3G4AA

Crystal structure of flavine dependant thymidylate synthase s88a mutant from thermotoga maritima at 1.95 angstrom resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
218
structure length
218
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELAGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title An unusual mechanism of thymidylate biosynthesis in organisms containing the thyX gene.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
total genus 78
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3g4aA00
1KQ4A 5IORA 5IOTA 1O24A 1O27A 4GT9A 5CHPA 5JFEA 1O2AA 4GTDA 3G4AA 3N0CA 4P5AA 4GTBA 1O26A 4GTEA 2CFAB 3AH5A 3G4CA 3N0BA 4GTFA 1O28A 4KASA 1O25A 4KATA 1O29A 4P5BA 1O2BA 4GTCA 4GTLA 5IOQA 4FZBA 3N3YA 2CFAA 4GTAA 4KARA 5IOSA
chains in the Genus database with same CATH superfamily
3FOEA 4G0WA 1ZXOA 3RZDK 4BLBA 3PO3K 3HOUK 2PMZL 4GTFA 1WQFA 1O29A 3S1MC 3H0GA 1IS1A 4ILDA 4A3FC 1XZPA 2VUMA 4XSZA 2RH6A 4C3HC 2P8TA 5C4XK 1WSRA 2GSUA 3FKIA 4BXXK 3AQOA 3AD9C 3HOVC 3M3YC 2JA7A 3FOFA 3HOZC 5IP7C 2FQTA 1JOEA 4KB4A 3RZOK 2JA5K 2JA6K 3H3VD 2RGRA 1WCMK 5TMCA 4YFNA 4KARA 4AH6A 4OIRA 3GTLC 3S2DK 1I50A 3BUEA 5IP9C 3S0XA 1Y1VC 2A6HA 2ZUFA 1ZVUA 4XLNA 3GTKA 5L46A 3GTGC 3GIRA 3V4GA 1XXAA 3GTQA 5FLMC 4A3DC 3OEPA 3OPFA 1O2FB 1INNA 2V6SA 3IPJA 3TFHA 4C45A 2R93K 1TWAA 1YCLA 1J6VA 1L0WA 2YU9C 4LK0A 1G51A 2E2IC 3HKZD 2NVYA 5CJ9A 1TWCC 3PO2C 5TMFA 4QIWL 1TWGA 1IE0A 4RMFA 4A3JC 3Q3QA 3M4OK 2GAHC 1WOPA 3HOYC 3VA7A 3GTMA 3SZZA 1BS2A 4DDQA 4WJ3M 3BP3A 1I3QC 3LPXA 5M5WK 3S1QK 2E2HC 4A3LK 2ZUEA 4KATA 4O2DA 1O2BA 4GTCA 1VGXA 2KWAA 5IYCK 3N3YA 1EQRA 4A3IK 3RZDC 3CQZK 4C2MK 3HOUC 4OINA 1TWHK 1ISEA 5C4JK 4A3EK 1WOOA 4A3GK 3HOWC 1O2AA 4A3CK 3BP8C 2B63K 4GFQA 5E68A 2CFAB 4C3IK 1K83K 3LAPA 3ERED 2D6FC 3H0GK 3I4NC 4A3KK 2XCOA 1ZQ1C 1EI6A 5C44K 1IQ0A 1B4AA 3S16K 1TWFK 3FKIK 1BJTA 3RZOC 4BY1K 2JA6C 4KMUA 4A3MK 5JFEA 3GDZA 5IYBK 4G7HA 1WOSA 4KMAA 2NVXA 3GTLA 4AYBL 2NVQK 1WIHA 3K7AC 1O25A 4M1XA 3S15K 3GTJC 4G7ZA 4XCHA 1V5VA 1Y1VA 5TJ3A 2XCQA 3GTGA 2JA8K 2NVTC 1DCOA 5IORA 1F9NA 4A93K 2R93C 3S14K 4Y52K 1R9TK 3S1NK 2PPBA 1GE9A 4BBSK 5IYDC 2YU9A 3GTQK 4G0VA 1BDFA 1B4BA 1I6VA 2E2IA 3GTOC 3AH5A 3N0BA 2A69A 2WAQL 1TWCA 2BE5A 2Y3PA 1TWAK 1JVIA 2EBBA 1YX2A 1Y1WC 2PMZD 2CFAA 4LQYA 3HOXK 4OIQA 1AB4A 3DXJA 1I3QA 3S1QC 2E2HA 1TWGK 4C3JK 4A3LC 1I6HK 4QJVB 5C3EK 3GTMK 2R7ZK 5CHPA 3S2HK 4X6AK 4MEYA 3S1RK 4A3BK 4Q4ZA 4A3IC 3CQZC 3G4AA 3N0CA 4BBRK 1TWHC 4A3EC 4FM9A 1YNJA 4A3GC 1PJ7A 3I4MK 5M5XK 1WQGA 4A3CC 4KDDA 3FHZA 2B63C 1SFOK 1HI9A 1K83C 2ZFZA 1BGWA 2R92K 4A3FK 1O27A 3GTPC 4MEXA 1ZYRA 4BLAA 4KM8A 1RU0A 1IBAA 2CW0A 1UV7A 5C44C 4GTBA 1IW7A 3S16C 1EFWA 4MQ9A 1TWFC 3FKIC 4LJZA 3A8KA 2A68A 4P5BA 2JA6A 3HOVK 1XXBA 3M3YK 5JVOA 4A3MC 1USOA 4FZBA 5IP7K 5IYBC 2JH3A 3L4KA 3PO3C 2NVQC 4XLPA 3JSTA 4BY7K 3GTJA 3S15C 1VLOA 1F7UA 4KC6A 4LR2A 1DCPA 3A8JA 5HL8A 2NVXK 3GTLK 3OREA 2Y0SD 4QJVA 1O26A 1XXCA 1O28A 4KASA 3SZYA 3CAGA 5C4XC 5IP9K 2R93A 4A93C 3S14C 1R9TC 4BXXC 3S1NC 3GEHA 2VUMK 4LK1A 5M3MK 3GTGK 1USMA 3NUHA 3GTQC 3GTOA 1IL2A 4KMHA 5M5YK 2JA5C 3A8IA 3S17K 1PJ6A 2JA7K 4OIPA 2O5JA 1Y1WA 5EGHA 3HOXC 2E2IK 1WCMC 2WB1D 4YFKA 4P5AA 4BKWA 1JQWA 4KMDA 3S2DC 1PJ5A 4Y7NK 1X31C 4PAAA 1EH1A 1WQHA 4GZYA 5C3EC 2R7ZC 5IOQA 3S2HC 1I3QK 3LAJA 3S1RC 4LOWA 3AQPA 3CQZA 1I50K 3EQLA 4BBRC 2E2HK 1TWHA 2PA8D 2O5IA 1O24A 4WILA 1EK8A 1XPPA 3T01A 4GT9A 3ADAC 3I4MC 4GTDA 3GTKK 4NOIA 1DCHA 2E2JK 2B63A 1WSVA 4Q5SA 4KM9A 3H3VL 1SFOC 1K83A 4OIOA 5FJ8K 3HOWK 2R92C 4GTLA 4AYBD 4YG2A 3M4OC 3GTPA 1VJEA 3GSIA 3T00A 2NVYK 2FQOA 3GEEA 3I4NK 1TWFA 4WJ4A 4ZH4A 3TTGA 5IYCC 1YNNA 1VRQC 4C2MC 1DD5A 3WODA 5C4JC 4BY7C 3HKZL 2GSOA 2WAQD 4KB2A 4LLGA 2NVXC 3QX3A 1F7VA 1WORA 4KAWX 4KN7A 3K7AK 5M3FK 1XZQB 4C3IC 3GTJK 3S1MK 5IOTA 4P9SA 3H0GC 1R9TA 4A3KC 2VUMC 2NVTK 4C3HK 4GTEA 3G4CA 5EGEA 3MMLB 1C0AA 2JA5A 4BY1C 4XSXA 3S17C 5IYDK 3L4JA 2JA7C 1F93A 3HOZK 3GTOK 1WCMA 4KN4A 2A6EA 1KQ4A 2Y0SL 4Y7NC 2V6UA 1Y1WK 2R7ZA 2PHCB 3T02A 1HQMA 2GAGC 1ZBSA 4JK1A 4QIWD 1XZPB 1I50C 2XCRB 2JA8C 4J3NA 4YFXA 3TFIA 1Y1VK 2V6TA 4Y52C 4G0UA 4GTAA 2W7VA 5D4DA 3GTKC 2E2JC 4BBSC 5FLMK 4G7OA 2P5MA 4A3DK 3GEIA 5IOSA 1SFOA 3AD8C 2WB1L 2R92A 1VH2A 1TWAC 2YU9K 1XZQA 3AD7C 2NVYC 3HXAA 1TWCK 3TFJA 3PO2K 1J6XA 1J6WA 1TWGC 4A3JK 4C3JC 3GTPK 2PA8L 1I6HC 3HOYK 3GTMC 2GSNA 1SMYA 4X6AC 4A3BC 4PABA 1J98A
chains in the Genus database with same CATH topology
3FOEA 1BGWA 4G0WA 1O27A 1O2AA 4BLAA 4KM8A 1ZXOA 4BLBA 4GFQA 4GTBA 4C2MC 2CFAB 3LAPA 3ERED 4GTFA 1WQFA 1DD5A 1O29A 4P5BA 2JA6A 3H0GA 1XXBA 2XCOA 1IS1A 4ILDA 2GSOA 5JVOA 4FZBA 4KB2A 2VUMA 2JH3A 3QX3A 4KAWX 3L4KA 1B4AA 2RH6A 4C3HC 1BJTA 2GSUA 4C3IC 3FKIA 5IOTA 3AQOA 3GTJA 4KC6A 1R9TA 5JFEA 2JA7A 4LR2A 3FOFA 3OREA 4KMAA 2NVXA 3GTLA 1O26A 4GTEA 4KB4A 1XXCA 1WIHA 3G4CA 1O28A 3MMLB 5EGEA 4KASA 1O25A 3CAGA 2JA5A 4M1XA 2R93A 3L4JA 1Y1VA 2RGRA 3NUHA 5TJ3A 4KARA 1WCMA 2XCQA 3GTGA 3GTOA 1I50A 4KMHA 1KQ4A 5IORA 3BUEA 1F9NA 3S0XA 2R7ZA 1Y1WA 1GE9A 5EGHA 1ZVUA 2PHCB 2YU9A 3GTKA 4G0VA 1B4BA 4BKWA 1XXAA 4P5AA 1ZBSA 3V4GA 3GTQA 2E2IA 4KMDA 2XCRB 3AH5A 3N0BA 3OEPA 3OPFA 1TWCA 4J3NA 2Y3PA 1EH1A 1WQHA 1TWAA 4G0UA 5IOQA 2CFAA 4GTAA 4LQYA 3LAJA 1AB4A 3AQPA 3CQZA 1I3QA 2P5MA 2NVYA 5IOSA 1TWHA 5CJ9A 1SFOA 2E2HA 1O24A 1EK8A 1TWGA 3Q3QA 2R92A 4GT9A 5CHPA 3GTMA 3VA7A 4GTDA 4DDQA 2B63A 3G4AA 3N0CA 4KM9A 3LPXA 1K83A 4FM9A 4KATA 4C3JC 1O2BA 4GTCA 4GTLA 2KWAA 3GTPA 1WQGA 2GSNA 3N3YA 4KDDA 3FHZA 1ISEA 1TWFA 2ZFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ4 A;  5IOR A;  5IOT A;  1O24 A;  1O27 A;  4GT9 A;  5CHP A;  5JFE A;  1O2A A;  4GTD A;  3G4A A;  3N0C A;  4P5A A;  4GTB A;  1O26 A;  4GTE A;  2CFA B;  3AH5 A;  3G4C A;  3N0B A;  4GTF A;  1O28 A;  4KAS A;  1O25 A;  4KAT A;  1O29 A;  4P5B A;  1O2B A;  4GTC A;  4GTL A;  5IOQ A;  4FZB A;  3N3Y A;  2CFA A;  4GTA A;  4KAR A;  5IOS A; 
#chains in the Genus database with same CATH topology
 3FOE A;  4G0W A;  1ZXO A;  3RZD K;  4BLB A;  3PO3 K;  3HOU K;  2PMZ L;  4GTF A;  1WQF A;  1O29 A;  3S1M C;  3H0G A;  1IS1 A;  4ILD A;  4A3F C;  1XZP A;  2VUM A;  4XSZ A;  2RH6 A;  4C3H C;  2P8T A;  5C4X K;  1WSR A;  2GSU A;  3FKI A;  4BXX K;  3AQO A;  3AD9 C;  3HOV C;  3M3Y C;  2JA7 A;  3FOF A;  3HOZ C;  5IP7 C;  2FQT A;  1JOE A;  4KB4 A;  3RZO K;  2JA5 K;  2JA6 K;  3H3V D;  2RGR A;  1WCM K;  5TMC A;  4YFN A;  4KAR A;  4AH6 A;  4OIR A;  3GTL C;  3S2D K;  1I50 A;  3BUE A;  5IP9 C;  3S0X A;  1Y1V C;  2A6H A;  2ZUF A;  1ZVU A;  4XLN A;  3GTK A;  5L46 A;  3GTG C;  3GIR A;  3V4G A;  1XXA A;  3GTQ A;  5FLM C;  4A3D C;  3OEP A;  3OPF A;  1O2F B;  1INN A;  2V6S A;  3IPJ A;  3TFH A;  4C45 A;  2R93 K;  1TWA A;  1YCL A;  1J6V A;  1L0W A;  2YU9 C;  4LK0 A;  1G51 A;  2E2I C;  3HKZ D;  2NVY A;  5CJ9 A;  1TWC C;  3PO2 C;  5TMF A;  4QIW L;  1TWG A;  1IE0 A;  4RMF A;  4A3J C;  3Q3Q A;  3M4O K;  2GAH C;  1WOP A;  3HOY C;  3VA7 A;  3GTM A;  3SZZ A;  1BS2 A;  4DDQ A;  4WJ3 M;  3BP3 A;  1I3Q C;  3LPX A;  5M5W K;  3S1Q K;  2E2H C;  4A3L K;  2ZUE A;  4KAT A;  4O2D A;  1O2B A;  4GTC A;  1VGX A;  2KWA A;  5IYC K;  3N3Y A;  1EQR A;  4A3I K;  3RZD C;  3CQZ K;  4C2M K;  3HOU C;  4OIN A;  1TWH K;  1ISE A;  5C4J K;  4A3E K;  1WOO A;  4A3G K;  3HOW C;  1O2A A;  4A3C K;  3BP8 C;  2B63 K;  4GFQ A;  5E68 A;  2CFA B;  4C3I K;  1K83 K;  3LAP A;  3ERE D;  2D6F C;  3H0G K;  3I4N C;  4A3K K;  2XCO A;  1ZQ1 C;  1EI6 A;  5C44 K;  1IQ0 A;  1B4A A;  3S16 K;  1TWF K;  3FKI K;  1BJT A;  3RZO C;  4BY1 K;  2JA6 C;  4KMU A;  4A3M K;  5JFE A;  3GDZ A;  5IYB K;  4G7H A;  1WOS A;  4KMA A;  2NVX A;  3GTL A;  4AYB L;  2NVQ K;  1WIH A;  3K7A C;  1O25 A;  4M1X A;  3S15 K;  3GTJ C;  4G7Z A;  4XCH A;  1V5V A;  1Y1V A;  5TJ3 A;  2XCQ A;  3GTG A;  2JA8 K;  2NVT C;  1DCO A;  5IOR A;  1F9N A;  4A93 K;  2R93 C;  3S14 K;  4Y52 K;  1R9T K;  3S1N K;  2PPB A;  1GE9 A;  4BBS K;  5IYD C;  2YU9 A;  3GTQ K;  4G0V A;  1BDF A;  1B4B A;  1I6V A;  2E2I A;  3GTO C;  3AH5 A;  3N0B A;  2A69 A;  2WAQ L;  1TWC A;  2BE5 A;  2Y3P A;  1TWA K;  1JVI A;  2EBB A;  1YX2 A;  1Y1W C;  2PMZ D;  2CFA A;  4LQY A;  3HOX K;  4OIQ A;  1AB4 A;  3DXJ A;  1I3Q A;  3S1Q C;  2E2H A;  1TWG K;  4C3J K;  4A3L C;  1I6H K;  4QJV B;  5C3E K;  3GTM K;  2R7Z K;  5CHP A;  3S2H K;  4X6A K;  4MEY A;  3S1R K;  4A3B K;  4Q4Z A;  4A3I C;  3CQZ C;  3G4A A;  3N0C A;  4BBR K;  1TWH C;  4A3E C;  4FM9 A;  1YNJ A;  4A3G C;  1PJ7 A;  3I4M K;  5M5X K;  1WQG A;  4A3C C;  4KDD A;  3FHZ A;  2B63 C;  1SFO K;  1HI9 A;  1K83 C;  2ZFZ A;  1BGW A;  2R92 K;  4A3F K;  1O27 A;  3GTP C;  4MEX A;  1ZYR A;  4BLA A;  4KM8 A;  1RU0 A;  1IBA A;  2CW0 A;  1UV7 A;  5C44 C;  4GTB A;  1IW7 A;  3S16 C;  1EFW A;  4MQ9 A;  1TWF C;  3FKI C;  4LJZ A;  3A8K A;  2A68 A;  4P5B A;  2JA6 A;  3HOV K;  1XXB A;  3M3Y K;  5JVO A;  4A3M C;  1USO A;  4FZB A;  5IP7 K;  5IYB C;  2JH3 A;  3L4K A;  3PO3 C;  2NVQ C;  4XLP A;  3JST A;  4BY7 K;  3GTJ A;  3S15 C;  1VLO A;  1F7U A;  4KC6 A;  4LR2 A;  1DCP A;  3A8J A;  5HL8 A;  2NVX K;  3GTL K;  3ORE A;  2Y0S D;  4QJV A;  1O26 A;  1XXC A;  1O28 A;  4KAS A;  3SZY A;  3CAG A;  5C4X C;  5IP9 K;  2R93 A;  4A93 C;  3S14 C;  1R9T C;  4BXX C;  3S1N C;  3GEH A;  2VUM K;  4LK1 A;  5M3M K;  3GTG K;  1USM A;  3NUH A;  3GTQ C;  3GTO A;  1IL2 A;  4KMH A;  5M5Y K;  2JA5 C;  3A8I A;  3S17 K;  1PJ6 A;  2JA7 K;  4OIP A;  2O5J A;  1Y1W A;  5EGH A;  3HOX C;  2E2I K;  1WCM C;  2WB1 D;  4YFK A;  4P5A A;  4BKW A;  1JQW A;  4KMD A;  3S2D C;  1PJ5 A;  4Y7N K;  1X31 C;  4PAA A;  1EH1 A;  1WQH A;  4GZY A;  5C3E C;  2R7Z C;  5IOQ A;  3S2H C;  1I3Q K;  3LAJ A;  3S1R C;  4LOW A;  3AQP A;  3CQZ A;  1I50 K;  3EQL A;  4BBR C;  2E2H K;  1TWH A;  2PA8 D;  2O5I A;  1O24 A;  4WIL A;  1EK8 A;  1XPP A;  3T01 A;  4GT9 A;  3ADA C;  3I4M C;  4GTD A;  3GTK K;  4NOI A;  1DCH A;  2E2J K;  2B63 A;  1WSV A;  4Q5S A;  4KM9 A;  3H3V L;  1SFO C;  1K83 A;  4OIO A;  5FJ8 K;  3HOW K;  2R92 C;  4GTL A;  4AYB D;  4YG2 A;  3M4O C;  3GTP A;  1VJE A;  3GSI A;  3T00 A;  2NVY K;  2FQO A;  3GEE A;  3I4N K;  1TWF A;  4WJ4 A;  4ZH4 A;  3TTG A;  5IYC C;  1YNN A;  1VRQ C;  4C2M C;  1DD5 A;  3WOD A;  5C4J C;  4BY7 C;  3HKZ L;  2GSO A;  2WAQ D;  4KB2 A;  4LLG A;  2NVX C;  3QX3 A;  1F7V A;  1WOR A;  4KAW X;  4KN7 A;  3K7A K;  5M3F K;  1XZQ B;  4C3I C;  3GTJ K;  3S1M K;  5IOT A;  4P9S A;  3H0G C;  1R9T A;  4A3K C;  2VUM C;  2NVT K;  4C3H K;  4GTE A;  3G4C A;  5EGE A;  3MML B;  1C0A A;  2JA5 A;  4BY1 C;  4XSX A;  3S17 C;  5IYD K;  3L4J A;  2JA7 C;  1F93 A;  3HOZ K;  3GTO K;  1WCM A;  4KN4 A;  2A6E A;  1KQ4 A;  2Y0S L;  4Y7N C;  2V6U A;  1Y1W K;  2R7Z A;  2PHC B;  3T02 A;  1HQM A;  2GAG C;  1ZBS A;  4JK1 A;  4QIW D;  1XZP B;  1I50 C;  2XCR B;  2JA8 C;  4J3N A;  4YFX A;  3TFI A;  1Y1V K;  2V6T A;  4Y52 C;  4G0U A;  4GTA A;  2W7V A;  5D4D A;  3GTK C;  2E2J C;  4BBS C;  5FLM K;  4G7O A;  2P5M A;  4A3D K;  3GEI A;  5IOS A;  1SFO A;  3AD8 C;  2WB1 L;  2R92 A;  1VH2 A;  1TWA C;  2YU9 K;  1XZQ A;  3AD7 C;  2NVY C;  3HXA A;  1TWC K;  3TFJ A;  3PO2 K;  1J6X A;  1J6W A;  1TWG C;  4A3J K;  4C3J C;  3GTP K;  2PA8 L;  1I6H C;  3HOY K;  3GTM C;  2GSN A;  1SMY A;  4X6A C;  4A3B C;  4PAB A;  1J98 A; 
#chains in the Genus database with same CATH homology
 3FOE A;  1BGW A;  4G0W A;  1O27 A;  1O2A A;  4BLA A;  4KM8 A;  1ZXO A;  4BLB A;  4GFQ A;  4GTB A;  4C2M C;  2CFA B;  3LAP A;  3ERE D;  4GTF A;  1WQF A;  1DD5 A;  1O29 A;  4P5B A;  2JA6 A;  3H0G A;  1XXB A;  2XCO A;  1IS1 A;  4ILD A;  2GSO A;  5JVO A;  4FZB A;  4KB2 A;  2VUM A;  2JH3 A;  3QX3 A;  4KAW X;  3L4K A;  1B4A A;  2RH6 A;  4C3H C;  1BJT A;  2GSU A;  4C3I C;  3FKI A;  5IOT A;  3AQO A;  3GTJ A;  4KC6 A;  1R9T A;  5JFE A;  2JA7 A;  4LR2 A;  3FOF A;  3ORE A;  4KMA A;  2NVX A;  3GTL A;  1O26 A;  4GTE A;  4KB4 A;  1XXC A;  1WIH A;  3G4C A;  1O28 A;  3MML B;  5EGE A;  4KAS A;  1O25 A;  3CAG A;  2JA5 A;  4M1X A;  2R93 A;  3L4J A;  1Y1V A;  2RGR A;  3NUH A;  5TJ3 A;  4KAR A;  1WCM A;  2XCQ A;  3GTG A;  3GTO A;  1I50 A;  4KMH A;  1KQ4 A;  5IOR A;  3BUE A;  1F9N A;  3S0X A;  2R7Z A;  1Y1W A;  1GE9 A;  5EGH A;  1ZVU A;  2PHC B;  2YU9 A;  3GTK A;  4G0V A;  1B4B A;  4BKW A;  1XXA A;  4P5A A;  1ZBS A;  3V4G A;  3GTQ A;  2E2I A;  4KMD A;  2XCR B;  3AH5 A;  3N0B A;  3OEP A;  3OPF A;  1TWC A;  4J3N A;  2Y3P A;  1EH1 A;  1WQH A;  1TWA A;  4G0U A;  5IOQ A;  2CFA A;  4GTA A;  4LQY A;  3LAJ A;  1AB4 A;  3AQP A;  3CQZ A;  1I3Q A;  2P5M A;  2NVY A;  5IOS A;  1TWH A;  5CJ9 A;  1SFO A;  2E2H A;  1O24 A;  1EK8 A;  1TWG A;  3Q3Q A;  2R92 A;  4GT9 A;  5CHP A;  3GTM A;  3VA7 A;  4GTD A;  4DDQ A;  2B63 A;  3G4A A;  3N0C A;  4KM9 A;  3LPX A;  1K83 A;  4FM9 A;  4KAT A;  4C3J C;  1O2B A;  4GTC A;  4GTL A;  2KWA A;  3GTP A;  1WQG A;  2GSN A;  3N3Y A;  4KDD A;  3FHZ A;  1ISE A;  1TWF A;  2ZFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...