3G4AA

Crystal structure of flavine dependant thymidylate synthase s88a mutant from thermotoga maritima at 1.95 angstrom resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
218
structure length
218
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELAGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unusual mechanism of thymidylate biosynthesis in organisms containing the thyX gene.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 78
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3g4aA00
4GT9A 5IOSA 1O27A 5CHPA 3N0CA 1O28A 4GTCA 5IOTA 4P5BA 4KARA 2CFAA 1KQ4A 4GTEA 4GTLA 1O24A 5IOQA 1O2AA 3G4CA 2CFAB 4GTBA 4GTFA 4P5AA 4FZBA 3G4AA 1O2BA 4KATA 1O29A 3N3YA 3N0BA 4GTDA 1O26A 4KASA 5IORA 5JFEA 4GTAA 1O25A 3AH5A
chains in the Genus database with same CATH superfamily
2GSNA 3MMLB 2JH3A 2NVTK 4C2MC 1DD5A 1O27A 3GSIA 3GTLK 4GTCA 5M3MK 3FKIC 4YG2A 4Y7NK 3BUEA 3AD8C 3GTOC 4ILDA 2W7VA 4FZBA 3HOZC 4X6AC 1DCHA 2XCOA 4MQ9A 4C3HC 2P5MA 4BLAA 1USOA 2E2JK 3GTMA 1EFWA 1X31C 3FKIA 4A3BK 1I3QC 2BE5A 4GT9A 2YU9A 4C3IK 2NVYK 2PHCB 4KMUA 4A3LK 2D6FC 2CFAB 2JA6C 2VUMA 1GE9A 1XZPB 3ERED 4G0WA 3GTQA 2E2IA 1XZPA 3L4JA 3GTQK 1I6VA 2GSOA 2XCQA 2V6UA 1TWCC 3AH5A 1I50A 3S1QC 3A8KA 4BBSC 2JA5C 3S16C 1HQMA 1B4AA 2NVYA 3GEIA 3K7AC 3S15C 1J6WA 3HOYC 1B4BA 1TWCK 4BBSK 3G4AA 5E68A 2R7ZC 3HOWC 3BP3A 3PO2C 3S1MK 1XPPA 3S17C 3S2DC 3PO3K 4A3DC 1TWAK 3GTQC 4KMHA 4FM9A 3S2HC 3H0GK 2Y3PA 5JFEA 4BY7C 4OINA 1Y1VK 3PO2K 2EBBA 3LPXA 4BY1K 5IOTA 3S1RK 4XCHA 5FJ8K 3RZDK 4AYBL 1TWHC 1XZQA 2B63K 3LAJA 3AQPA 1J98A 1VGXA 4Y52C 4J3NA 4OIOA 1O26A 1L0WA 4WILA 2WAQD 4QJVA 4BBRC 1BDFA 2Y0SD 3Q3QA 5L46A 2E2IK 4QIWL 4XLPA 4A3MK 4G0UA 4A3IK 3T00A 3H0GC 1K83K 4KB4A 1XXCA 2P8TA 1K83A 3GTLC 2ZUFA 2JA7C 1IBAA 1WCMK 3AQOA 4GTDA 1YX2A 3HOXK 5TMCA 2B63C 1WQFA 5C4JK 4GFQA 4KASA 5IP9K 5C44C 4BKWA 4XLNA 1C0AA 1BS2A 4XSZA 3S16K 5IYCC 2WAQL 1WQGA 3S15K 4XSXA 3T02A 1YNJA 1O24A 5FLMK 4YFNA 4A3JC 3H3VD 5EGEA 1BGWA 2NVXA 4A3MC 4Q4ZA 3GTOK 5FLMC 3S14K 2NVQK 3GTGK 3EQLA 4A3CK 5CJ9A 2GAGC 5IP9C 1IE0A 4C2MK 1O25A 3GTPC 2GAHC 3HOXC 4KAWX 1UV7A 1O28A 2NVXC 5C4JC 3BP8C 3GDZA 3HOVK 4GTLA 2VUMK 1TWCA 3G4CA 4WJ3M 1TWAC 1F93A 3OPFA 1O2BA 1F7UA 1ZVUA 2PA8L 2PPBA 3GTJA 3RZOC 4O2DA 3V4GA 3S1NK 3CQZC 3SZZA 5IOSA 4MEYA 5CHPA 3N0CA 4Y7NC 4Y52K 1USMA 3QX3A 1PJ5A 3K7AK 5IOQA 4KN4A 1PJ6A 1XXAA 4P5AA 4A3GK 1JOEA 1WIHA 4LK1A 4KMDA 2R92C 1WOPA 1R9TC 1WSVA 2FQOA 4RMFA 3GTKK 3S17K 3S2DK 1ZQ1C 4ZH4A 3TFHA 4A3JK 1AB4A 5D4DA 1INNA 3HOVC 1BJTA 1EQRA 1WCMA 2NVXK 1ZXOA 1TWHA 1VH2A 4G7OA 5C4XC 3GEHA 4KM9A 3S14C 3GTGA 2E2JC 4A3GC 5C44K 4KATA 1O29A 2PA8D 4LJZA 2O5IA 1VLOA 1Y1WA 3CQZK 3HOZK 2WB1D 4X6AK 4G0VA 3TFJA 2FQTA 2A69A 1I3QA 3I4NC 3GTKC 4PABA 1O2FB 3GTJC 3HXAA 5TMFA 5M3FK 3S1RC 1Y1VC 2PMZL 4KC6A 2CW0A 4WJ4A 1O2AA 1TWFK 3S1MC 3AD9C 4A3DK 2NVYC 1R9TA 4LQYA 3N3YA 4MEXA 3GTOA 3GTPA 3GEEA 3GTPK 5IYDC 3T01A 3S1QK 2R93A 3ADAC 5IP7C 4KMAA 1G51A 5TJ3A 4KDDA 3TTGA 4OIQA 4A3BC 2E2IC 1YNNA 1ISEA 5C3EC 5HL8A 1F7VA 2JA8K 4BLBA 3OREA 3JSTA 3GTMK 1WOSA 1I6HK 4KB2A 1VRQC 4A3KC 2R7ZA 4A93K 4LK0A 2NVTC 4LOWA 1I50K 2PMZD 2B63A 4YFKA 3A8JA 4G7HA 4A93C 4P9SA 5M5XK 2R93K 1J6VA 1WORA 3FHZA 3I4MK 1J6XA 1I50C 2Y0SL 2JA7A 2JA7K 4C3IC 1K83C 3GIRA 3GTLA 1XZQB 5IYBC 2JA5K 4YFXA 2WB1L 1WQHA 1XXBA 4LLGA 1YCLA 3NUHA 1TWFC 3GTKA 1TWGC 1DCPA 2A68A 4KN7A 1VJEA 2GSUA 3HKZL 1JQWA 2JA6A 1TWGK 3FKIK 2O5JA 4A3EK 5IYCK 5C3EK 5C4XK 3H3VL 2R93C 3TFIA 2KWAA 3FOFA 3M4OK 3M3YK 4PAAA 1V5VA 4A3EC 1DCOA 4GTEA 4OIRA 2E2HC 4NOIA 1ZBSA 4GTFA 2RGRA 3A8IA 1I6HC 3GTJK 4A3FK 3HOUC 3DXJA 5M5WK 4A3KK 4A3CC 3S2HK 5EGHA 4BY7K 1Y1VA 1EI6A 4M1XA 3H0GA 3PO3C 2R92A 4A3FC 3IPJA 4BBRK 4BXXK 3OEPA 4P5BA 3HOWK 1Y1WC 2R7ZK 4C3JK 2CFAA 3LAPA 1SFOK 1KQ4A 3SZYA 2YU9K 3S0XA 1WOOA 1PJ7A 3WODA 3FOEA 1HI9A 4GZYA 1TWHK 2RH6A 4QIWD 3S1NC 3M3YC 4C3JC 1SFOC 1WCMC 3AD7C 3VA7A 3RZDC 5IORA 1TWAA 5M5YK 2V6SA 4BY1C 2A6EA 1RU0A 1SFOA 4KM8A 4AYBD 1F9NA 2ZUEA 3I4NK 1R9TK 1JVIA 1EK8A 2R92K 4GTBA 3HKZD 1TWGA 2A6HA 4A3LC 2E2HK 1SMYA 1TWFA 4JK1A 2V6TA 2JA6K 4QJVB 1ZYRA 2YU9C 3HOYK 1IS1A 3L4KA 3M4OC 3GTMC 1I3QK 1EH1A 4LR2A 4BXXC 3CQZA 3RZOK 2ZFZA 2JA5A 5JVOA 1Y1WK 1IL2A 4A3IC 4Q5SA 1IW7A 4KARA 3CAGA 4C45A 4C3HK 2E2HA 4OIPA 3HOUK 2JA8C 3I4MC 5IYBK 5IYDK 3N0BA 4G7ZA 2VUMC 1WSRA 2XCRB 4AH6A 1IQ0A 4DDQA 2NVQC 5IP7K 3GTGC 4GTAA
chains in the Genus database with same CATH topology
2GSNA 3MMLB 1AB4A 2JH3A 4C2MC 1DD5A 1O27A 3Q3QA 2KWAA 1BJTA 4GTCA 3FOFA 4G0UA 1WCMA 3BUEA 1ZXOA 4GTEA 4KB4A 1TWHA 4ILDA 1ZBSA 4GTFA 1XXCA 4KM9A 3GTGA 1K83A 4FZBA 2XCOA 4KATA 2RGRA 1O29A 3AQOA 4C3HC 2P5MA 4GTDA 4BLAA 1Y1WA 1WQFA 5EGHA 1Y1VA 4GFQA 4KASA 4M1XA 4G0VA 3GTMA 3H0GA 4BKWA 1I3QA 2R92A 3FKIA 4GT9A 2YU9A 3OEPA 1WQGA 2PHCB 4KC6A 4P5BA 2CFAA 3LAPA 1KQ4A 3S0XA 1O24A 1O2AA 2CFAB 3FOEA 2VUMA 5EGEA 1BGWA 1GE9A 2RH6A 3ERED 4G0WA 2NVXA 1R9TA 4LQYA 3N3YA 4C3JC 3GTQA 2E2IA 3GTOA 3GTPA 3L4JA 2R93A 2GSOA 2XCQA 4KMAA 3VA7A 5CJ9A 5IORA 1TWAA 5TJ3A 4KDDA 1O25A 3AH5A 1I50A 4KAWX 1ISEA 1SFOA 4KM8A 1O28A 1F9NA 1B4AA 2NVYA 4GTLA 1B4BA 4BLBA 1EK8A 1TWCA 3G4CA 1TWGA 3OREA 4GTBA 1TWFA 3G4AA 3OPFA 1O2BA 4KB2A 1ZVUA 2R7ZA 3GTJA 1IS1A 3L4KA 3V4GA 2B63A 4KMHA 4FM9A 2Y3PA 1EH1A 4LR2A 5JFEA 3CQZA 2ZFZA 2JA5A 3LPXA 5JVOA 5IOSA 3FHZA 5CHPA 3N0CA 2JA7A 5IOTA 4C3IC 4KARA 3GTLA 3CAGA 3QX3A 1WQHA 5IOQA 2E2HA 1XXBA 1XXAA 4P5AA 3NUHA 3LAJA 1WIHA 3AQPA 3GTKA 4KMDA 3N0BA 4J3NA 1O26A 2GSUA 2JA6A 2XCRB 4DDQA 4GTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GT9 A;  5IOS A;  1O27 A;  5CHP A;  3N0C A;  1O28 A;  4GTC A;  5IOT A;  4P5B A;  4KAR A;  2CFA A;  1KQ4 A;  4GTE A;  4GTL A;  1O24 A;  5IOQ A;  1O2A A;  3G4C A;  2CFA B;  4GTB A;  4GTF A;  4P5A A;  4FZB A;  3G4A A;  1O2B A;  4KAT A;  1O29 A;  3N3Y A;  3N0B A;  4GTD A;  1O26 A;  4KAS A;  5IOR A;  5JFE A;  4GTA A;  1O25 A;  3AH5 A; 
#chains in the Genus database with same CATH topology
 2GSN A;  3MML B;  2JH3 A;  2NVT K;  4C2M C;  1DD5 A;  1O27 A;  3GSI A;  3GTL K;  4GTC A;  5M3M K;  3FKI C;  4YG2 A;  4Y7N K;  3BUE A;  3AD8 C;  3GTO C;  4ILD A;  2W7V A;  4FZB A;  3HOZ C;  4X6A C;  1DCH A;  2XCO A;  4MQ9 A;  4C3H C;  2P5M A;  4BLA A;  1USO A;  2E2J K;  3GTM A;  1EFW A;  1X31 C;  3FKI A;  4A3B K;  1I3Q C;  2BE5 A;  4GT9 A;  2YU9 A;  4C3I K;  2NVY K;  2PHC B;  4KMU A;  4A3L K;  2D6F C;  2CFA B;  2JA6 C;  2VUM A;  1GE9 A;  1XZP B;  3ERE D;  4G0W A;  3GTQ A;  2E2I A;  1XZP A;  3L4J A;  3GTQ K;  1I6V A;  2GSO A;  2XCQ A;  2V6U A;  1TWC C;  3AH5 A;  1I50 A;  3S1Q C;  3A8K A;  4BBS C;  2JA5 C;  3S16 C;  1HQM A;  1B4A A;  2NVY A;  3GEI A;  3K7A C;  3S15 C;  1J6W A;  3HOY C;  1B4B A;  1TWC K;  4BBS K;  3G4A A;  5E68 A;  2R7Z C;  3HOW C;  3BP3 A;  3PO2 C;  3S1M K;  1XPP A;  3S17 C;  3S2D C;  3PO3 K;  4A3D C;  1TWA K;  3GTQ C;  4KMH A;  4FM9 A;  3S2H C;  3H0G K;  2Y3P A;  5JFE A;  4BY7 C;  4OIN A;  1Y1V K;  3PO2 K;  2EBB A;  3LPX A;  4BY1 K;  5IOT A;  3S1R K;  4XCH A;  5FJ8 K;  3RZD K;  4AYB L;  1TWH C;  1XZQ A;  2B63 K;  3LAJ A;  3AQP A;  1J98 A;  1VGX A;  4Y52 C;  4J3N A;  4OIO A;  1O26 A;  1L0W A;  4WIL A;  2WAQ D;  4QJV A;  4BBR C;  1BDF A;  2Y0S D;  3Q3Q A;  5L46 A;  2E2I K;  4QIW L;  4XLP A;  4A3M K;  4G0U A;  4A3I K;  3T00 A;  3H0G C;  1K83 K;  4KB4 A;  1XXC A;  2P8T A;  1K83 A;  3GTL C;  2ZUF A;  2JA7 C;  1IBA A;  1WCM K;  3AQO A;  4GTD A;  1YX2 A;  3HOX K;  5TMC A;  2B63 C;  1WQF A;  5C4J K;  4GFQ A;  4KAS A;  5IP9 K;  5C44 C;  4BKW A;  4XLN A;  1C0A A;  1BS2 A;  4XSZ A;  3S16 K;  5IYC C;  2WAQ L;  1WQG A;  3S15 K;  4XSX A;  3T02 A;  1YNJ A;  1O24 A;  5FLM K;  4YFN A;  4A3J C;  3H3V D;  5EGE A;  1BGW A;  2NVX A;  4A3M C;  4Q4Z A;  3GTO K;  5FLM C;  3S14 K;  2NVQ K;  3GTG K;  3EQL A;  4A3C K;  5CJ9 A;  2GAG C;  5IP9 C;  1IE0 A;  4C2M K;  1O25 A;  3GTP C;  2GAH C;  3HOX C;  4KAW X;  1UV7 A;  1O28 A;  2NVX C;  5C4J C;  3BP8 C;  3GDZ A;  3HOV K;  4GTL A;  2VUM K;  1TWC A;  3G4C A;  4WJ3 M;  1TWA C;  1F93 A;  3OPF A;  1O2B A;  1F7U A;  1ZVU A;  2PA8 L;  2PPB A;  3GTJ A;  3RZO C;  4O2D A;  3V4G A;  3S1N K;  3CQZ C;  3SZZ A;  5IOS A;  4MEY A;  5CHP A;  3N0C A;  4Y7N C;  4Y52 K;  1USM A;  3QX3 A;  1PJ5 A;  3K7A K;  5IOQ A;  4KN4 A;  1PJ6 A;  1XXA A;  4P5A A;  4A3G K;  1JOE A;  1WIH A;  4LK1 A;  4KMD A;  2R92 C;  1WOP A;  1R9T C;  1WSV A;  2FQO A;  4RMF A;  3GTK K;  3S17 K;  3S2D K;  1ZQ1 C;  4ZH4 A;  3TFH A;  4A3J K;  1AB4 A;  5D4D A;  1INN A;  3HOV C;  1BJT A;  1EQR A;  1WCM A;  2NVX K;  1ZXO A;  1TWH A;  1VH2 A;  4G7O A;  5C4X C;  3GEH A;  4KM9 A;  3S14 C;  3GTG A;  2E2J C;  4A3G C;  5C44 K;  4KAT A;  1O29 A;  2PA8 D;  4LJZ A;  2O5I A;  1VLO A;  1Y1W A;  3CQZ K;  3HOZ K;  2WB1 D;  4X6A K;  4G0V A;  3TFJ A;  2FQT A;  2A69 A;  1I3Q A;  3I4N C;  3GTK C;  4PAB A;  1O2F B;  3GTJ C;  3HXA A;  5TMF A;  5M3F K;  3S1R C;  1Y1V C;  2PMZ L;  4KC6 A;  2CW0 A;  4WJ4 A;  1O2A A;  1TWF K;  3S1M C;  3AD9 C;  4A3D K;  2NVY C;  1R9T A;  4LQY A;  3N3Y A;  4MEX A;  3GTO A;  3GTP A;  3GEE A;  3GTP K;  5IYD C;  3T01 A;  3S1Q K;  2R93 A;  3ADA C;  5IP7 C;  4KMA A;  1G51 A;  5TJ3 A;  4KDD A;  3TTG A;  4OIQ A;  4A3B C;  2E2I C;  1YNN A;  1ISE A;  5C3E C;  5HL8 A;  1F7V A;  2JA8 K;  4BLB A;  3ORE A;  3JST A;  3GTM K;  1WOS A;  1I6H K;  4KB2 A;  1VRQ C;  4A3K C;  2R7Z A;  4A93 K;  4LK0 A;  2NVT C;  4LOW A;  1I50 K;  2PMZ D;  2B63 A;  4YFK A;  3A8J A;  4G7H A;  4A93 C;  4P9S A;  5M5X K;  2R93 K;  1J6V A;  1WOR A;  3FHZ A;  3I4M K;  1J6X A;  1I50 C;  2Y0S L;  2JA7 A;  2JA7 K;  4C3I C;  1K83 C;  3GIR A;  3GTL A;  1XZQ B;  5IYB C;  2JA5 K;  4YFX A;  2WB1 L;  1WQH A;  1XXB A;  4LLG A;  1YCL A;  3NUH A;  1TWF C;  3GTK A;  1TWG C;  1DCP A;  2A68 A;  4KN7 A;  1VJE A;  2GSU A;  3HKZ L;  1JQW A;  2JA6 A;  1TWG K;  3FKI K;  2O5J A;  4A3E K;  5IYC K;  5C3E K;  5C4X K;  3H3V L;  2R93 C;  3TFI A;  2KWA A;  3FOF A;  3M4O K;  3M3Y K;  4PAA A;  1V5V A;  4A3E C;  1DCO A;  4GTE A;  4OIR A;  2E2H C;  4NOI A;  1ZBS A;  4GTF A;  2RGR A;  3A8I A;  1I6H C;  3GTJ K;  4A3F K;  3HOU C;  3DXJ A;  5M5W K;  4A3K K;  4A3C C;  3S2H K;  5EGH A;  4BY7 K;  1Y1V A;  1EI6 A;  4M1X A;  3H0G A;  3PO3 C;  2R92 A;  4A3F C;  3IPJ A;  4BBR K;  4BXX K;  3OEP A;  4P5B A;  3HOW K;  1Y1W C;  2R7Z K;  4C3J K;  2CFA A;  3LAP A;  1SFO K;  1KQ4 A;  3SZY A;  2YU9 K;  3S0X A;  1WOO A;  1PJ7 A;  3WOD A;  3FOE A;  1HI9 A;  4GZY A;  1TWH K;  2RH6 A;  4QIW D;  3S1N C;  3M3Y C;  4C3J C;  1SFO C;  1WCM C;  3AD7 C;  3VA7 A;  3RZD C;  5IOR A;  1TWA A;  5M5Y K;  2V6S A;  4BY1 C;  2A6E A;  1RU0 A;  1SFO A;  4KM8 A;  4AYB D;  1F9N A;  2ZUE A;  3I4N K;  1R9T K;  1JVI A;  1EK8 A;  2R92 K;  4GTB A;  3HKZ D;  1TWG A;  2A6H A;  4A3L C;  2E2H K;  1SMY A;  1TWF A;  4JK1 A;  2V6T A;  2JA6 K;  4QJV B;  1ZYR A;  2YU9 C;  3HOY K;  1IS1 A;  3L4K A;  3M4O C;  3GTM C;  1I3Q K;  1EH1 A;  4LR2 A;  4BXX C;  3CQZ A;  3RZO K;  2ZFZ A;  2JA5 A;  5JVO A;  1Y1W K;  1IL2 A;  4A3I C;  4Q5S A;  1IW7 A;  4KAR A;  3CAG A;  4C45 A;  4C3H K;  2E2H A;  4OIP A;  3HOU K;  2JA8 C;  3I4M C;  5IYB K;  5IYD K;  3N0B A;  4G7Z A;  2VUM C;  1WSR A;  2XCR B;  4AH6 A;  1IQ0 A;  4DDQ A;  2NVQ C;  5IP7 K;  3GTG C;  4GTA A; 
#chains in the Genus database with same CATH homology
 2GSN A;  3MML B;  1AB4 A;  2JH3 A;  4C2M C;  1DD5 A;  1O27 A;  3Q3Q A;  2KWA A;  1BJT A;  4GTC A;  3FOF A;  4G0U A;  1WCM A;  3BUE A;  1ZXO A;  4GTE A;  4KB4 A;  1TWH A;  4ILD A;  1ZBS A;  4GTF A;  1XXC A;  4KM9 A;  3GTG A;  1K83 A;  4FZB A;  2XCO A;  4KAT A;  2RGR A;  1O29 A;  3AQO A;  4C3H C;  2P5M A;  4GTD A;  4BLA A;  1Y1W A;  1WQF A;  5EGH A;  1Y1V A;  4GFQ A;  4KAS A;  4M1X A;  4G0V A;  3GTM A;  3H0G A;  4BKW A;  1I3Q A;  2R92 A;  3FKI A;  4GT9 A;  2YU9 A;  3OEP A;  1WQG A;  2PHC B;  4KC6 A;  4P5B A;  2CFA A;  3LAP A;  1KQ4 A;  3S0X A;  1O24 A;  1O2A A;  2CFA B;  3FOE A;  2VUM A;  5EGE A;  1BGW A;  1GE9 A;  2RH6 A;  3ERE D;  4G0W A;  2NVX A;  1R9T A;  4LQY A;  3N3Y A;  4C3J C;  3GTQ A;  2E2I A;  3GTO A;  3GTP A;  3L4J A;  2R93 A;  2GSO A;  2XCQ A;  4KMA A;  3VA7 A;  5CJ9 A;  5IOR A;  1TWA A;  5TJ3 A;  4KDD A;  1O25 A;  3AH5 A;  1I50 A;  4KAW X;  1ISE A;  1SFO A;  4KM8 A;  1O28 A;  1F9N A;  1B4A A;  2NVY A;  4GTL A;  1B4B A;  4BLB A;  1EK8 A;  1TWC A;  3G4C A;  1TWG A;  3ORE A;  4GTB A;  1TWF A;  3G4A A;  3OPF A;  1O2B A;  4KB2 A;  1ZVU A;  2R7Z A;  3GTJ A;  1IS1 A;  3L4K A;  3V4G A;  2B63 A;  4KMH A;  4FM9 A;  2Y3P A;  1EH1 A;  4LR2 A;  5JFE A;  3CQZ A;  2ZFZ A;  2JA5 A;  3LPX A;  5JVO A;  5IOS A;  3FHZ A;  5CHP A;  3N0C A;  2JA7 A;  5IOT A;  4C3I C;  4KAR A;  3GTL A;  3CAG A;  3QX3 A;  1WQH A;  5IOQ A;  2E2H A;  1XXB A;  1XXA A;  4P5A A;  3NUH A;  3LAJ A;  1WIH A;  3AQP A;  3GTK A;  4KMD A;  3N0B A;  4J3N A;  1O26 A;  2GSU A;  2JA6 A;  2XCR B;  4DDQ A;  4GTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...