AF4A 4K03A 4E2YA 1NUPA 2MYPA 2IX3A 1I3NA 2XNDA 2FYTA 4FGWA 3VR5H 3DDUA 1NYRA 2CJYA 4NMMA 4FMDB 5CEJA 5ALLA 4CXMA 5NULA 3TLJA 2YQ5A 5EWLB 4PIVA 5LQDA 1P2UA 3R2JA 2JLQA 1XNQB 5EKSA 2PU5A 5BQXA 2D4AA 2HQRA 4TZ0A 4Q1VA 4Q1DA 1E6UA 1QCCA 3RHZA 5I4KA 2AF3C 2E9SA 2D62A 3WLMA 3OQ6A 3U40A 1RMQA 1AK9A 2Y1LA 2YJ6A 3MOIA 4WZ6A 2ZANA 1OAKA 4NEGA 3IRUA 4MGKR 4KDCA 3W5CA 3ZQJA 1GZ6A 4BFVA 5E6RB 5HYVA 2FZKA 2VDQB 2BT4A 3LXUX 4JBYA 2KE5A 4O29A 1SQ6A 1DPFA 2UDPA 4YAGA 1ILWA 4MW4A 4L8WB 3QSGA 5JAOA 2Z6QA 2R6GA 1DO0A 4DF3A 5IUKC 3LK6A 2B3TA 3EMDA 4LJ8A 5IC5A 1CC1S 4FCWA 2I87A 2Y92A 1EZ4A 4QOHA 3D8NA 3HYCA 3SDZA 5M5BA 1IL0A 1WHTA 3OHPA 1B93A 4X20B 3GYBA 5DN6A 3S99A 3KXLA 4FDAA 4Y6QA 4BO1A 1BCRB 1L7BA 1I4WA 1R4MA 1RKUA 2TMDA 4GMKA 4QDXA 3SFVA 1SU7A 3GGOA 3KP1A 5L3SA 3WGZA 1TAHA 3NBAA 1EK1A 3LOUA 5CJ2A 3MLEA 3KZOA 2CF5A 4HGYA 2O2SA 1KERA 5GJVC 5K3DA 4H35A 1K4MA 4QE3A 4DGQA 1F4VA 1D04A 4UAJA 1PAUA 3ZC3A 2ADMA 2QMUA 3BHNA 2V6BA 4DR4B 5FNZA 1RM0A 2I65A 3NWJA 4H17A 2DWQA 4INPA 1KYTA 1JAIA 3C14C 3RU3A 2R8RA 3AM3A 3S1AB 1Z0SA 4IAOA 4MLDA 5FPKA 2P79A 1RKXA 2HJRA 3AM5A 3HCNA 3TOZA 1G2IA 2YOGA 3EPHA 1KPGA 1R8XA 5ES3A 1K6MA 3ORQA 2XVZA 3G2HA 1NYTA 1V5GA 3G59A 4HVTA 2XY4A 3T3HA 2ONCA 2O5CA 2GCIA 1J2JA 4O2AB 3H5TA 3QQPA 2JJ1D 2IS4A 3RANA 3H11B 3C6ZA 4F9EA 2W6IA 3DBRA 3Q3GE 1H94A 4ATNA 2PM8A 3CUWA 4IYJA 2LKDA 3AEYA 3DJFA 3RIMA 3N0RA 5KI6A 2UU9B 4BL5A 3DR5A 4EYKA 2D0PB 3LMKA 1NVMB 2RKBA 3T6KA 3LTNC 2JLUA 2BKAA 4OI0A 1VE7A 3I8SA 2NU7A 4Q93A 4IS3A 4U9UA 3PFFA 4MUGA 3JYQA 5TRTA 4GE0A 2ZJFA 4RHXA 4OI1A 3BVPA 3D0QA 4KMSA 3WYNA 5A4MS 1H93A 2IV2X 2BFFB 4FFNA 3UAOA 2P91A 1T2VA 1U94A 1IN4A 4NNJA 3VSCA 1N2CE 1UDXA 3OICA 3O4IA 2YC4C 2IWRA 1NUSA 5H5JA 4L0MA 3WS7A 2CL0X 2H5JA 1N6LA 2I4OA 2O50A 2BCGY 2RHTA 3B1JA 1ODIA 3MGGA 3IR6A 2VPTA 1BD4A 2ZJ1A 1ZI8A 4I4IA 1D7OA 1UC8A 3BG5A 3W4JA 3WLEA 4OHVA 2OL4A 3C3AA 3DG9A 5K8UA 1G7SA 1E4EA 1N2BA 1UKAA 4C4ZA 4C4PA 5IDXA 3BD9A 4HTAA 2V7QD 2YZKA 4N8EA 3K05A 1R6BX 2ZJ3A 4RCVA 2P30A 3C6KA 3D8BA 3DDCA 4D25A 1WXGA 1KZ9A 2DLDA 3M5CA 4OBXA 4ZYZA 4ZOAA 3OLVA 3RHFA 3ESBA 3USZA 2JFGA 2QSUA 3EQ8A 5IVKA 5EESA 5TXGA 1VIMA 3CLTC 1G2QA 1Y5LA 4NICA 4CCSA 5JNUA 3A6DA 3VU9A 1T9BA 5J2UA 3CINA 1Z08A 1VDMA 3UK6A 3CVYA 2KX7A 3ANTA 1CR2A 3N2EA 3ZGYA 4XIFA 3TJRA 3IR5A 1JI0A 2B4TO 4NLLA 4YRFA 5DNVA 3VPXA 4M1WA 3V4FA 3EEOA 3QKRA 3CO0S 1JI3A 4GSYA 4JUIA 2DWPA 3DJYA 1UKEA 2JAUA 3IAM6 2FZLA 2XE4A 3HR7A 3JRWA 5G0VA 2QVZX 2RFLA 4LAFA 2RGBA 4F5WA 1V8FA 2IU3A 2WIDA 3G6WA 5BMVB 1JKIA 4WPGA 4WL0A 4RVUA 1PW7A 3VJRA 4B6RA 1GGVA 1F8UA 3F5MA 4QDZA 4WEQA 1J21A 1EVLA 1C9DB 2Z04A 4WOBA 4CKBA 2ISQA 3IMGA 4YJ3A 1E5DA 1HWYA 4H77A 2H65A 3ORFA 1PD1A 3A2MA 1XTBA 3E8SA 5JJCA 2ZAOA 1JTEA 4BZWA 2LV8A 1F6DA 1QK4A 3IQHX 3PDIB 1SBHA 4GRIA 2AVNA 4W82A 1WETA 4LJRA 4BNTA 4QWWA 3MJEA 2ZSAA 3BL5A 4D46A 1R00A 4JVMA 5ALKA 1FJHA 3KOUA 4MUYA 3RTBA 3KS9A 3ESQA 1TAQA 3GZNB 4EFLA 4YXFA 3NO4A 1QO0A 3AUUA 2D2VA 4W9NC 4Y2RA 2I2WA 4AMBA 4G8BA 5BWMA 2BL4A 3BWXA 4ZGWA 3JRNA 1FCJA 1LTHR 1RVDA 3U5ZB 3CZQA 2GSWA 3R3VA 1ODTC 2ZXFA 5LQRA 4ZZ3A 1FXWF 1AKVA 3A27A 3IB6A 4PHFA 4BKPA 2BHLA 3ZLVA 4E13A 4UUOA 4JI8B 1JFVA 3FUXA 2I55A 2VJLA 4UAUA 3WMEA 1KZYC 4LTDA 4CL3A 1ONNA 1THMA 3KWFA 5KSWB 5AJWA 4GM1A 4CJXA 2HSGA 2WV9A 2DVMA 3I76A 3M6WA 5JD5A 1DAPA 3F73A 1BD3A 4OX9B 4HRVA 4CGYA 4YJHB 1FZTA 1BGVA 1E3EA 1VG1A 3CS3A 3Q8WA 4FLEA 4TV9F 4EBBA 1YVRA 4YWHA 1FUUA 1OJ7A 3SKYA 3C7DB 3K9QO 1DT3A 1F3OA 2AXPA 4ENPA 1F8GA 1RAGA 1RXUA 3CKYA 2A0XA 4FCVA 4J0QA 4E4RA 1KJ9A 1I2CA 3AGQA 1XZGA 2DSTA 3WMFA 4LCBA 2BFBA 3MJFA 4RVNA 3G3EA 4HX9A 1XVLA 1VZ2A 3EWNA 2JW5A 3EBPA 2R65A 4R98A 3DTNA 4DUYB 5HM8A 2QRGA 3PT9A 4IIXA 2WAOA 3IAFA 1E2BA 3K2EA 3WWOA 3FSGA 1JKMA 1M2EA 1J06A 2VEOA 2YW2A 3LQ2A 5JDIA 3A8TA 1CNFA 1QAOA 5HW0A 3OX4A 4MRRA 4XM0A 2I1LA 4AN0A 1Y9JA 2DJ5A 2WSLA 4I14A 5FUVA 2V1UA 3JQAD 1DHTA 1U9ZA 2IXTA 2OSBA 3WRYC 1NONA 3QEKA 2JATA 4YJFB 1P2SA 3S3TA 4CMAA 2C9CA 4IZ6A 1CR4A 2X5OA 5FQOA 1H2WA 1ZNXA 3Q3JB 1QTQA 4Y2YA 4KV7A 3P9CA 4OKNA 2C03A 3S1AA 3VYUB 3EF1A 4I19A 2DJIA 4NMWA 1AOXA 2G9UA 3F6RA 3VR5D 1FYXA 4A8JA 3Q9UA 2IYNA 4D43A 4TTPA 2RGNC 1RCUA 4D3FA 4Y1FA 3D3QA 2YRXA 1VCHA 4HDKB 3ZHBA 4CM4A 2WTUA 2IUUA 5CCEA 3CZ9A 3UJ9A 4LE2A 2GILA 3AF5A 3PFCA 4JOSA 5H82A 5B57C 1VI6A 5T4EA 2GD2A 1W36C 4TS1A 3RRYA 4OQFA 3LFUA 1XL1A 2PZGA 2GASA 3EIHA 5LZ9A 2DPGA 1QHHB 3L5KA 4S2UA 5M2QA 2Z1NA 4Q24A 3G2JA 2OM6A 5AM1A 5AKLA 1EGHA 5EHNA 2FN3A 2Q9BA 2FSUA 1S4QA 3VR6A 5BYBA 2LP4Y 5FBHA 3QXCA 1FFBA 1G5RA 1MH9A 2HWUA 4H1TA 4K9OA 4K6FA 1XWWA 4UE2A 3V33A 4DCTA 3PTAA 4YMSA 4Y2HA 5B12A 1LPAB 1RWKA 4P3KA 3ROMA 2BDTA 1XHFA 1O0BA 3K8ZA 3K1ZA 2X41A 1VLHA 4IJQA 5SZHB 1U3VA 3QP9A 3PGVA 3W04A 1TOAA 3FOBA 2DPMA 2JI7A 4PLGA 4PHCA 4KX3A 1G0OA 3AFMA 1J2UA 3DT8A 1L8QA 2A86A 3RBZA 1P9LA 1SHUX 3VC3A 2AOXA 2IV3A 3K15A 3DO6A 4NOJA 3AGPA 1TF2A 3OO1A 1LY1A 2G5PA 1MT3A 1QIMA 3BMQA 3K1AA 2CHGA 2PMWB 4YQEA 3I8XA 2B1RA 4HRYA 3HM9A 4GI2A 3W7VA 3DKIA 4TKVA 1O0CA 4DCOA 3ZU5A 5J9FA 4G4SP 1E2KA 4R2HA 4S1VA 5B37A 1GXSA 5HRCA 4Q19A 4UM7A 1CG6A 1OYYA 1K3TA 3FMGA 4X3PA 2ZVQX 1MENA 3SZMA 2PJRA 2HT6A 3IDOA 2XB8A 1YDEA 4DPMA 3WGVA 3MCWA 4UCXA 3EDOA 2HC9A 4P4UA 2DKNA 3FPFA 1WUIS 2FWIA 2HGZA 2R60A 2W6PA 2YBEA 1XB2A 3A05A 4IIYA 2AMFA 3ZIDA 3GJQA 3N8NA 1QIGA 3AESA 1HNZB 2B4KA 1T9DA 1YH3A 3H2HA 4CEIB 2L19A 4WKOA 3JQRA 3OM1A 1ZMOA 4XZ3A 5D00A 2GAOA 2DBVO 2G67A 3KYIB 3JV7A 4BKOA 3FFXA 4LZZA 4G0PA 3TX2A 1E79D 1REQB 3L7NA 3FCAA 5C8ZA 1SK8A 5KYXB 1CY6A 4XOUA 1SUFA 1ZOPA 3HB7A 3VX4A 1G4HA 4BKRA 3U3KA 5AM2A 6REQB 3UMRA 2W2VA 2AXEA 1GZ5A 2MMCA 3H05A 1XRSB 1URPA 1U0BB 3ABZA 1QORA 2GLXA 3DYBA 4UCQA 3BWBA 3NPMA 1HTTA 1LLCA 2VATA 3GFRA 1XBTA 4GC5A 3EB9A 4D9CA 3HK2A 2VDKB 2HCBA 1EH5A 3I2IA 4M0DA 4JBLA 3UJNA 2P75A 4PHTA 1YCGA 2J0QA 3KQYA 2I03A 4NECA 4EY3A 1W30A 3DBRB 4ON9A 4YN3A 3TX6A 1PJAA 3CZCA 3Q2OA 4CLRA 4MR7B 3E6AA 1AXEA 2FCAA 3UOAB 5CAEA 4L78A 3G0HA 1KEVA 1I1OA 1DTWA 3JYOA 3N2GA 4ZPJA 5KTPA 1GGJA 4WOPA 4RL4A 4WLVA 3F8WA 1II8A 3E03A 4Z86A 1JPNA 5AFSA 3M33A 2HHAA 3FDZA 2BTQA 2Y67A 3ZCTA 1IHUA 1MX3A 4LKOA 3NHZA 5DEOA 4O1IA 2O7RA 4AB1A 2ZETA 2JLYA 2Z9DA 4H7IA 1SCBA 2CDNA 3O82A 2OY0A 1CLEA 1K5PA 1QB7A 5JJLA 1BU5A 2OVFA 3KOMA 4JI5B 5HF5A 3KR1A