3G4CA

Flavine dependant thymidylate syntahse s88c mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
209
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELCGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unusual mechanism of thymidylate biosynthesis in organisms containing the thyX gene.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 77
structure length 209
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3g4cA00
5IORA 4GTCA 3N3YA 5IOTA 3N0CA 4P5BA 1O29A 3N0BA 1O2BA 4GTAA 5IOQA 4GTEA 4GT9A 5JFEA 1O25A 4KASA 4GTBA 3G4CA 5IOSA 1O27A 2CFAB 4GTLA 4GTFA 1O26A 4KATA 4P5AA 3G4AA 1O28A 2CFAA 1KQ4A 4GTDA 1O2AA 3AH5A 1O24A 5CHPA 4FZBA 4KARA
chains in the Genus database with same CATH superfamily
5IYDC 2NVQK 2E2IC 3HOWK 1TWAA 3HOUK 4X6AK 1YNNA 4LK1A 4C3IC 4XLPA 4A3CK 2R7ZC 5EGEA 1I50K 3S1QC 3I4MK 2JH3A 3TTGA 2R93A 3GTKK 3HOZK 2NVQC 4GFQA 3CQZC 4A3IC 4OINA 5M5YK 3I4MC 3SZYA 3GTMC 4BBRK 5IORA 1VGXA 5IOTA 3S1MK 5E68A 3CQZK 4C3HC 1XZPB 1XZQA 1TWGC 2E2HC 3H3VD 2ZUFA 1XZQB 3GTKC 5M3MK 3RZDC 1R9TK 3FKIC 2JA5C 3FOFA 1SFOA 2YU9A 4KATA 1ZXOA 3OEPA 4G7HA 2R93C 2VUMA 5IYDK 4LLGA 3FOEA 2NVYC 1Y1WA 3FKIK 4C3JC 4YFNA 1L0WA 1O2BA 5JFEA 2V6SA 2WAQL 4YFKA 3AQOA 5TMFA 5C44K 4JK1A 1TWFC 1EK8A 3GTJK 2CFAB 1Y1VC 2O5IA 4A3BK 2NVTK 1YCLA 1BDFA 2CW0A 3LPXA 1WIHA 3GTLC 1EI6A 3FHZA 1ZBSA 3MMLB 3S16K 2JA7C 3HOWC 3HKZL 1I3QC 1TWAK 4A93C 1IBAA 1IS1A 4P5BA 1EH1A 4BY1K 4ILDA 4KN4A 1B4BA 3A8KA 3EQLA 3V4GA 1SMYA 1I6HK 1I50C 3S1QK 4J3NA 3GTGA 5FJ8K 4A3JK 3S1RK 3GTOA 2NVYK 1HI9A 1YNJA 5C3EK 1HQMA 2Y0SD 1I3QK 1TWAC 4AYBD 1K83A 3HOYC 1TWGA 3GTQA 1O28A 2CFAA 1X31C 5FLMC 1DD5A 3T01A 3GTMK 1WOPA 3S1RC 2PA8L 2GAGC 2R92K 2JA5A 1IL2A 4A3IK 3ERED 1DCOA 1IW7A 4GT9A 4BXXK 2E2HK 1IE0A 2GSNA 4WJ4A 1VRQC 1VJEA 4G7OA 4DDQA 1R9TA 1ZQ1C 3L4JA 5C3EC 3JSTA 4KMDA 4KDDA 1WQFA 4KM9A 2NVTC 4MQ9A 4KB4A 4C2MC 2R93K 5CHPA 4KC6A 3GTKA 3S14C 3GTPK 5IYBK 4LJZA 3HOVC 2Y0SL 4AYBL 1O29A 1XXCA 2P8TA 3BUEA 1O25A 1UV7A 3GIRA 2E2IK 1WQHA 2ZFZA 3M3YC 5IYBC 4OIRA 4GTFA 4GZYA 4XLNA 2PPBA 1J6XA 4P5AA 3HOXK 4P9SA 3PO2K 2JA8C 4A3DK 4NOIA 4KARA 5IP9K 3H0GC 3GTOC 1EQRA 3TFJA 3N3YA 2A6HA 1C0AA 4XSZA 3HKZD 2V6UA 4BY7C 2GSUA 1WQGA 3GTGK 2B63A 3S17C 1WOSA 5C4XK 4BBRC 4LQYA 1WORA 4WJ3M 1F93A 2JA6A 5CJ9A 4A3LK 4KMAA 4ZH4A 3M4OC 1TWCA 4A3JC 3H0GK 3PO3K 3RZDK 1AB4A 2PMZD 4LR2A 4OIOA 1ZVUA 1O2FB 4OIQA 2A6EA 3HOXC 3GTQC 2O5JA 4KM8A 4KASA 2EBBA 3HXAA 1BS2A 2WAQD 3SZZA 5JVOA 1O26A 4G0WA 1F7UA 2NVXA 3S15C 3LAJA 3G4AA 2JA8K 3GEHA 2ZUEA 1JVIA 3OPFA 1WCMA 4G0VA 3PO2C 5C4XC 2XCRB 4GTCA 1Y1VK 3I4NK 3CQZA 5IYCK 1B4AA 3S2HC 4C3IK 3DXJA 1J6VA 5C4JC 3H3VL 1XZPA 2E2IA 1ISEA 3GTPC 3S2DK 4QIWL 4A93K 1WOOA 2XCQA 2B63C 5L46A 2VUMK 5IOSA 4A3DC 3Q3QA 5C4JK 3A8JA 4YG2A 1Y1WK 4KN7A 1V5VA 5EGHA 3BP3A 1PJ7A 1F7VA 3GDZA 4KAWX 4M1XA 2NVXC 1USMA 3BP8C 3GTJC 1J98A 2KWAA 2YU9C 1VLOA 4Q5SA 3GTMA 4A3EC 3CAGA 4PAAA 2RGRA 2JA5K 3S16C 1WSRA 3RZOK 4A3KK 2E2HA 3GTGC 5D4DA 1GE9A 1TWHK 1O24A 2JA7K 2R7ZA 1K83C 3NUHA 2PHCB 5IP7K 3QX3A 1TWFA 3RZOC 1SFOC 3N0CA 5M5WK 1WSVA 1TWCC 4A3FK 2FQOA 3S2HK 2NVYA 3S14K 4KB2A 1EFWA 5M3FK 4WILA 5C44C 1K83K 3TFHA 3LAPA 2NVXK 1ZYRA 3HOYK 4KMUA 2R92C 1DCPA 3S15K 3GTLK 1SFOK 4GTDA 2W7VA 1O2AA 2D6FC 4BKWA 2Y3PA 3S17K 1Y1VA 4XSXA 4G7ZA 2A68A 3K7AK 3S1NK 2PA8D 4A3LC 2GSOA 1RU0A 1PJ6A 1BJTA 4A3MC 4BLBA 1JOEA 1JQWA 2A69A 3IPJA 3K7AC 3GTJA 1J6WA 3VA7A 5HL8A 3S1MC 2B63K 1TWHC 3GEEA 1I50A 3GTPA 3HOZC 5M5XK 3AD9C 2JA6K 1R9TC 2P5MA 3HOVK 4A3GC 3S1NC 2V6TA 4QJVA 4GTAA 3N0BA 4GTEA 2YU9K 4XCHA 3H0GA 1XXAA 4MEXA 5TMCA 3GSIA 4GTBA 3S2DC 1O27A 3OREA 4GTLA 3GTOK 4A3KC 3ADAC 5IYCC 1I3QA 1KQ4A 3HOUC 2GAHC 5FLMK 3AQPA 3AH5A 1USOA 4G0UA 1IQ0A 1TWFK 4PABA 4Y7NK 1BGWA 1G51A 5TJ3A 4A3GK 2XCOA 2R92A 1WCMK 4QIWD 5IOQA 3GEIA 3AD7C 2RH6A 4C45A 1DCHA 3AD8C 5IP7C 4BBSC 3G4CA 3M3YK 3PO3C 3I4NC 3TFIA 4Q4ZA 2E2JC 1TWCK 4O2DA 4A3FC 1PJ5A 4FZBA 2WB1L 4OIPA 4FM9A 4BLAA 3S0XA 1I6HC 3T00A 4Y7NC 4RMFA 4X6AC 1TWHA 4C3HK 4LOWA 4C2MK 3A8IA 3GTQK 1XXBA 1VH2A 2R7ZK 1Y1WC 3L4KA 4LK0A 1YX2A 4YFXA 4Y52K 4A3BC 4BY1C 2BE5A 3T02A 2PMZL 4A3EK 3M4OK 4BXXC 4MEYA 2WB1D 1INNA 3WODA 4A3MK 5IP9C 2JA6C 4QJVB 4AH6A 4C3JK 3GTLA 2E2JK 1XPPA 3FKIA 1TWGK 1WCMC 4BY7K 2JA7A 2VUMC 4BBSK 4KMHA 1I6VA 1F9NA 4Y52C 2FQTA 4A3CC
chains in the Genus database with same CATH topology
1I50A 3GTPA 2XCRB 4GTCA 2P5MA 3CQZA 2JA5A 1TWAA 1B4AA 3N0BA 4GTAA 4C3IC 3ERED 4GTEA 4GT9A 3H0GA 1XXAA 5EGEA 2GSNA 2JH3A 2E2IA 1ISEA 4GTBA 2R93A 4DDQA 1R9TA 3L4JA 4KMDA 1O27A 4GFQA 3OREA 4GTLA 4KDDA 1WQFA 2XCQA 4KM9A 1I3QA 1KQ4A 4KB4A 3AQPA 4C2MC 3AH5A 5CHPA 4KC6A 5IOSA 3GTKA 3Q3QA 4G0UA 5EGHA 5IORA 4KAWX 4M1XA 1BGWA 5TJ3A 5IOTA 2XCOA 2R92A 1O29A 2KWAA 5IOQA 1XXCA 4C3HC 3GTMA 3BUEA 1O25A 3CAGA 2RH6A 2RGRA 3G4CA 1WQHA 2ZFZA 4GTFA 3FOFA 1SFOA 2YU9A 4KATA 4P5AA 2E2HA 1GE9A 1ZXOA 1O24A 4FZBA 3OEPA 4KARA 2VUMA 4FM9A 4BLAA 3S0XA 2R7ZA 3NUHA 3FOEA 2PHCB 1Y1WA 3QX3A 1TWFA 3N3YA 4C3JC 3N0CA 1O2BA 1TWHA 2GSUA 5JFEA 1WQGA 3AQOA 2B63A 1XXBA 2NVYA 4KB2A 3L4KA 4LQYA 1EK8A 3LAPA 2CFAB 2JA6A 5CJ9A 4KMAA 3LPXA 4GTDA 1WIHA 1O2AA 4BKWA 3FHZA 2Y3PA 1TWCA 1ZBSA 3MMLB 1Y1VA 1AB4A 4LR2A 1ZVUA 1IS1A 3GTLA 4P5BA 1EH1A 3FKIA 4ILDA 1B4BA 3V4GA 2GSOA 2JA7A 4KM8A 4KASA 4J3NA 3GTGA 1BJTA 4BLBA 4KMHA 3GTOA 5JVOA 1F9NA 1K83A 1O26A 4G0WA 3GTQA 1TWGA 2NVXA 3LAJA 3GTJA 3G4AA 1O28A 2CFAA 3VA7A 3OPFA 1DD5A 1WCMA 4G0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOR A;  4GTC A;  3N3Y A;  5IOT A;  3N0C A;  4P5B A;  1O29 A;  3N0B A;  1O2B A;  4GTA A;  5IOQ A;  4GTE A;  4GT9 A;  5JFE A;  1O25 A;  4KAS A;  4GTB A;  3G4C A;  5IOS A;  1O27 A;  2CFA B;  4GTL A;  4GTF A;  1O26 A;  4KAT A;  4P5A A;  3G4A A;  1O28 A;  2CFA A;  1KQ4 A;  4GTD A;  1O2A A;  3AH5 A;  1O24 A;  5CHP A;  4FZB A;  4KAR A; 
#chains in the Genus database with same CATH topology
 5IYD C;  2NVQ K;  2E2I C;  3HOW K;  1TWA A;  3HOU K;  4X6A K;  1YNN A;  4LK1 A;  4C3I C;  4XLP A;  4A3C K;  2R7Z C;  5EGE A;  1I50 K;  3S1Q C;  3I4M K;  2JH3 A;  3TTG A;  2R93 A;  3GTK K;  3HOZ K;  2NVQ C;  4GFQ A;  3CQZ C;  4A3I C;  4OIN A;  5M5Y K;  3I4M C;  3SZY A;  3GTM C;  4BBR K;  5IOR A;  1VGX A;  5IOT A;  3S1M K;  5E68 A;  3CQZ K;  4C3H C;  1XZP B;  1XZQ A;  1TWG C;  2E2H C;  3H3V D;  2ZUF A;  1XZQ B;  3GTK C;  5M3M K;  3RZD C;  1R9T K;  3FKI C;  2JA5 C;  3FOF A;  1SFO A;  2YU9 A;  4KAT A;  1ZXO A;  3OEP A;  4G7H A;  2R93 C;  2VUM A;  5IYD K;  4LLG A;  3FOE A;  2NVY C;  1Y1W A;  3FKI K;  4C3J C;  4YFN A;  1L0W A;  1O2B A;  5JFE A;  2V6S A;  2WAQ L;  4YFK A;  3AQO A;  5TMF A;  5C44 K;  4JK1 A;  1TWF C;  1EK8 A;  3GTJ K;  2CFA B;  1Y1V C;  2O5I A;  4A3B K;  2NVT K;  1YCL A;  1BDF A;  2CW0 A;  3LPX A;  1WIH A;  3GTL C;  1EI6 A;  3FHZ A;  1ZBS A;  3MML B;  3S16 K;  2JA7 C;  3HOW C;  3HKZ L;  1I3Q C;  1TWA K;  4A93 C;  1IBA A;  1IS1 A;  4P5B A;  1EH1 A;  4BY1 K;  4ILD A;  4KN4 A;  1B4B A;  3A8K A;  3EQL A;  3V4G A;  1SMY A;  1I6H K;  1I50 C;  3S1Q K;  4J3N A;  3GTG A;  5FJ8 K;  4A3J K;  3S1R K;  3GTO A;  2NVY K;  1HI9 A;  1YNJ A;  5C3E K;  1HQM A;  2Y0S D;  1I3Q K;  1TWA C;  4AYB D;  1K83 A;  3HOY C;  1TWG A;  3GTQ A;  1O28 A;  2CFA A;  1X31 C;  5FLM C;  1DD5 A;  3T01 A;  3GTM K;  1WOP A;  3S1R C;  2PA8 L;  2GAG C;  2R92 K;  2JA5 A;  1IL2 A;  4A3I K;  3ERE D;  1DCO A;  1IW7 A;  4GT9 A;  4BXX K;  2E2H K;  1IE0 A;  2GSN A;  4WJ4 A;  1VRQ C;  1VJE A;  4G7O A;  4DDQ A;  1R9T A;  1ZQ1 C;  3L4J A;  5C3E C;  3JST A;  4KMD A;  4KDD A;  1WQF A;  4KM9 A;  2NVT C;  4MQ9 A;  4KB4 A;  4C2M C;  2R93 K;  5CHP A;  4KC6 A;  3GTK A;  3S14 C;  3GTP K;  5IYB K;  4LJZ A;  3HOV C;  2Y0S L;  4AYB L;  1O29 A;  1XXC A;  2P8T A;  3BUE A;  1O25 A;  1UV7 A;  3GIR A;  2E2I K;  1WQH A;  2ZFZ A;  3M3Y C;  5IYB C;  4OIR A;  4GTF A;  4GZY A;  4XLN A;  2PPB A;  1J6X A;  4P5A A;  3HOX K;  4P9S A;  3PO2 K;  2JA8 C;  4A3D K;  4NOI A;  4KAR A;  5IP9 K;  3H0G C;  3GTO C;  1EQR A;  3TFJ A;  3N3Y A;  2A6H A;  1C0A A;  4XSZ A;  3HKZ D;  2V6U A;  4BY7 C;  2GSU A;  1WQG A;  3GTG K;  2B63 A;  3S17 C;  1WOS A;  5C4X K;  4BBR C;  4LQY A;  1WOR A;  4WJ3 M;  1F93 A;  2JA6 A;  5CJ9 A;  4A3L K;  4KMA A;  4ZH4 A;  3M4O C;  1TWC A;  4A3J C;  3H0G K;  3PO3 K;  3RZD K;  1AB4 A;  2PMZ D;  4LR2 A;  4OIO A;  1ZVU A;  1O2F B;  4OIQ A;  2A6E A;  3HOX C;  3GTQ C;  2O5J A;  4KM8 A;  4KAS A;  2EBB A;  3HXA A;  1BS2 A;  2WAQ D;  3SZZ A;  5JVO A;  1O26 A;  4G0W A;  1F7U A;  2NVX A;  3S15 C;  3LAJ A;  3G4A A;  2JA8 K;  3GEH A;  2ZUE A;  1JVI A;  3OPF A;  1WCM A;  4G0V A;  3PO2 C;  5C4X C;  2XCR B;  4GTC A;  1Y1V K;  3I4N K;  3CQZ A;  5IYC K;  1B4A A;  3S2H C;  4C3I K;  3DXJ A;  1J6V A;  5C4J C;  3H3V L;  1XZP A;  2E2I A;  1ISE A;  3GTP C;  3S2D K;  4QIW L;  4A93 K;  1WOO A;  2XCQ A;  2B63 C;  5L46 A;  2VUM K;  5IOS A;  4A3D C;  3Q3Q A;  5C4J K;  3A8J A;  4YG2 A;  1Y1W K;  4KN7 A;  1V5V A;  5EGH A;  3BP3 A;  1PJ7 A;  1F7V A;  3GDZ A;  4KAW X;  4M1X A;  2NVX C;  1USM A;  3BP8 C;  3GTJ C;  1J98 A;  2KWA A;  2YU9 C;  1VLO A;  4Q5S A;  3GTM A;  4A3E C;  3CAG A;  4PAA A;  2RGR A;  2JA5 K;  3S16 C;  1WSR A;  3RZO K;  4A3K K;  2E2H A;  3GTG C;  5D4D A;  1GE9 A;  1TWH K;  1O24 A;  2JA7 K;  2R7Z A;  1K83 C;  3NUH A;  2PHC B;  5IP7 K;  3QX3 A;  1TWF A;  3RZO C;  1SFO C;  3N0C A;  5M5W K;  1WSV A;  1TWC C;  4A3F K;  2FQO A;  3S2H K;  2NVY A;  3S14 K;  4KB2 A;  1EFW A;  5M3F K;  4WIL A;  5C44 C;  1K83 K;  3TFH A;  3LAP A;  2NVX K;  1ZYR A;  3HOY K;  4KMU A;  2R92 C;  1DCP A;  3S15 K;  3GTL K;  1SFO K;  4GTD A;  2W7V A;  1O2A A;  2D6F C;  4BKW A;  2Y3P A;  3S17 K;  1Y1V A;  4XSX A;  4G7Z A;  2A68 A;  3K7A K;  3S1N K;  2PA8 D;  4A3L C;  2GSO A;  1RU0 A;  1PJ6 A;  1BJT A;  4A3M C;  4BLB A;  1JOE A;  1JQW A;  2A69 A;  3IPJ A;  3K7A C;  3GTJ A;  1J6W A;  3VA7 A;  5HL8 A;  3S1M C;  2B63 K;  1TWH C;  3GEE A;  1I50 A;  3GTP A;  3HOZ C;  5M5X K;  3AD9 C;  2JA6 K;  1R9T C;  2P5M A;  3HOV K;  4A3G C;  3S1N C;  2V6T A;  4QJV A;  4GTA A;  3N0B A;  4GTE A;  2YU9 K;  4XCH A;  3H0G A;  1XXA A;  4MEX A;  5TMC A;  3GSI A;  4GTB A;  3S2D C;  1O27 A;  3ORE A;  4GTL A;  3GTO K;  4A3K C;  3ADA C;  5IYC C;  1I3Q A;  1KQ4 A;  3HOU C;  2GAH C;  5FLM K;  3AQP A;  3AH5 A;  1USO A;  4G0U A;  1IQ0 A;  1TWF K;  4PAB A;  4Y7N K;  1BGW A;  1G51 A;  5TJ3 A;  4A3G K;  2XCO A;  2R92 A;  1WCM K;  4QIW D;  5IOQ A;  3GEI A;  3AD7 C;  2RH6 A;  4C45 A;  1DCH A;  3AD8 C;  5IP7 C;  4BBS C;  3G4C A;  3M3Y K;  3PO3 C;  3I4N C;  3TFI A;  4Q4Z A;  2E2J C;  1TWC K;  4O2D A;  4A3F C;  1PJ5 A;  4FZB A;  2WB1 L;  4OIP A;  4FM9 A;  4BLA A;  3S0X A;  1I6H C;  3T00 A;  4Y7N C;  4RMF A;  4X6A C;  1TWH A;  4C3H K;  4LOW A;  4C2M K;  3A8I A;  3GTQ K;  1XXB A;  1VH2 A;  2R7Z K;  1Y1W C;  3L4K A;  4LK0 A;  1YX2 A;  4YFX A;  4Y52 K;  4A3B C;  4BY1 C;  2BE5 A;  3T02 A;  2PMZ L;  4A3E K;  3M4O K;  4BXX C;  4MEY A;  2WB1 D;  1INN A;  3WOD A;  4A3M K;  5IP9 C;  2JA6 C;  4QJV B;  4AH6 A;  4C3J K;  3GTL A;  2E2J K;  1XPP A;  3FKI A;  1TWG K;  1WCM C;  4BY7 K;  2JA7 A;  2VUM C;  4BBS K;  4KMH A;  1I6V A;  1F9N A;  4Y52 C;  2FQT A;  4A3C C; 
#chains in the Genus database with same CATH homology
 1I50 A;  3GTP A;  2XCR B;  4GTC A;  2P5M A;  3CQZ A;  2JA5 A;  1TWA A;  1B4A A;  3N0B A;  4GTA A;  4C3I C;  3ERE D;  4GTE A;  4GT9 A;  3H0G A;  1XXA A;  5EGE A;  2GSN A;  2JH3 A;  2E2I A;  1ISE A;  4GTB A;  2R93 A;  4DDQ A;  1R9T A;  3L4J A;  4KMD A;  1O27 A;  4GFQ A;  3ORE A;  4GTL A;  4KDD A;  1WQF A;  2XCQ A;  4KM9 A;  1I3Q A;  1KQ4 A;  4KB4 A;  3AQP A;  4C2M C;  3AH5 A;  5CHP A;  4KC6 A;  5IOS A;  3GTK A;  3Q3Q A;  4G0U A;  5EGH A;  5IOR A;  4KAW X;  4M1X A;  1BGW A;  5TJ3 A;  5IOT A;  2XCO A;  2R92 A;  1O29 A;  2KWA A;  5IOQ A;  1XXC A;  4C3H C;  3GTM A;  3BUE A;  1O25 A;  3CAG A;  2RH6 A;  2RGR A;  3G4C A;  1WQH A;  2ZFZ A;  4GTF A;  3FOF A;  1SFO A;  2YU9 A;  4KAT A;  4P5A A;  2E2H A;  1GE9 A;  1ZXO A;  1O24 A;  4FZB A;  3OEP A;  4KAR A;  2VUM A;  4FM9 A;  4BLA A;  3S0X A;  2R7Z A;  3NUH A;  3FOE A;  2PHC B;  1Y1W A;  3QX3 A;  1TWF A;  3N3Y A;  4C3J C;  3N0C A;  1O2B A;  1TWH A;  2GSU A;  5JFE A;  1WQG A;  3AQO A;  2B63 A;  1XXB A;  2NVY A;  4KB2 A;  3L4K A;  4LQY A;  1EK8 A;  3LAP A;  2CFA B;  2JA6 A;  5CJ9 A;  4KMA A;  3LPX A;  4GTD A;  1WIH A;  1O2A A;  4BKW A;  3FHZ A;  2Y3P A;  1TWC A;  1ZBS A;  3MML B;  1Y1V A;  1AB4 A;  4LR2 A;  1ZVU A;  1IS1 A;  3GTL A;  4P5B A;  1EH1 A;  3FKI A;  4ILD A;  1B4B A;  3V4G A;  2GSO A;  2JA7 A;  4KM8 A;  4KAS A;  4J3N A;  3GTG A;  1BJT A;  4BLB A;  4KMH A;  3GTO A;  5JVO A;  1F9N A;  1K83 A;  1O26 A;  4G0W A;  3GTQ A;  1TWG A;  2NVX A;  3LAJ A;  3GTJ A;  3G4A A;  1O28 A;  2CFA A;  3VA7 A;  3OPF A;  1DD5 A;  1WCM A;  4G0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...