3G4CA

Flavine dependant thymidylate syntahse s88c mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
209
Chain Sequence
b'HHMKIDILDKGFVELVDVMGNDLSAVRAARVSERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELCGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title An unusual mechanism of thymidylate biosynthesis in organisms containing the thyX gene.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 77
structure length 209
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3g4cA00
1O28A 4GTDA 5IORA 1O27A 3G4AA 4GTAA 4GTEA 1O24A 1O29A 3N0CA 4KARA 1KQ4A 3N0BA 5JFEA 1O25A 3AH5A 4P5BA 4GTCA 4GT9A 2CFAB 2CFAA 3N3YA 4GTLA 3G4CA 1O2AA 4GTBA 5IOQA 5IOSA 1O26A 5IOTA 4GTFA 4P5AA 5CHPA 4KASA 4FZBA 4KATA 1O2BA
chains in the Genus database with same CATH superfamily
2NVYA 3A8KA 3S2DC 1TWAA 2A68A 2VUMC 4BKWA 1C0AA 4KMUA 1IL2A 4KARA 3HOUK 3I4MC 3N0BA 3GTPA 1EK8A 4Y7NK 1ZQ1C 4BBRC 1IW7A 5EGEA 1SMYA 1K83C 3S0XA 1O2AA 5HL8A 2PA8L 3S1RK 2B63C 3LAPA 4P5AA 1B4BA 1VH2A 4Q5SA 1O2BA 3H0GK 4P9SA 1BS2A 2NVQC 5IORA 1G51A 5IYDK 1IQ0A 4GFQA 3AD9C 2E2HK 2JA6A 3IPJA 3N0CA 4QIWD 1EH1A 2PA8D 2XCRB 3AD8C 4LLGA 3M3YC 1WOOA 4X6AK 3HOWC 4YFKA 4JK1A 3JSTA 4A3FC 2E2HA 1WQHA 2JA5C 1WSVA 4YFNA 1R9TK 3S16C 3HOVC 2V6SA 4A3BK 5IYBK 1L0WA 1I50K 2WAQL 5IP7K 1O28A 1R9TA 1GE9A 2XCOA 5C4JK 1ZYRA 3I4NK 4C3IC 1TWHC 3OREA 2Y3PA 3AH5A 1F9NA 1VRQC 1Y1VK 2NVYC 1TWAC 4KB2A 4LJZA 2A69A 3N3YA 1HI9A 2FQOA 3T00A 4Y52C 3H3VL 5IP9C 3GTPC 2PMZL 4J3NA 5EGHA 1Y1VA 1XZPB 2PPBA 4KC6A 1J6VA 2O5JA 3HOUC 4GTEA 1TWFA 1VLOA 3OEPA 4A3CK 1B4AA 4GTCA 3BP3A 2XCQA 4KM9A 5IYCK 2KWAA 3S1RC 2JA6C 4ILDA 1WIHA 3TFIA 1X31C 1J98A 3HOWK 3H0GC 4BY1K 1DCHA 5IYDC 3AD7C 5CHPA 4G7OA 2E2HC 3HOVK 4ZH4A 1SFOK 4G0WA 1O2FB 3BP8C 3GTKK 3TTGA 4OIRA 3AQOA 4KMDA 4KMAA 1R9TC 1SFOA 5D4DA 3S1QK 4C3HC 2NVTK 5M3FK 1I50C 3GTOA 2NVYK 1VJEA 3HKZD 3RZOK 1XZPA 1PJ7A 4MQ9A 5C3EK 4XCHA 1PJ6A 5C4JC 1I3QK 3I4NC 4KAWX 2Y0SD 1WORA 4OIPA 1J6XA 1Y1VC 2P5MA 3ERED 4KMHA 2A6EA 3S17C 4G0UA 1I6HC 3BUEA 4O2DA 1HQMA 3DXJA 1I3QA 2CW0A 2R93K 3NUHA 1DD5A 1RU0A 3A8JA 1TWFC 4NOIA 4GZYA 4XSXA 4QIWL 1O26A 2JA6K 2ZUEA 3GEHA 1WSRA 2BE5A 4KASA 4KATA 5TJ3A 2R93A 5C44C 4A3IK 4A3CC 1YX2A 1WCMK 4MEYA 5C4XK 4C45A 3FOFA 5IYCC 1O25A 4KB4A 3PO3K 2CFAB 3GTQK 5M5WK 3CQZK 3CAGA 1WCMA 5FJ8K 4BY1C 3GTQA 4C3HK 1SFOC 3CQZA 4OINA 3RZDK 2JA7K 2E2IK 2RH6A 4GTAA 1WQFA 3GTKC 2R92K 1V5VA 1UV7A 1KQ4A 2JA7A 2E2IA 4A3KC 3S1QC 2NVTC 4LR2A 3S17K 2NVXK 2R92A 1ZXOA 1I6HK 3GTJK 3RZOC 1EFWA 5C3EC 1TWFK 1I3QC 1XXCA 2NVXA 1I6VA 3G4AA 3GTJA 1XXBA 5C44K 4WJ4A 2GSOA 2R93C 3GDZA 1XZQB 2CFAA 3PO2C 2GSNA 3S14K 2R7ZA 4KDDA 4M1XA 4BXXK 2WB1D 3LAJA 4A3IC 3GIRA 4GTFA 1WCMC 5C4XC 4GTDA 1K83A 1YCLA 3PO3C 3GTQC 3GTLA 4A3MK 4KN7A 3CQZC 3GTOK 3HKZL 2ZFZA 1JOEA 4WILA 1USOA 4RMFA 2Y0SL 4A3KK 5IOSA 1YNJA 3RZDC 2JA7C 2E2IC 4A3JK 2E2JK 1IS1A 4BLBA 3K7AK 5IOTA 5M5YK 5FLMK 4OIQA 3GTMK 2R92C 3FHZA 2JA8K 2W7VA 3S1MK 4LOWA 4QJVB 2GSUA 3T01A 3GTMA 4XLPA 4GT9A 2NVXC 1WOPA 1JVIA 1DCPA 1TWCK 3GTJC 1XZQA 4GTLA 4G0VA 3PO2K 4A3EK 1WQGA 2O5IA 1TWCA 2YU9K 3GTGK 4BBSK 3ADAC 3A8IA 3GSIA 4AYBL 1USMA 4A3GK 1J6WA 1ISEA 4A3DK 3L4KA 2PHCB 4LK0A 3S14C 4WJ3M 2YU9A 3FKIK 3GTGA 1Y1WK 4BXXC 1BDFA 1VGXA 5CJ9A 1INNA 4GTBA 2GAHC 4AYBD 1TWGK 3GTLC 4XSZA 1EQRA 2JH3A 3FKIA 2RGRA 3S15K 1Y1WA 2GAGC 1ZBSA 3WODA 4C2MK 4KM8A 3Q3QA 1TWGA 4A3MC 4Q4ZA 3GTOC 3V4GA 1O29A 1WOSA 1JQWA 4QJVA 5JFEA 3H0GA 1IBAA 4DDQA 3S2HK 3S1NK 4A3LK 4XLNA 4C3JK 2P8TA 1BGWA 4A3JC 2E2JC 3TFHA 3K7AC 3M4OK 1PJ5A 3OPFA 5FLMC 3GTMC 3HOYK 2JA8C 4KN4A 3HOXK 3GEEA 3HOZK 1AB4A 4LK1A 5E68A 3S1MC 3LPXA 1O27A 3SZZA 4BY7C 2WB1L 4A93K 2R7ZK 1O24A 3MMLB 1I50A 3VA7A 3S2DK 1TWCC 3T02A 5TMFA 2VUMK 4P5BA 3HXAA 4AH6A 2WAQD 3I4MK 3GEIA 4A3EC 1YNNA 5M5XK 4BBRK 3TFJA 1ZVUA 1F7UA 5IOQA 4FM9A 4G7HA 1K83K 2YU9C 3GTGC 5JVOA 4BBSC 2VUMA 3EQLA 2ZUFA 4OIOA 1EI6A 4PABA 3GTLK 4A3GC 4FZBA 4A3DC 2B63K 5L46A 2V6UA 4Y7NC 3QX3A 3FKIC 2NVQK 1Y1WC 3H3VD 1BJTA 2PMZD 2B63A 1TWGC 3SZYA 2FQTA 4G7ZA 1F7VA 3G4CA 3M3YK 3S15C 4A3FK 4C2MC 5M3MK 4MEXA 2JA5K 1XPPA 3S16K 4YFXA 1IE0A 1XXAA 2V6TA 2JA5A 3S2HC 3S1NC 4A3LC 4X6AC 5TMCA 4BY7K 4C3JC 3FOEA 2D6FC 4C3IK 3M4OC 1TWHK 3L4JA 4LQYA 4BLAA 4A3BC 2A6HA 5IYBC 3HOYC 3GTKA 1F93A 1TWAK 3HOXC 3HOZC 5IP7C 4PAAA 4YG2A 4Y52K 1DCOA 5IP9K 3GTPK 1TWHA 4A93C 2R7ZC 3AQPA 2EBBA
chains in the Genus database with same CATH topology
1TWGA 2NVYA 3G4AA 1TWAA 4G0WA 3GTJA 2NVXA 4BKWA 3V4GA 1O29A 1XXBA 4KARA 3N0BA 3GTPA 1EK8A 5JFEA 3H0GA 4DDQA 2GSOA 5EGEA 3AQOA 4KMDA 4KMAA 2CFAA 1SFOA 2GSNA 2R7ZA 3S0XA 4KDDA 4M1XA 1O2AA 1BGWA 4C3HC 3LAJA 3GTOA 3OPFA 4KM8A 3LAPA 4GTFA 4P5AA 1B4BA 1AB4A 1O2BA 3LPXA 4GTDA 5IORA 1O27A 1K83A 4GFQA 4KAWX 1O24A 2JA6A 3MMLB 3N0CA 1I50A 3VA7A 3GTLA 2P5MA 3ERED 1EH1A 4KMHA 2XCRB 4G0UA 4P5BA 2ZFZA 3BUEA 1I3QA 2E2HA 1WQHA 3NUHA 1DD5A 1ZVUA 5IOQA 5IOSA 1O26A 4FM9A 2VUMA 5JVOA 1IS1A 4BLBA 5IOTA 4KASA 4FZBA 4KATA 5TJ3A 2R93A 3FHZA 1O28A 1R9TA 1GE9A 3QX3A 3FOFA 2XCOA 2GSUA 1BJTA 4C3IC 3OREA 2Y3PA 1O25A 3AH5A 4KB4A 3GTMA 4GT9A 1F9NA 2CFAB 2B63A 4KB2A 3CAGA 1WCMA 3N3YA 4GTLA 3G4CA 4G0VA 4C2MC 1WQGA 4J3NA 5EGHA 3GTQA 1Y1VA 1TWCA 3CQZA 4KC6A 1XXAA 2RH6A 4GTAA 1WQFA 1ISEA 4GTEA 3L4KA 2JA5A 1TWFA 2PHCB 3OEPA 1KQ4A 1B4AA 2YU9A 3GTGA 2JA7A 2E2IA 4GTCA 4C3JC 3FOEA 2XCQA 4KM9A 5CJ9A 4LR2A 3L4JA 4LQYA 2KWAA 4BLAA 2R92A 4ILDA 1ZXOA 4GTBA 3GTKA 1WIHA 2JH3A 2RGRA 3FKIA 1Y1WA 1ZBSA 5CHPA 1TWHA 1XXCA 3AQPA 3Q3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O28 A;  4GTD A;  5IOR A;  1O27 A;  3G4A A;  4GTA A;  4GTE A;  1O24 A;  1O29 A;  3N0C A;  4KAR A;  1KQ4 A;  3N0B A;  5JFE A;  1O25 A;  3AH5 A;  4P5B A;  4GTC A;  4GT9 A;  2CFA B;  2CFA A;  3N3Y A;  4GTL A;  3G4C A;  1O2A A;  4GTB A;  5IOQ A;  5IOS A;  1O26 A;  5IOT A;  4GTF A;  4P5A A;  5CHP A;  4KAS A;  4FZB A;  4KAT A;  1O2B A; 
#chains in the Genus database with same CATH topology
 2NVY A;  3A8K A;  3S2D C;  1TWA A;  2A68 A;  2VUM C;  4BKW A;  1C0A A;  4KMU A;  1IL2 A;  4KAR A;  3HOU K;  3I4M C;  3N0B A;  3GTP A;  1EK8 A;  4Y7N K;  1ZQ1 C;  4BBR C;  1IW7 A;  5EGE A;  1SMY A;  1K83 C;  3S0X A;  1O2A A;  5HL8 A;  2PA8 L;  3S1R K;  2B63 C;  3LAP A;  4P5A A;  1B4B A;  1VH2 A;  4Q5S A;  1O2B A;  3H0G K;  4P9S A;  1BS2 A;  2NVQ C;  5IOR A;  1G51 A;  5IYD K;  1IQ0 A;  4GFQ A;  3AD9 C;  2E2H K;  2JA6 A;  3IPJ A;  3N0C A;  4QIW D;  1EH1 A;  2PA8 D;  2XCR B;  3AD8 C;  4LLG A;  3M3Y C;  1WOO A;  4X6A K;  3HOW C;  4YFK A;  4JK1 A;  3JST A;  4A3F C;  2E2H A;  1WQH A;  2JA5 C;  1WSV A;  4YFN A;  1R9T K;  3S16 C;  3HOV C;  2V6S A;  4A3B K;  5IYB K;  1L0W A;  1I50 K;  2WAQ L;  5IP7 K;  1O28 A;  1R9T A;  1GE9 A;  2XCO A;  5C4J K;  1ZYR A;  3I4N K;  4C3I C;  1TWH C;  3ORE A;  2Y3P A;  3AH5 A;  1F9N A;  1VRQ C;  1Y1V K;  2NVY C;  1TWA C;  4KB2 A;  4LJZ A;  2A69 A;  3N3Y A;  1HI9 A;  2FQO A;  3T00 A;  4Y52 C;  3H3V L;  5IP9 C;  3GTP C;  2PMZ L;  4J3N A;  5EGH A;  1Y1V A;  1XZP B;  2PPB A;  4KC6 A;  1J6V A;  2O5J A;  3HOU C;  4GTE A;  1TWF A;  1VLO A;  3OEP A;  4A3C K;  1B4A A;  4GTC A;  3BP3 A;  2XCQ A;  4KM9 A;  5IYC K;  2KWA A;  3S1R C;  2JA6 C;  4ILD A;  1WIH A;  3TFI A;  1X31 C;  1J98 A;  3HOW K;  3H0G C;  4BY1 K;  1DCH A;  5IYD C;  3AD7 C;  5CHP A;  4G7O A;  2E2H C;  3HOV K;  4ZH4 A;  1SFO K;  4G0W A;  1O2F B;  3BP8 C;  3GTK K;  3TTG A;  4OIR A;  3AQO A;  4KMD A;  4KMA A;  1R9T C;  1SFO A;  5D4D A;  3S1Q K;  4C3H C;  2NVT K;  5M3F K;  1I50 C;  3GTO A;  2NVY K;  1VJE A;  3HKZ D;  3RZO K;  1XZP A;  1PJ7 A;  4MQ9 A;  5C3E K;  4XCH A;  1PJ6 A;  5C4J C;  1I3Q K;  3I4N C;  4KAW X;  2Y0S D;  1WOR A;  4OIP A;  1J6X A;  1Y1V C;  2P5M A;  3ERE D;  4KMH A;  2A6E A;  3S17 C;  4G0U A;  1I6H C;  3BUE A;  4O2D A;  1HQM A;  3DXJ A;  1I3Q A;  2CW0 A;  2R93 K;  3NUH A;  1DD5 A;  1RU0 A;  3A8J A;  1TWF C;  4NOI A;  4GZY A;  4XSX A;  4QIW L;  1O26 A;  2JA6 K;  2ZUE A;  3GEH A;  1WSR A;  2BE5 A;  4KAS A;  4KAT A;  5TJ3 A;  2R93 A;  5C44 C;  4A3I K;  4A3C C;  1YX2 A;  1WCM K;  4MEY A;  5C4X K;  4C45 A;  3FOF A;  5IYC C;  1O25 A;  4KB4 A;  3PO3 K;  2CFA B;  3GTQ K;  5M5W K;  3CQZ K;  3CAG A;  1WCM A;  5FJ8 K;  4BY1 C;  3GTQ A;  4C3H K;  1SFO C;  3CQZ A;  4OIN A;  3RZD K;  2JA7 K;  2E2I K;  2RH6 A;  4GTA A;  1WQF A;  3GTK C;  2R92 K;  1V5V A;  1UV7 A;  1KQ4 A;  2JA7 A;  2E2I A;  4A3K C;  3S1Q C;  2NVT C;  4LR2 A;  3S17 K;  2NVX K;  2R92 A;  1ZXO A;  1I6H K;  3GTJ K;  3RZO C;  1EFW A;  5C3E C;  1TWF K;  1I3Q C;  1XXC A;  2NVX A;  1I6V A;  3G4A A;  3GTJ A;  1XXB A;  5C44 K;  4WJ4 A;  2GSO A;  2R93 C;  3GDZ A;  1XZQ B;  2CFA A;  3PO2 C;  2GSN A;  3S14 K;  2R7Z A;  4KDD A;  4M1X A;  4BXX K;  2WB1 D;  3LAJ A;  4A3I C;  3GIR A;  4GTF A;  1WCM C;  5C4X C;  4GTD A;  1K83 A;  1YCL A;  3PO3 C;  3GTQ C;  3GTL A;  4A3M K;  4KN7 A;  3CQZ C;  3GTO K;  3HKZ L;  2ZFZ A;  1JOE A;  4WIL A;  1USO A;  4RMF A;  2Y0S L;  4A3K K;  5IOS A;  1YNJ A;  3RZD C;  2JA7 C;  2E2I C;  4A3J K;  2E2J K;  1IS1 A;  4BLB A;  3K7A K;  5IOT A;  5M5Y K;  5FLM K;  4OIQ A;  3GTM K;  2R92 C;  3FHZ A;  2JA8 K;  2W7V A;  3S1M K;  4LOW A;  4QJV B;  2GSU A;  3T01 A;  3GTM A;  4XLP A;  4GT9 A;  2NVX C;  1WOP A;  1JVI A;  1DCP A;  1TWC K;  3GTJ C;  1XZQ A;  4GTL A;  4G0V A;  3PO2 K;  4A3E K;  1WQG A;  2O5I A;  1TWC A;  2YU9 K;  3GTG K;  4BBS K;  3ADA C;  3A8I A;  3GSI A;  4AYB L;  1USM A;  4A3G K;  1J6W A;  1ISE A;  4A3D K;  3L4K A;  2PHC B;  4LK0 A;  3S14 C;  4WJ3 M;  2YU9 A;  3FKI K;  3GTG A;  1Y1W K;  4BXX C;  1BDF A;  1VGX A;  5CJ9 A;  1INN A;  4GTB A;  2GAH C;  4AYB D;  1TWG K;  3GTL C;  4XSZ A;  1EQR A;  2JH3 A;  3FKI A;  2RGR A;  3S15 K;  1Y1W A;  2GAG C;  1ZBS A;  3WOD A;  4C2M K;  4KM8 A;  3Q3Q A;  1TWG A;  4A3M C;  4Q4Z A;  3GTO C;  3V4G A;  1O29 A;  1WOS A;  1JQW A;  4QJV A;  5JFE A;  3H0G A;  1IBA A;  4DDQ A;  3S2H K;  3S1N K;  4A3L K;  4XLN A;  4C3J K;  2P8T A;  1BGW A;  4A3J C;  2E2J C;  3TFH A;  3K7A C;  3M4O K;  1PJ5 A;  3OPF A;  5FLM C;  3GTM C;  3HOY K;  2JA8 C;  4KN4 A;  3HOX K;  3GEE A;  3HOZ K;  1AB4 A;  4LK1 A;  5E68 A;  3S1M C;  3LPX A;  1O27 A;  3SZZ A;  4BY7 C;  2WB1 L;  4A93 K;  2R7Z K;  1O24 A;  3MML B;  1I50 A;  3VA7 A;  3S2D K;  1TWC C;  3T02 A;  5TMF A;  2VUM K;  4P5B A;  3HXA A;  4AH6 A;  2WAQ D;  3I4M K;  3GEI A;  4A3E C;  1YNN A;  5M5X K;  4BBR K;  3TFJ A;  1ZVU A;  1F7U A;  5IOQ A;  4FM9 A;  4G7H A;  1K83 K;  2YU9 C;  3GTG C;  5JVO A;  4BBS C;  2VUM A;  3EQL A;  2ZUF A;  4OIO A;  1EI6 A;  4PAB A;  3GTL K;  4A3G C;  4FZB A;  4A3D C;  2B63 K;  5L46 A;  2V6U A;  4Y7N C;  3QX3 A;  3FKI C;  2NVQ K;  1Y1W C;  3H3V D;  1BJT A;  2PMZ D;  2B63 A;  1TWG C;  3SZY A;  2FQT A;  4G7Z A;  1F7V A;  3G4C A;  3M3Y K;  3S15 C;  4A3F K;  4C2M C;  5M3M K;  4MEX A;  2JA5 K;  1XPP A;  3S16 K;  4YFX A;  1IE0 A;  1XXA A;  2V6T A;  2JA5 A;  3S2H C;  3S1N C;  4A3L C;  4X6A C;  5TMC A;  4BY7 K;  4C3J C;  3FOE A;  2D6F C;  4C3I K;  3M4O C;  1TWH K;  3L4J A;  4LQY A;  4BLA A;  4A3B C;  2A6H A;  5IYB C;  3HOY C;  3GTK A;  1F93 A;  1TWA K;  3HOX C;  3HOZ C;  5IP7 C;  4PAA A;  4YG2 A;  4Y52 K;  1DCO A;  5IP9 K;  3GTP K;  1TWH A;  4A93 C;  2R7Z C;  3AQP A;  2EBB A; 
#chains in the Genus database with same CATH homology
 1TWG A;  2NVY A;  3G4A A;  1TWA A;  4G0W A;  3GTJ A;  2NVX A;  4BKW A;  3V4G A;  1O29 A;  1XXB A;  4KAR A;  3N0B A;  3GTP A;  1EK8 A;  5JFE A;  3H0G A;  4DDQ A;  2GSO A;  5EGE A;  3AQO A;  4KMD A;  4KMA A;  2CFA A;  1SFO A;  2GSN A;  2R7Z A;  3S0X A;  4KDD A;  4M1X A;  1O2A A;  1BGW A;  4C3H C;  3LAJ A;  3GTO A;  3OPF A;  4KM8 A;  3LAP A;  4GTF A;  4P5A A;  1B4B A;  1AB4 A;  1O2B A;  3LPX A;  4GTD A;  5IOR A;  1O27 A;  1K83 A;  4GFQ A;  4KAW X;  1O24 A;  2JA6 A;  3MML B;  3N0C A;  1I50 A;  3VA7 A;  3GTL A;  2P5M A;  3ERE D;  1EH1 A;  4KMH A;  2XCR B;  4G0U A;  4P5B A;  2ZFZ A;  3BUE A;  1I3Q A;  2E2H A;  1WQH A;  3NUH A;  1DD5 A;  1ZVU A;  5IOQ A;  5IOS A;  1O26 A;  4FM9 A;  2VUM A;  5JVO A;  1IS1 A;  4BLB A;  5IOT A;  4KAS A;  4FZB A;  4KAT A;  5TJ3 A;  2R93 A;  3FHZ A;  1O28 A;  1R9T A;  1GE9 A;  3QX3 A;  3FOF A;  2XCO A;  2GSU A;  1BJT A;  4C3I C;  3ORE A;  2Y3P A;  1O25 A;  3AH5 A;  4KB4 A;  3GTM A;  4GT9 A;  1F9N A;  2CFA B;  2B63 A;  4KB2 A;  3CAG A;  1WCM A;  3N3Y A;  4GTL A;  3G4C A;  4G0V A;  4C2M C;  1WQG A;  4J3N A;  5EGH A;  3GTQ A;  1Y1V A;  1TWC A;  3CQZ A;  4KC6 A;  1XXA A;  2RH6 A;  4GTA A;  1WQF A;  1ISE A;  4GTE A;  3L4K A;  2JA5 A;  1TWF A;  2PHC B;  3OEP A;  1KQ4 A;  1B4A A;  2YU9 A;  3GTG A;  2JA7 A;  2E2I A;  4GTC A;  4C3J C;  3FOE A;  2XCQ A;  4KM9 A;  5CJ9 A;  4LR2 A;  3L4J A;  4LQY A;  2KWA A;  4BLA A;  2R92 A;  4ILD A;  1ZXO A;  4GTB A;  3GTK A;  1WIH A;  2JH3 A;  2RGR A;  3FKI A;  1Y1W A;  1ZBS A;  5CHP A;  1TWH A;  1XXC A;  3AQP A;  3Q3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...