3G4CA

Flavine dependant thymidylate syntahse s88c mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
209
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELCGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title An unusual mechanism of thymidylate biosynthesis in organisms containing the thyX gene.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 77
structure length 209
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3g4cA00
1O27A 3N3YA 4GT9A 3G4AA 1O2AA 4KASA 5IOQA 4P5AA 1O2BA 3AH5A 1O29A 5IOSA 4FZBA 2CFAB 4GTBA 4KATA 4KARA 4GTEA 1O24A 4GTLA 5JFEA 4GTCA 3G4CA 5IORA 5IOTA 1O25A 2CFAA 4GTDA 3N0CA 1O28A 4P5BA 3N0BA 1O26A 1KQ4A 5CHPA 4GTAA 4GTFA
chains in the Genus database with same CATH superfamily
1WQHA 1SMYA 2YU9A 1DCPA 1B4BA 4P5AA 5IP7C 2E2IC 3GSIA 3V4GA 5C3EK 5L46A 4A93K 4G0WA 1Y1VA 4KATA 4C45A 4BY1C 4J3NA 1TWAK 1WOOA 4A3EC 3S1MK 3K7AC 2A69A 2JA7C 1I3QA 3GTOA 1EFWA 4A3JC 1O28A 5C44C 3GTMK 3N0BA 3M4OC 1Y1WA 5C4XK 2E2JC 4BBSK 3QX3A 2V6SA 4M1XA 1RU0A 1X31C 1K83A 4KN7A 1J6XA 2Y0SL 1O2AA 5EGHA 2E2HK 2JA6A 4YFXA 1WQFA 3GTJK 4C2MK 4A3KC 2R92A 1PJ7A 1IBAA 1GE9A 1SFOK 3OEPA 3TFJA 4AYBL 1J98A 4KC6A 4YFKA 2NVQK 4XLPA 1WCMA 2A68A 2A6EA 5TJ3A 1JVIA 4XSXA 5IYBC 4MQ9A 1IW7A 1UV7A 1TWGA 4LOWA 4P9SA 2V6TA 5C4JK 3PO2K 3HOXK 4C3IK 3FKIK 3S17C 4Q5SA 1JOEA 4LLGA 2B63A 4KAWX 1USOA 1I50A 5M5WK 4GZYA 3S1NC 3A8JA 5M3MK 4PABA 1F9NA 2R93A 4LQYA 3I4NC 2R7ZK 5IOTA 1TWCC 5M5YK 3FHZA 1DD5A 4KN4A 4LK0A 1VGXA 3GTLK 1WQGA 4BXXK 2YU9C 2XCQA 5HL8A 1TWFA 3G4AA 1IL2A 2WB1D 1Y1VC 2JA5C 4XLNA 4OIPA 2PA8D 5FJ8K 3H3VD 2NVYK 1WSRA 2WB1L 3G4CA 2PA8L 3S2HC 1VLOA 4GTDA 5FLMC 4OIOA 2GSNA 4G0UA 1INNA 3FOEA 1O26A 2JA6C 3GEHA 2R92C 1L0WA 3HOWC 2VUMC 5IP7K 3WODA 3JSTA 4PAAA 2E2IK 4KB4A 4A3FC 1EH1A 4LK1A 4BY1K 4BBRC 1I6HC 4GTLA 4A3EK 4A3DC 3K7AK 2JA7K 1O25A 3GTKC 4A3JK 5C44K 4KDDA 3S15C 3M4OK 3S14C 2E2JK 3RZDC 3RZOC 5JVOA 1R9TA 1BGWA 1I50C 2RH6A 3TFIA 4BKWA 4A3KK 4RMFA 4OIRA 3CQZA 2E2HA 3GEEA 1I6VA 3GTJA 2EBBA 4DDQA 4KARA 1O24A 5TMCA 3OREA 4C3HC 2GSOA 1USMA 5CJ9A 2Y0SD 1TWFC 3H0GA 3HOZC 5IYBK 3GEIA 3SZZA 5IOQA 1YNNA 3S17K 4AYBD 4G0VA 2D6FC 1ZYRA 3AD7C 3T02A 4BY7C 2ZFZA 3ERED 4QIWD 3S1NK 3FKIA 1PJ5A 2JH3A 2NVXC 3I4NK 3HOUC 3GTGA 1TWCK 4KM8A 3GTQC 4QIWL 3S2DC 2YU9K 5CHPA 1AB4A 4OIQA 4NOIA 4WILA 5M5XK 3HOYC 3HKZL 1Y1VK 2JA5K 1WIHA 2RGRA 1J6WA 3S0XA 3NUHA 4XCHA 4FZBA 3LAJA 3HOVC 1EI6A 1XZQB 5D4DA 3GTPC 1TWHC 4Y7NC 5FLMK 4A3IC 2NVYA 1F7UA 1R9TC 2JA6K 1ISEA 4C3JC 4MEYA 1O27A 3S16C 3AQOA 3LAPA 3CQZC 3HOWK 2VUMK 4A3FK 4KMUA 4BBRK 3S1RK 1I6HK 2E2IA 4AH6A 4A3DK 5JFEA 1I3QC 3GTOC 2PMZL 4KM9A 3GTKK 3S15K 3H0GC 3S1QC 1Y1WC 3N0CA 2PHCB 3IPJA 3S14K 2JA7A 4BLAA 1K83C 4LR2A 3RZDK 3RZOK 2A6HA 4A3GC 1I50K 1HI9A 3L4JA 3AH5A 2ZUFA 3GTGC 1HQMA 1IQ0A 4GTBA 4A3LC 2WAQL 3CAGA 4QJVA 1WCMC 4GFQA 4LJZA 1F93A 1G51A 4C3HK 1JQWA 5IP9C 1WSVA 1TWAA 1XXAA 4JK1A 1TWFK 3M3YC 3HOZK 1O2FB 1TWGC 3FOFA 1ZXOA 5TMFA 1J6VA 4X6AC 3GTMA 4BLBA 1XZPB 1EQRA 2B63C 4KMAA 4A3CC 4BY7K 2PPBA 2R93C 3BP3A 1XXBA 4WJ3M 2NVXK 4GTEA 3HOUK 4GTCA 1SFOA 3GTQK 4XSZA 3S2DK 1XZQA 2O5JA 1TWCA 4G7HA 5IYDC 2JA8K 3HOYK 3TTGA 2V6UA 1VRQC 4Y52C 5M3FK 4A3MC 4QJVB 1XXCA 2Y3PA 2JA5A 3HOVK 2CFAB 2KWAA 1YX2A 3AD8C 3PO3C 3T00A 3I4MC 4KB2A 1BJTA 3SZYA 3GTPK 1TWHK 4Y7NK 5IYCC 4A3IK 4A3BC 1BS2A 1R9TK 3HKZD 2R7ZA 1V5VA 3MMLB 1KQ4A 4C3JK 3S16K 3TFHA 2NVTC 3CQZK 2JA8C 2GAGC 3GTLA 2GSUA 2CW0A 1C0AA 3HXAA 3ADAC 2VUMA 5C3EC 4A93C 1I3QK 3GTOK 1TWAC 4OINA 1F7VA 5IORA 2O5IA 3H0GK 3S1MC 3S1QK 1Y1WK 3S2HK 4P5BA 3GTMC 3AD9C 1K83K 3GTKA 3Q3QA 5C4XC 3A8KA 4GTAA 4GTFA 1EK8A 4BBSC 2R92K 2XCOA 4A3GK 4G7OA 2E2HC 1B4AA 1ZQ1C 3GTJC 2PMZD 4C2MC 1O29A 3GTGK 3EQLA 1XZPA 1SFOC 4ILDA 4A3LK 4WJ4A 1WCMK 4YG2A 1XPPA 5IP9K 1VJEA 2NVQC 1ZBSA 1YCLA 3M3YK 1VH2A 1TWGK 3BP8C 2BE5A 2ZUEA 4FM9A 2P8TA 5EGEA 4X6AK 1YNJA 4KMHA 5C4JC 4KASA 1WOPA 2B63K 3PO2C 3DXJA 1ZVUA 4A3CK 2WAQD 4O2DA 4C3IC 3FKIC 1PJ6A 2W7VA 4KMDA 3HOXC 3L4KA 3GIRA 2R93K 1WORA 3AQPA 3BUEA 4YFNA 2R7ZC 2P5MA 3GDZA 2NVXA 2CFAA 1IS1A 5E68A 3OPFA 3T01A 1WOSA 3H3VL 3GTQA 1DCOA 3GTLC 5IYDK 4G7ZA 4BXXC 2FQOA 1DCHA 1BDFA 3N3YA 4GT9A 4Y52K 3VA7A 4A3MK 2GAHC 1O2BA 4ZH4A 5IOSA 4MEXA 3PO3K 3S1RC 3I4MK 2FQTA 2NVYC 5IYCK 3LPXA 4A3BK 4Q4ZA 1IE0A 3GTPA 1TWHA 2XCRB 2NVTK 3A8IA
chains in the Genus database with same CATH topology
1O27A 3AQOA 3LAPA 1WQHA 3GTLA 2YU9A 4P5AA 1B4BA 2GSUA 4KB4A 1EH1A 3V4GA 2VUMA 4G0WA 1Y1VA 4KATA 2E2IA 4J3NA 4GTLA 5JFEA 5IORA 4KM9A 1O25A 1I3QA 4KDDA 3GTOA 3N0CA 1O28A 4P5BA 3N0BA 2PHCB 3GTKA 2JA7A 1Y1WA 4BLAA 3Q3QA 4LR2A 4GTAA 4GTFA 3QX3A 1EK8A 4M1XA 2XCOA 1K83A 5JVOA 1R9TA 1O2AA 5EGHA 2JA6A 1BGWA 2RH6A 1B4AA 4BKWA 1WQFA 2R92A 4C2MC 3CQZA 3AH5A 1O29A 3L4JA 2E2HA 1GE9A 3OEPA 4GTBA 3GTJA 4ILDA 4DDQA 4KARA 1O24A 3CAGA 4KC6A 4GFQA 3OREA 4C3HC 1WCMA 2GSOA 1TWAA 1ZBSA 5CJ9A 5TJ3A 1XXAA 3H0GA 3FOFA 4FM9A 1ZXOA 5EGEA 1TWGA 3GTMA 4BLBA 4KMHA 5IOQA 4KASA 4G0VA 1ZVUA 4KMAA 4C3IC 4KMDA 3L4KA 2ZFZA 3ERED 2B63A 4KAWX 1I50A 3FKIA 3AQPA 1XXBA 3BUEA 1F9NA 2JH3A 4GTEA 2R93A 3GTGA 4GTCA 4LQYA 1SFOA 5IOTA 4KM8A 3FHZA 2P5MA 1DD5A 2NVXA 2CFAA 1IS1A 3OPFA 1TWCA 3GTQA 1WQGA 5CHPA 2XCQA 1AB4A 3N3YA 1TWFA 4GT9A 3G4AA 1WIHA 3VA7A 2RGRA 1O2BA 5IOSA 3S0XA 3NUHA 1XXCA 2Y3PA 4FZBA 2JA5A 2CFAB 3LAJA 2KWAA 4KB2A 1BJTA 3G4CA 3LPXA 4GTDA 2NVYA 3GTPA 1TWHA 2GSNA 4G0UA 3FOEA 1O26A 2XCRB 2R7ZA 3MMLB 1KQ4A 1ISEA 4C3JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O27 A;  3N3Y A;  4GT9 A;  3G4A A;  1O2A A;  4KAS A;  5IOQ A;  4P5A A;  1O2B A;  3AH5 A;  1O29 A;  5IOS A;  4FZB A;  2CFA B;  4GTB A;  4KAT A;  4KAR A;  4GTE A;  1O24 A;  4GTL A;  5JFE A;  4GTC A;  3G4C A;  5IOR A;  5IOT A;  1O25 A;  2CFA A;  4GTD A;  3N0C A;  1O28 A;  4P5B A;  3N0B A;  1O26 A;  1KQ4 A;  5CHP A;  4GTA A;  4GTF A; 
#chains in the Genus database with same CATH topology
 1WQH A;  1SMY A;  2YU9 A;  1DCP A;  1B4B A;  4P5A A;  5IP7 C;  2E2I C;  3GSI A;  3V4G A;  5C3E K;  5L46 A;  4A93 K;  4G0W A;  1Y1V A;  4KAT A;  4C45 A;  4BY1 C;  4J3N A;  1TWA K;  1WOO A;  4A3E C;  3S1M K;  3K7A C;  2A69 A;  2JA7 C;  1I3Q A;  3GTO A;  1EFW A;  4A3J C;  1O28 A;  5C44 C;  3GTM K;  3N0B A;  3M4O C;  1Y1W A;  5C4X K;  2E2J C;  4BBS K;  3QX3 A;  2V6S A;  4M1X A;  1RU0 A;  1X31 C;  1K83 A;  4KN7 A;  1J6X A;  2Y0S L;  1O2A A;  5EGH A;  2E2H K;  2JA6 A;  4YFX A;  1WQF A;  3GTJ K;  4C2M K;  4A3K C;  2R92 A;  1PJ7 A;  1IBA A;  1GE9 A;  1SFO K;  3OEP A;  3TFJ A;  4AYB L;  1J98 A;  4KC6 A;  4YFK A;  2NVQ K;  4XLP A;  1WCM A;  2A68 A;  2A6E A;  5TJ3 A;  1JVI A;  4XSX A;  5IYB C;  4MQ9 A;  1IW7 A;  1UV7 A;  1TWG A;  4LOW A;  4P9S A;  2V6T A;  5C4J K;  3PO2 K;  3HOX K;  4C3I K;  3FKI K;  3S17 C;  4Q5S A;  1JOE A;  4LLG A;  2B63 A;  4KAW X;  1USO A;  1I50 A;  5M5W K;  4GZY A;  3S1N C;  3A8J A;  5M3M K;  4PAB A;  1F9N A;  2R93 A;  4LQY A;  3I4N C;  2R7Z K;  5IOT A;  1TWC C;  5M5Y K;  3FHZ A;  1DD5 A;  4KN4 A;  4LK0 A;  1VGX A;  3GTL K;  1WQG A;  4BXX K;  2YU9 C;  2XCQ A;  5HL8 A;  1TWF A;  3G4A A;  1IL2 A;  2WB1 D;  1Y1V C;  2JA5 C;  4XLN A;  4OIP A;  2PA8 D;  5FJ8 K;  3H3V D;  2NVY K;  1WSR A;  2WB1 L;  3G4C A;  2PA8 L;  3S2H C;  1VLO A;  4GTD A;  5FLM C;  4OIO A;  2GSN A;  4G0U A;  1INN A;  3FOE A;  1O26 A;  2JA6 C;  3GEH A;  2R92 C;  1L0W A;  3HOW C;  2VUM C;  5IP7 K;  3WOD A;  3JST A;  4PAA A;  2E2I K;  4KB4 A;  4A3F C;  1EH1 A;  4LK1 A;  4BY1 K;  4BBR C;  1I6H C;  4GTL A;  4A3E K;  4A3D C;  3K7A K;  2JA7 K;  1O25 A;  3GTK C;  4A3J K;  5C44 K;  4KDD A;  3S15 C;  3M4O K;  3S14 C;  2E2J K;  3RZD C;  3RZO C;  5JVO A;  1R9T A;  1BGW A;  1I50 C;  2RH6 A;  3TFI A;  4BKW A;  4A3K K;  4RMF A;  4OIR A;  3CQZ A;  2E2H A;  3GEE A;  1I6V A;  3GTJ A;  2EBB A;  4DDQ A;  4KAR A;  1O24 A;  5TMC A;  3ORE A;  4C3H C;  2GSO A;  1USM A;  5CJ9 A;  2Y0S D;  1TWF C;  3H0G A;  3HOZ C;  5IYB K;  3GEI A;  3SZZ A;  5IOQ A;  1YNN A;  3S17 K;  4AYB D;  4G0V A;  2D6F C;  1ZYR A;  3AD7 C;  3T02 A;  4BY7 C;  2ZFZ A;  3ERE D;  4QIW D;  3S1N K;  3FKI A;  1PJ5 A;  2JH3 A;  2NVX C;  3I4N K;  3HOU C;  3GTG A;  1TWC K;  4KM8 A;  3GTQ C;  4QIW L;  3S2D C;  2YU9 K;  5CHP A;  1AB4 A;  4OIQ A;  4NOI A;  4WIL A;  5M5X K;  3HOY C;  3HKZ L;  1Y1V K;  2JA5 K;  1WIH A;  2RGR A;  1J6W A;  3S0X A;  3NUH A;  4XCH A;  4FZB A;  3LAJ A;  3HOV C;  1EI6 A;  1XZQ B;  5D4D A;  3GTP C;  1TWH C;  4Y7N C;  5FLM K;  4A3I C;  2NVY A;  1F7U A;  1R9T C;  2JA6 K;  1ISE A;  4C3J C;  4MEY A;  1O27 A;  3S16 C;  3AQO A;  3LAP A;  3CQZ C;  3HOW K;  2VUM K;  4A3F K;  4KMU A;  4BBR K;  3S1R K;  1I6H K;  2E2I A;  4AH6 A;  4A3D K;  5JFE A;  1I3Q C;  3GTO C;  2PMZ L;  4KM9 A;  3GTK K;  3S15 K;  3H0G C;  3S1Q C;  1Y1W C;  3N0C A;  2PHC B;  3IPJ A;  3S14 K;  2JA7 A;  4BLA A;  1K83 C;  4LR2 A;  3RZD K;  3RZO K;  2A6H A;  4A3G C;  1I50 K;  1HI9 A;  3L4J A;  3AH5 A;  2ZUF A;  3GTG C;  1HQM A;  1IQ0 A;  4GTB A;  4A3L C;  2WAQ L;  3CAG A;  4QJV A;  1WCM C;  4GFQ A;  4LJZ A;  1F93 A;  1G51 A;  4C3H K;  1JQW A;  5IP9 C;  1WSV A;  1TWA A;  1XXA A;  4JK1 A;  1TWF K;  3M3Y C;  3HOZ K;  1O2F B;  1TWG C;  3FOF A;  1ZXO A;  5TMF A;  1J6V A;  4X6A C;  3GTM A;  4BLB A;  1XZP B;  1EQR A;  2B63 C;  4KMA A;  4A3C C;  4BY7 K;  2PPB A;  2R93 C;  3BP3 A;  1XXB A;  4WJ3 M;  2NVX K;  4GTE A;  3HOU K;  4GTC A;  1SFO A;  3GTQ K;  4XSZ A;  3S2D K;  1XZQ A;  2O5J A;  1TWC A;  4G7H A;  5IYD C;  2JA8 K;  3HOY K;  3TTG A;  2V6U A;  1VRQ C;  4Y52 C;  5M3F K;  4A3M C;  4QJV B;  1XXC A;  2Y3P A;  2JA5 A;  3HOV K;  2CFA B;  2KWA A;  1YX2 A;  3AD8 C;  3PO3 C;  3T00 A;  3I4M C;  4KB2 A;  1BJT A;  3SZY A;  3GTP K;  1TWH K;  4Y7N K;  5IYC C;  4A3I K;  4A3B C;  1BS2 A;  1R9T K;  3HKZ D;  2R7Z A;  1V5V A;  3MML B;  1KQ4 A;  4C3J K;  3S16 K;  3TFH A;  2NVT C;  3CQZ K;  2JA8 C;  2GAG C;  3GTL A;  2GSU A;  2CW0 A;  1C0A A;  3HXA A;  3ADA C;  2VUM A;  5C3E C;  4A93 C;  1I3Q K;  3GTO K;  1TWA C;  4OIN A;  1F7V A;  5IOR A;  2O5I A;  3H0G K;  3S1M C;  3S1Q K;  1Y1W K;  3S2H K;  4P5B A;  3GTM C;  3AD9 C;  1K83 K;  3GTK A;  3Q3Q A;  5C4X C;  3A8K A;  4GTA A;  4GTF A;  1EK8 A;  4BBS C;  2R92 K;  2XCO A;  4A3G K;  4G7O A;  2E2H C;  1B4A A;  1ZQ1 C;  3GTJ C;  2PMZ D;  4C2M C;  1O29 A;  3GTG K;  3EQL A;  1XZP A;  1SFO C;  4ILD A;  4A3L K;  4WJ4 A;  1WCM K;  4YG2 A;  1XPP A;  5IP9 K;  1VJE A;  2NVQ C;  1ZBS A;  1YCL A;  3M3Y K;  1VH2 A;  1TWG K;  3BP8 C;  2BE5 A;  2ZUE A;  4FM9 A;  2P8T A;  5EGE A;  4X6A K;  1YNJ A;  4KMH A;  5C4J C;  4KAS A;  1WOP A;  2B63 K;  3PO2 C;  3DXJ A;  1ZVU A;  4A3C K;  2WAQ D;  4O2D A;  4C3I C;  3FKI C;  1PJ6 A;  2W7V A;  4KMD A;  3HOX C;  3L4K A;  3GIR A;  2R93 K;  1WOR A;  3AQP A;  3BUE A;  4YFN A;  2R7Z C;  2P5M A;  3GDZ A;  2NVX A;  2CFA A;  1IS1 A;  5E68 A;  3OPF A;  3T01 A;  1WOS A;  3H3V L;  3GTQ A;  1DCO A;  3GTL C;  5IYD K;  4G7Z A;  4BXX C;  2FQO A;  1DCH A;  1BDF A;  3N3Y A;  4GT9 A;  4Y52 K;  3VA7 A;  4A3M K;  2GAH C;  1O2B A;  4ZH4 A;  5IOS A;  4MEX A;  3PO3 K;  3S1R C;  3I4M K;  2FQT A;  2NVY C;  5IYC K;  3LPX A;  4A3B K;  4Q4Z A;  1IE0 A;  3GTP A;  1TWH A;  2XCR B;  2NVT K;  3A8I A; 
#chains in the Genus database with same CATH homology
 1O27 A;  3AQO A;  3LAP A;  1WQH A;  3GTL A;  2YU9 A;  4P5A A;  1B4B A;  2GSU A;  4KB4 A;  1EH1 A;  3V4G A;  2VUM A;  4G0W A;  1Y1V A;  4KAT A;  2E2I A;  4J3N A;  4GTL A;  5JFE A;  5IOR A;  4KM9 A;  1O25 A;  1I3Q A;  4KDD A;  3GTO A;  3N0C A;  1O28 A;  4P5B A;  3N0B A;  2PHC B;  3GTK A;  2JA7 A;  1Y1W A;  4BLA A;  3Q3Q A;  4LR2 A;  4GTA A;  4GTF A;  3QX3 A;  1EK8 A;  4M1X A;  2XCO A;  1K83 A;  5JVO A;  1R9T A;  1O2A A;  5EGH A;  2JA6 A;  1BGW A;  2RH6 A;  1B4A A;  4BKW A;  1WQF A;  2R92 A;  4C2M C;  3CQZ A;  3AH5 A;  1O29 A;  3L4J A;  2E2H A;  1GE9 A;  3OEP A;  4GTB A;  3GTJ A;  4ILD A;  4DDQ A;  4KAR A;  1O24 A;  3CAG A;  4KC6 A;  4GFQ A;  3ORE A;  4C3H C;  1WCM A;  2GSO A;  1TWA A;  1ZBS A;  5CJ9 A;  5TJ3 A;  1XXA A;  3H0G A;  3FOF A;  4FM9 A;  1ZXO A;  5EGE A;  1TWG A;  3GTM A;  4BLB A;  4KMH A;  5IOQ A;  4KAS A;  4G0V A;  1ZVU A;  4KMA A;  4C3I C;  4KMD A;  3L4K A;  2ZFZ A;  3ERE D;  2B63 A;  4KAW X;  1I50 A;  3FKI A;  3AQP A;  1XXB A;  3BUE A;  1F9N A;  2JH3 A;  4GTE A;  2R93 A;  3GTG A;  4GTC A;  4LQY A;  1SFO A;  5IOT A;  4KM8 A;  3FHZ A;  2P5M A;  1DD5 A;  2NVX A;  2CFA A;  1IS1 A;  3OPF A;  1TWC A;  3GTQ A;  1WQG A;  5CHP A;  2XCQ A;  1AB4 A;  3N3Y A;  1TWF A;  4GT9 A;  3G4A A;  1WIH A;  3VA7 A;  2RGR A;  1O2B A;  5IOS A;  3S0X A;  3NUH A;  1XXC A;  2Y3P A;  4FZB A;  2JA5 A;  2CFA B;  3LAJ A;  2KWA A;  4KB2 A;  1BJT A;  3G4C A;  3LPX A;  4GTD A;  2NVY A;  3GTP A;  1TWH A;  2GSN A;  4G0U A;  3FOE A;  1O26 A;  2XCR B;  2R7Z A;  3MML B;  1KQ4 A;  1ISE A;  4C3J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...