3G4AA

Crystal structure of flavine dependant thymidylate synthase s88a mutant from thermotoga maritima at 1.95 angstrom resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
218
structure length
218
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELAGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unusual mechanism of thymidylate biosynthesis in organisms containing the thyX gene.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 78
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3g4aA00
1O29A 3N0BA 4KATA 1O27A 4P5BA 4GTLA 1O26A 1O25A 4GT9A 4P5AA 3N3YA 5IOSA 4GTFA 5IOQA 1O28A 3G4AA 4GTDA 1O24A 4FZBA 1KQ4A 5JFEA 5CHPA 1O2AA 4KARA 1O2BA 4GTBA 4KASA 5IORA 3N0CA 4GTAA 3AH5A 4GTEA 5IOTA 3G4CA 2CFAA 2CFAB 4GTCA
chains in the Genus database with same CATH superfamily
3M3YK 1F7UA 3HOWC 1XZPB 3PO3K 4KMHA 4BXXC 3GTMC 3TFJA 4Y52K 1ZBSA 2O5IA 2ZUEA 1WCMC 4BBSC 3BUEA 1USMA 3HOYK 4QIWL 5C44C 5C4XK 3NUHA 4KN4A 1VLOA 1EH1A 1TWGK 1IE0A 4GTBA 2E2JC 4ZH4A 4KN7A 1Y1WC 5IOTA 3GTLA 1XXCA 5M3MK 3SZZA 4XLNA 3AD8C 1WCMA 3CQZC 1EQRA 3GTOK 3GTGA 4GTLA 1O26A 1WQFA 4KB4A 3H0GK 1ZVUA 3RZOC 1WORA 3JSTA 5IP7K 2VUMK 3GTJA 2E2IA 3PO2C 3L4JA 1O24A 3HOXK 1R9TA 4A3KC 4C3HK 1HI9A 2FQOA 1K83K 4A3JK 2GSNA 3M4OC 3HOXC 1EFWA 4GTAA 3AH5A 4YFXA 1IBAA 3BP3A 2YU9K 3S2HK 1BDFA 4ILDA 5TJ3A 2CFAB 1IQ0A 1O29A 1TWFK 1SMYA 4MQ9A 1TWHA 2A6EA 4Y7NC 2B63A 2YU9A 2PMZL 5D4DA 2PPBA 2EBBA 4WJ4A 4C3IC 4OIQA 4YFKA 3S14K 1DD5A 2R92C 4BBRC 1TWCK 1YNJA 1F9NA 1WCMK 2GSOA 4OINA 4XSXA 4P5BA 4Q5SA 4M1XA 3GSIA 4XCHA 1TWHC 4A3LC 1JQWA 1Y1VA 3GEEA 4A3DC 3CAGA 3G4AA 3GTKA 4A3BC 4DDQA 1I3QK 3MMLB 5JFEA 1PJ5A 3T00A 1TWFC 4KB2A 3AD7C 1YNNA 1WIHA 2JA8C 3HKZD 1Y1WA 3S0XA 1XPPA 3H3VD 3HOZK 2JA7C 1V5VA 4Y52C 4GT9A 1BJTA 1UV7A 3GTJK 3FHZA 2E2IK 4C2MK 4BLAA 2R92K 1K83C 5M5WK 3GTKC 4Q4ZA 4A3MC 5C4JC 2PA8D 2NVYK 4LOWA 1WOSA 3WODA 2Y0SD 3RZOK 2ZUFA 1WOOA 1I50K 4WILA 5L46A 1SFOA 1TWGA 1IS1A 2JA6C 1IW7A 4JK1A 4BY1K 4QJVB 3RZDK 3HOUC 3GTMA 5IYCK 2JA7A 3I4NK 4P9SA 1SFOK 4A3JC 5E68A 5JVOA 5IORA 3M3YC 3N0CA 3A8KA 2ZFZA 4AYBD 3N0BA 2E2HC 5IYDC 4KMUA 3S2DK 5C3EK 4LQYA 3HOVC 1G51A 1I50C 3S17K 3GTGK 3GTOA 2XCOA 4C3IK 1I3QA 3OREA 4G0WA 3S15K 3GTPA 3VA7A 2B63K 4BLBA 3GTLK 3S1MC 4GZYA 2BE5A 2V6SA 3HOYC 2CFAA 2B63C 3H0GC 3S1MK 5FJ8K 4LLGA 1J6WA 5C44K 3S16C 2VUMA 3TFHA 2R7ZC 4C3JC 3N3YA 3S17C 3TFIA 3GTMK 3LAPA 2E2HA 2JA8K 1USOA 3K7AC 3HOZC 1O2FB 1TWAA 3I4NC 3GEIA 1GE9A 2WAQD 3QX3A 1XZQB 4A93C 3GTKK 1I50A 3L4KA 4G7ZA 2JA5C 4MEXA 1YX2A 1ISEA 4KATA 1VJEA 4A3GC 3HXAA 1TWAK 2RGRA 4A3KK 4A3CC 3AQPA 2W7VA 4LR2A 3ADAC 4KDDA 4MEYA 3FKIA 4AH6A 1WQHA 1DCHA 1DCPA 1ZQ1C 4LK1A 2NVXC 1EK8A 3S14C 4FZBA 2XCRB 3S1RC 3GTOC 2VUMC 4KMAA 4BBRK 1B4AA 3T01A 4RMFA 4BY1C 3H3VL 1TWAC 3T02A 4OIPA 2NVTK 1TWFA 4A3FK 1TWGC 3GEHA 3ERED 5C4XC 4GTFA 5IYBK 2NVXK 4PAAA 4C2MC 2PA8L 4O2DA 4GFQA 4A3MK 2P5MA 3HOWK 3PO3C 4BXXK 4A3DK 2JA7K 1VGXA 3I4MC 2PMZD 1YCLA 1EI6A 4A93K 2A6HA 2XCQA 1SFOC 3EQLA 2R93K 5IP7C 4OIRA 3LAJA 3GDZA 1DCOA 5IP9C 1XZPA 3SZYA 2YU9C 3FKIK 3GTQC 4YFNA 4GTDA 1TWHK 4WJ3M 3BP8C 1JOEA 1VH2A 2NVTC 1R9TK 5M5XK 2R93A 2NVQC 3GTQK 4G7HA 4KASA 4BKWA 1L0WA 2D6FC 3S16K 2V6UA 4AYBL 4PABA 4X6AC 3IPJA 3GTQA 2WB1L 2Y0SL 1I6HK 4XLPA 4A3EC 1O28A 2R92A 4A3GK 1JVIA 2JA5K 1KQ4A 3GTGC 2R93C 1INNA 1X31C 5IYCC 4GTEA 4KM8A 2CW0A 3S2DC 3S1QK 5FLMC 3GTPK 1XXAA 2WB1D 1I6HC 2RH6A 3S1NC 4C45A 1O25A 3OEPA 3FOFA 1J6VA 1HQMA 3OPFA 4A3IC 2NVXA 2KWAA 1AB4A 4G7OA 1Y1VK 1WSRA 3GTLC 1XZQA 3CQZK 3Q3QA 2JA6K 1WOPA 1R9TC 5IYBC 5TMFA 4BY7C 3GTJC 2E2IC 1PJ7A 5CJ9A 3FOEA 4G0UA 3TTGA 4A3FC 4GTCA 3H0GA 4BY7K 2E2JK 3S1RK 3GIRA 5EGEA 3FKIC 5HL8A 1XXBA 4X6AK 2GAHC 5C4JK 5M3FK 2NVYC 1Y1VC 4XSZA 4FM9A 4KAWX 3S2HC 3I4MK 4BBSK 2JA5A 1RU0A 3A8JA 4LK0A 1F93A 4KMDA 3DXJA 5CHPA 1TWCA 3LPXA 4KARA 3S1NK 5M5YK 4A3IK 2GSUA 2R7ZK 3M4OK 1ZYRA 5IP9K 4NOIA 3G4CA 3AD9C 5IOSA 1I6VA 4C3HC 5TMCA 1ZXOA 3RZDC 3AQOA 1PJ6A 3PO2K 5FLMK 3GTPC 1VRQC 3K7AK 1BS2A 2R7ZA 2JH3A 4P5AA 4A3BK 2WAQL 4J3NA 3HKZL 5EGHA 1J98A 4C3JK 2A68A 1O2AA 1O2BA 4OIOA 4KC6A 2NVYA 4A3EK 1F7VA 4Y7NK 4A3LK 2GAGC 1WQGA 1IL2A 4G0VA 2V6TA 5C3EC 3HOUK 1BGWA 3V4GA 1TWCC 1O27A 2NVQK 1J6XA 4QJVA 3S15C 2P8TA 4LJZA 2A69A 5IOQA 3S1QC 1Y1WK 2Y3PA 4A3CK 1B4BA 4QIWD 3CQZA 2O5JA 1C0AA 1K83A 2JA6A 2E2HK 5IYDK 1I3QC 3HOVK 4KM9A 4YG2A 2FQTA 1WSVA 3A8IA 2PHCB
chains in the Genus database with same CATH topology
1ISEA 1XXAA 4KATA 4KMHA 2RH6A 2RGRA 1O25A 1ZBSA 3AQPA 3OEPA 4LR2A 4GT9A 4KDDA 1BJTA 3FOFA 3OPFA 3FHZA 3BUEA 2NVXA 2KWAA 1AB4A 3FKIA 4BLAA 1WQHA 1EK8A 3NUHA 4FZBA 2XCRB 1EH1A 3Q3QA 4KMAA 4GTBA 1B4AA 5CJ9A 3FOEA 5IOTA 4G0UA 3GTLA 1XXCA 4GTCA 3H0GA 1SFOA 1WCMA 1TWFA 1TWGA 1IS1A 5EGEA 3GTGA 4GTLA 1O26A 1WQFA 1XXBA 4KB4A 3ERED 1ZVUA 4GTFA 3GTMA 4FM9A 2JA7A 4KAWX 3GTJA 2E2IA 4C2MC 3L4JA 1O24A 2JA5A 1R9TA 4GFQA 4KMDA 5CHPA 5JVOA 1TWCA 3LPXA 2P5MA 4KARA 2GSNA 5IORA 3N0CA 4GTAA 3AH5A 2ZFZA 2GSUA 4ILDA 5TJ3A 3G4CA 2CFAB 4C3HC 5IOSA 1O29A 1ZXOA 3N0BA 2XCQA 3AQOA 3LAJA 1TWHA 2R7ZA 2JH3A 4P5AA 4LQYA 2B63A 4J3NA 2YU9A 5EGHA 3GTOA 4GTDA 2XCOA 1I3QA 3OREA 4G0WA 4C3IC 2R93A 3GTPA 1O2AA 3VA7A 1O2BA 4KC6A 2NVYA 4KASA 4BLBA 4BKWA 1WQGA 1DD5A 4G0VA 2CFAA 1F9NA 1BGWA 2GSOA 3GTQA 3V4GA 1O27A 4P5BA 4M1XA 2VUMA 4C3JC 1Y1VA 3N3YA 5IOQA 1O28A 2R92A 3CAGA 3G4AA 2Y3PA 3LAPA 3GTKA 1B4BA 2E2HA 3CQZA 4DDQA 1KQ4A 3MMLB 5JFEA 1TWAA 1K83A 2JA6A 4KB2A 1GE9A 4KM9A 3QX3A 4GTEA 1WIHA 4KM8A 1I50A 3L4KA 1Y1WA 2PHCB 3S0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O29 A;  3N0B A;  4KAT A;  1O27 A;  4P5B A;  4GTL A;  1O26 A;  1O25 A;  4GT9 A;  4P5A A;  3N3Y A;  5IOS A;  4GTF A;  5IOQ A;  1O28 A;  3G4A A;  4GTD A;  1O24 A;  4FZB A;  1KQ4 A;  5JFE A;  5CHP A;  1O2A A;  4KAR A;  1O2B A;  4GTB A;  4KAS A;  5IOR A;  3N0C A;  4GTA A;  3AH5 A;  4GTE A;  5IOT A;  3G4C A;  2CFA A;  2CFA B;  4GTC A; 
#chains in the Genus database with same CATH topology
 3M3Y K;  1F7U A;  3HOW C;  1XZP B;  3PO3 K;  4KMH A;  4BXX C;  3GTM C;  3TFJ A;  4Y52 K;  1ZBS A;  2O5I A;  2ZUE A;  1WCM C;  4BBS C;  3BUE A;  1USM A;  3HOY K;  4QIW L;  5C44 C;  5C4X K;  3NUH A;  4KN4 A;  1VLO A;  1EH1 A;  1TWG K;  1IE0 A;  4GTB A;  2E2J C;  4ZH4 A;  4KN7 A;  1Y1W C;  5IOT A;  3GTL A;  1XXC A;  5M3M K;  3SZZ A;  4XLN A;  3AD8 C;  1WCM A;  3CQZ C;  1EQR A;  3GTO K;  3GTG A;  4GTL A;  1O26 A;  1WQF A;  4KB4 A;  3H0G K;  1ZVU A;  3RZO C;  1WOR A;  3JST A;  5IP7 K;  2VUM K;  3GTJ A;  2E2I A;  3PO2 C;  3L4J A;  1O24 A;  3HOX K;  1R9T A;  4A3K C;  4C3H K;  1HI9 A;  2FQO A;  1K83 K;  4A3J K;  2GSN A;  3M4O C;  3HOX C;  1EFW A;  4GTA A;  3AH5 A;  4YFX A;  1IBA A;  3BP3 A;  2YU9 K;  3S2H K;  1BDF A;  4ILD A;  5TJ3 A;  2CFA B;  1IQ0 A;  1O29 A;  1TWF K;  1SMY A;  4MQ9 A;  1TWH A;  2A6E A;  4Y7N C;  2B63 A;  2YU9 A;  2PMZ L;  5D4D A;  2PPB A;  2EBB A;  4WJ4 A;  4C3I C;  4OIQ A;  4YFK A;  3S14 K;  1DD5 A;  2R92 C;  4BBR C;  1TWC K;  1YNJ A;  1F9N A;  1WCM K;  2GSO A;  4OIN A;  4XSX A;  4P5B A;  4Q5S A;  4M1X A;  3GSI A;  4XCH A;  1TWH C;  4A3L C;  1JQW A;  1Y1V A;  3GEE A;  4A3D C;  3CAG A;  3G4A A;  3GTK A;  4A3B C;  4DDQ A;  1I3Q K;  3MML B;  5JFE A;  1PJ5 A;  3T00 A;  1TWF C;  4KB2 A;  3AD7 C;  1YNN A;  1WIH A;  2JA8 C;  3HKZ D;  1Y1W A;  3S0X A;  1XPP A;  3H3V D;  3HOZ K;  2JA7 C;  1V5V A;  4Y52 C;  4GT9 A;  1BJT A;  1UV7 A;  3GTJ K;  3FHZ A;  2E2I K;  4C2M K;  4BLA A;  2R92 K;  1K83 C;  5M5W K;  3GTK C;  4Q4Z A;  4A3M C;  5C4J C;  2PA8 D;  2NVY K;  4LOW A;  1WOS A;  3WOD A;  2Y0S D;  3RZO K;  2ZUF A;  1WOO A;  1I50 K;  4WIL A;  5L46 A;  1SFO A;  1TWG A;  1IS1 A;  2JA6 C;  1IW7 A;  4JK1 A;  4BY1 K;  4QJV B;  3RZD K;  3HOU C;  3GTM A;  5IYC K;  2JA7 A;  3I4N K;  4P9S A;  1SFO K;  4A3J C;  5E68 A;  5JVO A;  5IOR A;  3M3Y C;  3N0C A;  3A8K A;  2ZFZ A;  4AYB D;  3N0B A;  2E2H C;  5IYD C;  4KMU A;  3S2D K;  5C3E K;  4LQY A;  3HOV C;  1G51 A;  1I50 C;  3S17 K;  3GTG K;  3GTO A;  2XCO A;  4C3I K;  1I3Q A;  3ORE A;  4G0W A;  3S15 K;  3GTP A;  3VA7 A;  2B63 K;  4BLB A;  3GTL K;  3S1M C;  4GZY A;  2BE5 A;  2V6S A;  3HOY C;  2CFA A;  2B63 C;  3H0G C;  3S1M K;  5FJ8 K;  4LLG A;  1J6W A;  5C44 K;  3S16 C;  2VUM A;  3TFH A;  2R7Z C;  4C3J C;  3N3Y A;  3S17 C;  3TFI A;  3GTM K;  3LAP A;  2E2H A;  2JA8 K;  1USO A;  3K7A C;  3HOZ C;  1O2F B;  1TWA A;  3I4N C;  3GEI A;  1GE9 A;  2WAQ D;  3QX3 A;  1XZQ B;  4A93 C;  3GTK K;  1I50 A;  3L4K A;  4G7Z A;  2JA5 C;  4MEX A;  1YX2 A;  1ISE A;  4KAT A;  1VJE A;  4A3G C;  3HXA A;  1TWA K;  2RGR A;  4A3K K;  4A3C C;  3AQP A;  2W7V A;  4LR2 A;  3ADA C;  4KDD A;  4MEY A;  3FKI A;  4AH6 A;  1WQH A;  1DCH A;  1DCP A;  1ZQ1 C;  4LK1 A;  2NVX C;  1EK8 A;  3S14 C;  4FZB A;  2XCR B;  3S1R C;  3GTO C;  2VUM C;  4KMA A;  4BBR K;  1B4A A;  3T01 A;  4RMF A;  4BY1 C;  3H3V L;  1TWA C;  3T02 A;  4OIP A;  2NVT K;  1TWF A;  4A3F K;  1TWG C;  3GEH A;  3ERE D;  5C4X C;  4GTF A;  5IYB K;  2NVX K;  4PAA A;  4C2M C;  2PA8 L;  4O2D A;  4GFQ A;  4A3M K;  2P5M A;  3HOW K;  3PO3 C;  4BXX K;  4A3D K;  2JA7 K;  1VGX A;  3I4M C;  2PMZ D;  1YCL A;  1EI6 A;  4A93 K;  2A6H A;  2XCQ A;  1SFO C;  3EQL A;  2R93 K;  5IP7 C;  4OIR A;  3LAJ A;  3GDZ A;  1DCO A;  5IP9 C;  1XZP A;  3SZY A;  2YU9 C;  3FKI K;  3GTQ C;  4YFN A;  4GTD A;  1TWH K;  4WJ3 M;  3BP8 C;  1JOE A;  1VH2 A;  2NVT C;  1R9T K;  5M5X K;  2R93 A;  2NVQ C;  3GTQ K;  4G7H A;  4KAS A;  4BKW A;  1L0W A;  2D6F C;  3S16 K;  2V6U A;  4AYB L;  4PAB A;  4X6A C;  3IPJ A;  3GTQ A;  2WB1 L;  2Y0S L;  1I6H K;  4XLP A;  4A3E C;  1O28 A;  2R92 A;  4A3G K;  1JVI A;  2JA5 K;  1KQ4 A;  3GTG C;  2R93 C;  1INN A;  1X31 C;  5IYC C;  4GTE A;  4KM8 A;  2CW0 A;  3S2D C;  3S1Q K;  5FLM C;  3GTP K;  1XXA A;  2WB1 D;  1I6H C;  2RH6 A;  3S1N C;  4C45 A;  1O25 A;  3OEP A;  3FOF A;  1J6V A;  1HQM A;  3OPF A;  4A3I C;  2NVX A;  2KWA A;  1AB4 A;  4G7O A;  1Y1V K;  1WSR A;  3GTL C;  1XZQ A;  3CQZ K;  3Q3Q A;  2JA6 K;  1WOP A;  1R9T C;  5IYB C;  5TMF A;  4BY7 C;  3GTJ C;  2E2I C;  1PJ7 A;  5CJ9 A;  3FOE A;  4G0U A;  3TTG A;  4A3F C;  4GTC A;  3H0G A;  4BY7 K;  2E2J K;  3S1R K;  3GIR A;  5EGE A;  3FKI C;  5HL8 A;  1XXB A;  4X6A K;  2GAH C;  5C4J K;  5M3F K;  2NVY C;  1Y1V C;  4XSZ A;  4FM9 A;  4KAW X;  3S2H C;  3I4M K;  4BBS K;  2JA5 A;  1RU0 A;  3A8J A;  4LK0 A;  1F93 A;  4KMD A;  3DXJ A;  5CHP A;  1TWC A;  3LPX A;  4KAR A;  3S1N K;  5M5Y K;  4A3I K;  2GSU A;  2R7Z K;  3M4O K;  1ZYR A;  5IP9 K;  4NOI A;  3G4C A;  3AD9 C;  5IOS A;  1I6V A;  4C3H C;  5TMC A;  1ZXO A;  3RZD C;  3AQO A;  1PJ6 A;  3PO2 K;  5FLM K;  3GTP C;  1VRQ C;  3K7A K;  1BS2 A;  2R7Z A;  2JH3 A;  4P5A A;  4A3B K;  2WAQ L;  4J3N A;  3HKZ L;  5EGH A;  1J98 A;  4C3J K;  2A68 A;  1O2A A;  1O2B A;  4OIO A;  4KC6 A;  2NVY A;  4A3E K;  1F7V A;  4Y7N K;  4A3L K;  2GAG C;  1WQG A;  1IL2 A;  4G0V A;  2V6T A;  5C3E C;  3HOU K;  1BGW A;  3V4G A;  1TWC C;  1O27 A;  2NVQ K;  1J6X A;  4QJV A;  3S15 C;  2P8T A;  4LJZ A;  2A69 A;  5IOQ A;  3S1Q C;  1Y1W K;  2Y3P A;  4A3C K;  1B4B A;  4QIW D;  3CQZ A;  2O5J A;  1C0A A;  1K83 A;  2JA6 A;  2E2H K;  5IYD K;  1I3Q C;  3HOV K;  4KM9 A;  4YG2 A;  2FQT A;  1WSV A;  3A8I A;  2PHC B; 
#chains in the Genus database with same CATH homology
 1ISE A;  1XXA A;  4KAT A;  4KMH A;  2RH6 A;  2RGR A;  1O25 A;  1ZBS A;  3AQP A;  3OEP A;  4LR2 A;  4GT9 A;  4KDD A;  1BJT A;  3FOF A;  3OPF A;  3FHZ A;  3BUE A;  2NVX A;  2KWA A;  1AB4 A;  3FKI A;  4BLA A;  1WQH A;  1EK8 A;  3NUH A;  4FZB A;  2XCR B;  1EH1 A;  3Q3Q A;  4KMA A;  4GTB A;  1B4A A;  5CJ9 A;  3FOE A;  5IOT A;  4G0U A;  3GTL A;  1XXC A;  4GTC A;  3H0G A;  1SFO A;  1WCM A;  1TWF A;  1TWG A;  1IS1 A;  5EGE A;  3GTG A;  4GTL A;  1O26 A;  1WQF A;  1XXB A;  4KB4 A;  3ERE D;  1ZVU A;  4GTF A;  3GTM A;  4FM9 A;  2JA7 A;  4KAW X;  3GTJ A;  2E2I A;  4C2M C;  3L4J A;  1O24 A;  2JA5 A;  1R9T A;  4GFQ A;  4KMD A;  5CHP A;  5JVO A;  1TWC A;  3LPX A;  2P5M A;  4KAR A;  2GSN A;  5IOR A;  3N0C A;  4GTA A;  3AH5 A;  2ZFZ A;  2GSU A;  4ILD A;  5TJ3 A;  3G4C A;  2CFA B;  4C3H C;  5IOS A;  1O29 A;  1ZXO A;  3N0B A;  2XCQ A;  3AQO A;  3LAJ A;  1TWH A;  2R7Z A;  2JH3 A;  4P5A A;  4LQY A;  2B63 A;  4J3N A;  2YU9 A;  5EGH A;  3GTO A;  4GTD A;  2XCO A;  1I3Q A;  3ORE A;  4G0W A;  4C3I C;  2R93 A;  3GTP A;  1O2A A;  3VA7 A;  1O2B A;  4KC6 A;  2NVY A;  4KAS A;  4BLB A;  4BKW A;  1WQG A;  1DD5 A;  4G0V A;  2CFA A;  1F9N A;  1BGW A;  2GSO A;  3GTQ A;  3V4G A;  1O27 A;  4P5B A;  4M1X A;  2VUM A;  4C3J C;  1Y1V A;  3N3Y A;  5IOQ A;  1O28 A;  2R92 A;  3CAG A;  3G4A A;  2Y3P A;  3LAP A;  3GTK A;  1B4B A;  2E2H A;  3CQZ A;  4DDQ A;  1KQ4 A;  3MML B;  5JFE A;  1TWA A;  1K83 A;  2JA6 A;  4KB2 A;  1GE9 A;  4KM9 A;  3QX3 A;  4GTE A;  1WIH A;  4KM8 A;  1I50 A;  3L4K A;  1Y1W A;  2PHC B;  3S0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...