3G4PA

Oxa-24 beta-lactamase at ph 7.5
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 79
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g4pA00
3SH9A 4ZJ3A 2H5SA 3C4OA 1ALQA 5J8XA 2FFYA 5EVIB 1FCNA 3IT9A 4BENA 5G18A 1SHVA 3HLFA 4JLFA 3QNBA 3W4QA 5FSRA 4PM6A 5IHVA 1K57C 1SDEA 5JYOA 2IWCA 3D4FA 4FSFA 1G68A 4KZ8A 2B5RA 3SS5A 4JF4A 3M2KA 3G2ZA 2HDUA 1DJCA 1FSWA 1FCOA 1ONGA 3BECA 2IWBA 4JBFA 3ISGA 1HTZA 2DRWA 2QPNA 3UPPA 4LV0A 3UY6A 1VM1A 4DF6A 1FCMA 1L0EA 3IXDA 1PWDA 2DNSA 3GRJA 4UAAA 3UDFA 1XGJA 4C3QA 4RX2A 3O3VA 1IEMA 3ZDJA 3UPOA 2P9VB 5CGSA 4UHUA 1W7FA 4DE2A 1YLTA 4HESA 5CEDA 2Y59A 2ZQ9A 5DTKA 3RXWA 4N9KA 4S2LA 3IF6B 3VFHA 1SDNA 3ZFZA 1K55A 1H5XA 2I72A 4WM9A 2ZD8A 1K38A 4HBUA 4FH4A 4E3OA 4FD8A 1J9MA 1LI0A 1BLHA 4KG2A 4PM8A 3NY4A 3EQUA 5M1AA 3PBNA 4LV1A 3TSGA 1KE4A 2Y4AA 4K91A 1BLSA 5HAQA 3UDXA 5KSHA 1JVJA 4OPZA 2Y2QA 3A3EA 3BEBA 1W8QA 1YLWA 1PWGA 3ZHHA 3LEZA 5HAPA 3C4PA 1WYBA 1E25A 2HDSA 1NRFA 4O7DA 4GOGA 2V1ZA 1HD8A 4LCLA 2CC1A 2WK0A 3RXXA 4S2NA 2HDRA 4GKUA 5GHXA 1RGYA 5CECA 5FI2A 2WKIA 5FQIA 1XA7A 2PBYA 3IXBA 2H10A 1HVBA 2DCFA 2Z2LB 1O7EA 3IHBA 3MXRA 4QHCA 2Y2HA 3C5AA 4IEDA 2EX6A 3NC8A 1K56D 3S1YA 4B88A 2EFUA 2WGWA 3V3SA 4DDYA 4H8RA 1IYQA 4X53A 3V39A 3G4PA 3HVFA 4K0WA 5HARA 4GNUA 3Q7VB 3PTEA 5DF7A 4YFMA 3ZNYA 3MZFA 3FKVA 3WS4A 4FCFA 3VMAA 4Y7PA 4OOYA 1E4DA 1JTGA 3IF6C 3OCNA 4IVIA 1QMFA 1S6RA 2QMIA 3UE0A 3ZGAB 2XFSA 3AGEA 1LL9A 5EUAA 3P98A 5CTMA 4ZBEA 1TDGA 4DKIA 5E2HA 3IF5A 2IWDA 2XGNA 3AGDA 3UN7A 4ID4A 1YLPA 4R23A 3RJUA 5CEBA 4S2MA 2E8IA 3CZDA 4X6TA 4MNRA 5E43A 4KG6A 3M6BA 1OMEA 1RCJA 2XLNA 2ZQCA 3MZDA 4U0XA 4FH2A 3SS4A 3ZNTA 4BD1A 5CRFA 1PYYA 1GCEA 4KZ9A 1NY0A 1MBLA 1TEMA 3G30A 4B4XA 3FV7A 2G2WA 1BLPA 3IH8A 3UNWA 4S2PA 1W8YA 4M3KA 1JWZA 5EVIA 3IXGA 3HLDA 3OCLA 4OP5A 5F1GA 4X55A 3HLWA 3PAEA 2Z2MB 4MEZA 2OSUA 4KZ4A 1ZKJA 3VP0A 5AQAA 5CGXA 5L2FA 2C6WB 1KGFA 3NDGA 5EOEA 4EWFA 4R4RA 2ZLYA 3Q7ZA 1LHYA 3NIAA 2QZ6A 1DY6A 1K54A 3G2YA 3SH8A 3HLBA 2FFFB 1CEGA 4JPMA 3MKEA 3QHYA 4OQHA 3VP3A 3QNCA 4E3NA 1DJBA 1YT4A 3IWIA 3O88A 1PZOA 4N92A 4S2IA 4Z9QA 1M6KA 4WEJA 2Q9NA 1MY8A 5CGWA 5TFQA 3BFEA 4DXBA 4X69A 2BLSA 1KGEA 3DWZA 1EROA 1SCWA 1FSYA 4OVDA 1PI4A 2PU4A 4JXSA 1Y54A 5FDHA 3VSKA 3S4XA 4E3MA 1ES3A 1JWPA 4JF6A 3WRTA 2J9PA 2ZC3B 1MWTA 3DW0A 3HBRA 1SKFA 1MKIA 4NETA 2OV5A 3N8LA 4U0TA 5HX9A 3OPLA 1FOFA 3UO9A 1NZOA 2WZXA 5CHUA 5E2EA 4BD0A 3MKFA 3IH9A 3WS0A 3OZHA 4R3JA 2Y2NA 5HL1A 5FQ9A 1GA0A 2ZQAA 1GHMA 3N4IA 4N9LA 5E2FA 2X71A 3P09A 3M6HA 3ZVTA 5DF8A 5U47A 3Q07A 2EX2A 5FAOA 5D3OA 4WZ5C 2XD1A 4QY5A 4WEKA 1ES4A 1CI9A 1YLJA 4EQIA 1K6RA 3ZG5A 4S2JA 5GHZA 4CPKA 4GD6A 4QJGA 2VGKA 5CHJA 4S2OA 1PW8A 3TG9A 5KSCA 5FAQA 3HLCA 2ZJ9A 1I5QA 2EXBA 3IQAA 1PWCA 1E3UD 3PBSA 5DTSA 2Y2LA 2Q9MA 1XX2A 2XFTA 3W8KA 4KZ5A 3PBOA 3FKWA 2XDMA 2XH9A 2ZQDA 3GV9A 4L0LA 4MBHA 4DDSA 4P0MA 3OPRA 4P6BA 1JTDA 1MWRA 1NJ4A 3OPPA 4OPQA 4KENB 4WMCD 3VSLA 4ZDXA 1EWZA 4BJPA 4GN2A 1NYMA 1K57A 3HLEA 1KVLA 3FYZA 2WAEA 2WZZA 5M18A 5KZHA 4C6YA 4OQ0A 1NXYA 5A91A 4EBNA 5GLBA 2EXAA 4OH0A 3AGFA 1ERMA 3NBLA 4YINA 4RA7A 2X01A 1K56A 2Y2JA 4BL2A 3EQVA 1FR1A 3MBZA 1L0DA 1XPBA 3GSGA 3WS2A 2Y2GA 2Y2PA 3E2LA 3HUMA 2Y2KA 1GHIA 5AQ7A 5EPHA 1BLCA 3BFGA 3LY3A 5DF9A 2X02A 1EI5A 4DE1A 5F83A 3GR2A 1BSGA 4EBLA 3C7VA 1K54C 3BM6A 5JYPA 2WKHA 2BG1A 3CG5A 5EOOA 2H0TA 3CMZA 4E3LA 3LO7A 2HPBA 1KVMA 3BLMA 4HEFA 5DTTA 4KZ6A 1L0GA 5I94A 4E6WA 2WGIA 4Y0OA 2A49A 2WKEA 3UPNA 4LCMA 2HDQA 2HP5A 2J7VA 3A3IA 3V3RA 3PBQA 3TOIA 2J9OA 1GHPA 4DE3A 2EX8A 4OPYA 2V2FF 1TDLA 2WGWB 5EE8A 1ERQA 1AXBA 1LLBA 1YMSA 1RP5A 3SH7A 3ZCZA 2H0YA 2XF3A 3HL9A 5HAIA 4IBRA 4S2KA 3ZG0A 3CJMA 5BOHA 1MXOA 4X68A 5CTNA 3ITAA 4LV3A 4A5RA 5GLAA 4MBKA 4KG5A 4OPRA 3G34A 4N1HA 3GQZA 5F82A 3HUNA 4OOLA 3ZG8B 1K55C 3OC2A 2ZM8A 4ZAMA 1XKZA 2JC7A 3G32A 1IYPA 4EV4A 1IYOA 2Y91A 4OP8A 4RX3A 2WADA 2XR0A 4OLGA 5FI6A 3PAGA 2EFXA 3Q82A 5A92A 4MBFA 2ZC4B 4RYEA 1ESUA 3NDEA 1HZOA 2JCHA 1DJAA 3HREA 4XXRA 4JXVA 2ZM0A 4R4SA 1ES2A 3GVBA 5TR7A 1N9BA 2WUQA 2ZM2A 3WWXA 4Y0UA 2P9VA 5AQBA 4KQRA 1CEFA 2HP6A 3BFFA 2OLVA 1FR6A 5M19A 3LCEA 1YLYA 3WS1A 2GDNA 1WE4A 3IF6A 1BUEA 3ZG9B 4QB8A 2WYXA 4NK3A 4DRTA 3HLGA 1NYYA 3BRMA 3MZEA 2OLUA 4QD4A 1IKGA 4PM9A 4S2NC 5FQQA 4C75A 1IELA 2Y2MA 3JYIA 3UDIA 2Y2IA 1W5DA 1M40A 5GHYA 1QMEA 4IBXA 4WYYA 3VOYA 5AQ9A 1Q2PA 3PBTA 3A3DA 3MXSA 1XP4A 2G2UA 1ONHA 4IVKA 5GLDA 2XK1A 4R1GA 3OPHA 3N6IA 2JE5A 1CI8A 4UA7A 5A93A 4KQOA 1K6SA 3GTCA 5HFOA 5HW3A 5GLCA 3BYDA 3I7JA 4HBTA 3IXHA 4R0QA 3VFFA 1PW1A 2ZQ7A 3W4PA 2ZC5B 3N7WA 4X56A 1IYSA 2RCXA 1XXMA 1BTLA 3V5MA 1BZAA 1L0FA 3Q1FA 3N8RA 3UE1A 1ZG4A 4UA9A 1NZUA 1E3UA 4KZ3A 3C7UA 5KMWA 1FQGA 5GL9A 4KZAA 2RL3A 2UWXA 5CHMA 2R9WA 4EUZA 1I2SA 4P87A 3BFDA 3ZVWA 1ES5A 1XGIA 3NCKA 4WMCA 3DWKA 4JF5A 1ZC2A 3Q7VA 1WYCA 1G6AA 1MWSA 5E2GA 1YM1A 3IWQA 4WZ4A 3DTMA 2C5WB 3BLSA 4R3BA 2Y55A 3BFCA 4JXGA 1ESIA 2Y2OA 3G35A 5EVIC 1JWVA 5TGFA 1LL5A 2XD5A 1C3BA 1U60A 4KZ7A 4OOMA 2WAFA 1YLZA 3GMWA 3O87A 2ZC7A 4KZBA 3VP1A 4PM5A 4OONA 4BQMA 4PM7A 1BT5A 3IHAA 4K0XA 1L2SA 3FWLA 4D2OA 1K4EA 2J8YA 3IWOA 4KQQA 3M2JA 4ZTKA 1K4FA 2VGJA 1H8ZA 3LY4A 1IKIA 1I2WA 1Z6FA 3B3XA 3O86A 5FQMA 3SOIA 4PMAA 4DE0A 1K25A 2V20A 1CK3A 4BLMA 4XUXA 5EVLA 4P85A 1BULA 2WGVA 4ZJ2A 5EECA 5CXWA 1O07A 5A90A 4JXWA 3WRZA 1PZPA 4WZ5A 5FASA 4WELA 4B4ZA 1MPLA 4JKTA 4UA6A 1Q2QA 1LI9A 5CERA 3E2KA 3VP4A 3A3JA 3NI9A 4N1XA 4QU3A 3UE3A 3FZCA 3A3FA 4E3JA 4GDBA 4OQGA 1XA1A 1ZG6A 4XUZA 3ZG7B 1YMXA 5FI7A 5F1FA 4MLLA 5FAPA 4E3IA 4LV2A 5DVAA 2A3UA 3N8SA 5FQKA 3G31A 3S22A 4GDNA 3VP2A 1H8YA 4LENA 4PPRA 4QY6A 4DXCA 3WS5A 4Q8IA 4GB7A 2P74A 4ZJ1A 2XEPA 4BL3A 3PBRA 4EBPA 2ZMAA 3MFDA 1KE0A 4OKPA 3SS3A 1KDSA 1TVFA 4GZBA 3HUOA 4Y0TA 1S0WA 5FATA 3Q81A 4WBGA 4OLDA 3ITBA 5FA7A 2ZQ8A 1YQSA 1GA9A 1KGGA 5EVID 3V50A 3VOZA 1PI5A 4GD8A 1KDWA 1W79A 2XQZA 2PU2A 2ZC6B 2R9XA 2EX9A 5FQJA 1VQQA 4RVAA 4U3TA 4CJNA 4E3KA 4E6XA 2HP9A 2JBFA 1KE3A 4OQIA 4F94A 1N4OA 1RGZA 1PIOA 1MWUA 3W4OA
chains in the Genus database with same CATH superfamily
4ZJ3A 5EVIB 2V9AA 1FCNA 3HLFA 3W4QA 5JYOA 1GSWA 4K08A 4O01A 1VEUA 4EXOA 2QJ5A 4JBFA 4CLCD 1HTZA 4YNRA 2QPNA 1VM1A 3MXQA 2DNSA 3GRJA 1XGJA 2YKHA 3O3VA 1IEMA 3ZDJA 3E4OA 5CGSA 1Y4OA 1W7FA 2Y59A 2ZQ9A 2V8FA 2JKFA 2PYPA 1LSXA 4E3OA 1LI0A 1BLHA 2J3TC 3IS2B 4GJ4A 4KG2A 4PM8A 3NY4A 5FEFA 3ULFA 5EVEA 4OPZA 5HWTA 3C4PA 3EOIA 2GZAA 2OWJA 3EGDC 4O7DA 2XRNA 3T4KA 3QP5A 4LCLA 2WK0A 3LIFA 4R38A 5EM1A 3EWKA 1T1AA 3IHBA 2NUTC 3MXRA 4BBUA 1K56D 2WGWA 1IYQA 3G4PA 4IVIA 1QMFA 3ZGAB 1SKOA 2W3DA 5E2HA 3IF5A 3AGDA 3NOUC 3UN7A 4ID4A 1YLPA 3RJUA 4GS9B 4MNRA 4KG6A 2XLNA 1PFLA 4NG2A 1JWZA 2HJEA 2JKTI 4G3VA 3PAEA 4LRXC 2C6WB 3U4LP 3NDGA 4EWFA 4R4RA 3Q7ZA 3NIAA 4EESA 1K54A 4JPMA 4OQHA 4YWZA 3QNCA 1PZOA 4Z9QA 1MY8A 5CGWA 3VE4A 2BLSA 4CLCA 1EROA 1PI4A 5L10A 5FDHA 3LIAA 3S4XA 2HGVA 3S7OA 3UMDA 1XJ2A 1F9IA 2OV5A 3UB7A 2L0WA 3OPLA 1FOFA 3IH9A 5TBMB 2A24A 1GHMA 4N9LA 3HCYA 3ZVTA 5U47A 2O9CA 2XA7S 4WEKA 4HJ3A 3LR5A 3FC7A 4EQIA 3SZTA 4GD6A 2WKRA 1DRMA 3GDIA 1NLZA 3F1PA 5KSCA 5FAQA 3HLCA 3R4KA 2EXBA 2W3EA 5HDSA 1XX2A 4KUKA 1FIKA 2XFTA 3W8KA 4L0LA 4P0MA 5G4YA 1NJ4A 3OPPA 3VSLA 4ZDXA 3IBJA 1NYMA 3V67A 3FYZA 2WZZA 1NXYA 5A91A 4EBNA 3NBLA 3KO6A 4RQ9A 3LI8A 1K56A 3EQVA 1FR1A 3MBZA 1L0DA 2Y2PA 4G3WA 3KSFA 5EPHA 1BLCA 2X02A 4DE1A 1XFQA 3GR2A 4QPRA 1BSGA 4EBLA 2PHYA 5JYPA 3BM6A 4P6ZS 5EOOA 3LO7A 2V1BA 4KZ6A 4BBTA 2WGIA 4Y0OA 2J7VA 3A3IA 1T1CA 4HI4A 2J9OA 1STZA 2V2FF 2IA2A 1TDLA 5EE8A 1ERQA 1AXBA 1LLBA 1EW0A 3T4OA 3CJMA 2HJ9C 4WF0A 3ITAA 4A5RA 4WLAA 4OPRA 2Z6DA 3GQZA 4OOLA 2Y91A 4OLGA 1F98A 2EWWA 3Q82A 5A92A 4RYEA 5L09A 1ESUA 5EV0A 3NDEA 1HZOA 2JCHA 4NEED 3GVBA 2WUQA 3ICYA 4KQRA 2HP6A 2KDKA 5M19A 3T4SA 1WE4A 3IF6A 1LSVA 2JKTM 4NK3A 3HLGA 3MZEA 2Y2IA 5C5KA 3VV4A 4IBXA 4I3JA 4HHDA 4EETB 5GLDA 2G7UA 2XK1A 3S7PA 4KQOA 1K6SA 3GTCA 4R0QA 2ZQ7A 4X56A 2RCXA 1XXMA 3F1OB 2ZL1A 2PT7A 3N8RA 3UB5P 4UA9A 1NZUA 4JGPA 5J3WA 1FQGA 5GL9A 3EEHA 4EUZA 3CHWP 1I2SA 2ZOHA 4X1LA 3UB9A 5E2GA 1OTEA 2V0UA 3BFCA 2PR5A 2Y2OA 2HF6A 1JWVA 1LL5A 4KZ7A 4LRZE 4KZBA 3O87A 3OLOA 3VP1A 3H7WA 5DKLA 3IWOA 4ZTKA 2LB9A 2VGJA 1H8ZA 3KSIA 1Z6FA 3O86A 1OTAA 2VJWA 3A0SA 4HNBA 3CPTB 4ZJ2A 5CXWA 2B95A 4X1MA 3S7NA 1OTDA 4WZ5A 1MPLA 4JKTA 4UA6A 1Q2QA 4CLCC 3VP4A 1XA1A 5FAPA 3VP2A 4GDNA 5IS1A 3KSHA 4DXCA 4ZJ1A 3MF0A 2L1MA 1KE0A 4MN5A 5FATA 4EEUA 4OLDA 1YQSA 5EVID 4EERA 1KDWA 2XQZA 4M4XA 3LFVA 5FQJA 2DMWA 3VE3A 4RVAA 2HP9A 2JBFA 2QJ7A 2VV6A 4F94A 1PIOA 1S67L 2FFYA 3IT9A 3MQQA 5G18A 4JLFA 5FSRA 5MC7A 2IWCA 2HDUA 3C8CA 1DJCA 3T1QB 2O0YA 1FCOA 1ONGA 3ISGA 2VLGA 5HD5A 1S1ZA 1FCMA 2KOIA 3IXDA 4UAAA 2BASA 2P9VB 2VV8A 4S2LA 3VFHA 1K55A 2P04A 4HBUA 4FH4A 4FD8A 3K3CA 3LICA 2Y4AA 3UDXA 5KSHA 1JVJA 4Y3IA 3BEBA 3DTEA 1YLWA 2PDRA 3W2ZA 1HD8A 4EEPA 3RXXA 3NECA 5GHXA 1XJ4A 1BYWA 5FI2A 2WKIA 5FQIA 1XA7A 2PBYA 3IXBA 1HVBA 2DCFA 4QHCA 1O7EA 3C5AA 1UGUA 4X25A 3NC8A 2A2LA 3V39A 1ZTUA 3HVFA 5HARA 4YFMA 3MZFA 4Y7PA 4Q0HA 4HP9A 1A0KA 4GCZA 3BQAA 3IF6C 1S6RA 2XFSA 3P98A 4DN0A 4DKIA 3CUEA 5F69A 2XGNA 4R23A 3LI9A 5CEBA 4S2MA 4X6TA 4BBVA 5E43A 5L8MA 3RFBA 3M6BA 1OMEA 3MZDA 3ZNTA 4BD1A 4FH2A 1PYYA 1NY0A 1TEMA 2G2WA 1NWZA 2I9VA 1BLPA 3MQOA 4S2PA 2K7SA 1W8YA 5EVIA 3OCLA 4OP5A 5F1GA 4X55A 4L9GA 4MEZA 4KZ4A 4PHTA 5AQAA 1UWPX 1KGFA 4MN7A 5EOEA 1S1YA 1DY6A 3SH8A 4PKYA 3HLBA 3MKEA 3A0RA 2ACGA 3R7WB 1DJBA 1YT4A 4Q0JA 2Q9NA 1VHMA 5DJUA 1V9ZA 5TFQA 2VA0A 3BFEA 4DXBA 3LEQA 4BMWA 3DWZA 4OVDA 4E3MA 5LBRA 1JWPA 4Y2FA 2J80A 2ZC3B 4HP4A 1MWTA 3DW0A 3HBRA 5CHUA 3MKFA 3WS0A 4R3JA 2X71A 5DF8A 5D3OA 4WZ5C 4UQIS 1P9RA 4O8GA 1VEUB 1OJ5A 1PRQA 2D02A 4CPKA 3H82A 4QJGA 2B02A 4KQDA 1PW8A 2MJ6A 2ZJ9A 1I5QA 4IUKA 3IQAA 1PWCA 3PBSA 5DTSA 3BJNA 3GECA 4EUVA 2XROA 2V0WA 4KZ5A 2XDMA 2XH9A 2ZQDA 2FH5A 3GV9A 4DDSA 3OPRA 1JTDA 1MWRA 4OPQA 3B47A 4GN2A 3HLEA 4C6YA 1ODVA 2EXAA 1ERMA 2ZOIA 4RA7A 3K2NA 2JHEA 4BL2A 1XPBA 3GSGA 4DJ2A 3C38A 5DKKA 1W63M 1GHIA 5I5LA 2PR6A 3BFGA 3LY3A 5HD3A 2BG1A 3CG5A 4E3LA 4CQHA 4ARZA 1MKMA 1L0GA 5I94A 2EWVA 2A49A 5K5BA 2WKEA 3UPNA 2Y8HA 2HDQA 3T1RA 3PBQA 1GHPA 4PKYG 4NXEA 4OPYA 3T4TA 4HJ4A 2WGWB 1RP5A 3ZCZA 2H0YA 4JGRA 1LL8A 3KSGA 4X68A 5CTNA 5GLAA 4KG5A 4N1HA 3F1NA 1S4SA 3ZG8B 1K55C 3KYZA 4ZAMA 4YOFA 1SKOB 1IYPA 4EV4A 4OP8A 2WADA 2XR0A 4LFUA 3CWFA 4MBFA 3E4PA 2VK3A 3HREA 1DJAA 4XXRA 4JXVA 2ZM0A 4R4SA 1ES2A 1OT6A 1N9BA 1LT0A 5HWVA 4Y0UA 4Q0IA 1CEFA 2PBDP 1TS0A 1MC0A 3BFFA 3LCEA 3WS1A 3NOTC 4IUHA 2WYXA 2J3WA 3BRMA 1IKGA 1XJ6A 1IELA 3E98A 4CLCE 3UDIA 1W5DA 5GHYA 1QMEA 4WYYA 3VOYA 5AQ9A 1Q2PA 3A3DA 3MXSA 1T1BA 4O0PA 1YKDA 2JE5A 5A93A 5HFOA 3IXHA 1PW1A 1LSWA 3V5MA 1BZAA 4CLCB 3Q1FA 3UE1A 3CUEC 4KZ3A 4DJ3A 5CHMA 2R9WA 1XGIA 2A24B 2ZMFA 3Q7VA 1WYCA 2VX8A 1G6AA 4AFIA 1YM1A 2YKFA 4R3BA 4BWIA 1ESIA 5EVIC 3PR6A 1KOUA 1U60A 5G4ZA 1W63Q 3GMWA 4PM5A 4BQMA 4PM7A 1BT5A 4K0XA 3F1PB 2WKQA 1L2SA 2J8YA 3BY9A 4KQQA 3JPUA 1VB6A 4PMAA 4DE0A 1K25A 4BLMA 2QYBA 2WGVA 5EECA 1G5UA 3OOVA 3WRZA 4WELA 3K3DA 3NI9A 4QU3A 3FG8A 3FZCA 3LR0A 4E3JA 3CI6A 4GDBA 5FI7A 5F1FA 4MLLA 4LV2A 5IT5A 2ZMVA 4WL9A 4QY6A 1MZUA 4BL3A 2ZMAA 1IOUA 1FILA 2E8JA 5EM0A 1KDSA 1TVFA 4GZBA 4Y0TA 3ITBA 2ZQ8A 1GA9A 1KGGA 3V50A 3VOZA 1L3LA 4MCWA 2R9XA 3UB8A 3L9KA 4HJ6A 4E3KA 4E6XA 4JGOA 1D7EA 4FTXA 1N9OA 1N4OA 1RGZA 3SH9A 1ALQA 1TS6A 4BENA 5DFYA 3QNBA 2ZBBA 4PM6A 3D4FA 4FSFA 1G68A 2B5RA 4R70A 3SS5A 3M2KA 3G2ZA 2QKPA 3BW6A 3BQ8A 2DRWA 4ETZA 3UPPA 4LV0A 1L0EA 2M1CA 1PWDA 2VEAA 4FUWA 5HWWA 3UPOA 2JN7A 4GHIA 4UHUA 2Q0OA 3QP1A 5CEDA 3RXWA 4N9KA 1Z09A 3IF6B 3ZFZA 5HZHA 1H5XA 4GLQA 1YPRA 1K38A 2B18A 5CX7A 3C2WA 4KUOA 5M1AA 2GJ3A 4LV1A 3TSGA 1KE4A 1D06A 4II7A 3IX3A 4K91A 1VETA 1DP8A 5HAQA 3QP6A 2Y2QA 3A3EA 3ZHHA 5HAPA 3TJZC 1WYBA 3CPTA 4IHQA 1NRFA 2VGLM 2V1ZA 2CC1A 4S2NA 1NRJA 2ZL1B 1RGYA 2W27A 2P7JA 2W1TB 3P01A 3NULA 3S1YA 2EFUA 4IJGA 1CF0A 4DDYA 4X53A 3FKVA 4FCFA 1P97A 1E4DA 1JTGA 1TS8A 2QMIA 5DJTA 3AGEA 5EUAA 3IX8A 4HOIA 1TDGA 2JKRI 1Y28A 2IWDA 3H7WB 2AVXA 4L9EA 5CRFA 1GCEA 3G30A 1DP6A 4ZRRA 3IH8A 4M3KA 1X0OA 2Y79A 4ME4A 3IXGA 5IU1A 3T4JA 1ZKJA 1WA9A 1ZHHB 3LYXA 2ZLYA 1H8MA 2FFFB 3VP3A 3IWIA 3O88A 4N92A 4WEJA 4X69A 1KGEA 2O9BA 1FSYA 2PU4A 3VSKA 3WRTA 3JVVA 1SKFA 1MKIA 1SZVA 4NETA 3N8LA 4U0TA 3UO9A 1NZOA 2WZXA 3OZHA 2Y2NA 5HL1A 5FQ9A 1GA0A 3N4IA 5E2FA 4F3LA 3LR3A 3P09A 3M6HA 3Q07A 5FAOA 2XD1A 2VV7A 1ES4A 1CI9A 1YLJA 2W3GA 3T1XA 2VGKA 3DAVA 5CHJA 4S2OA 2K31A 3CITA 3CAXA 2GNXA 1E3UD 2Y2LA 3DTIA 3PBOA 4MBHA 4NXGA 4P6BA 4WMCD 2XSSA 4XT2A 1EWZA 1K57A 1KVLA 2WAEA 1G28A 5M18A 5KZHA 4OQ0A 5GLBA 4OH0A 4YINA 2X01A 1J3WA 4G3KA 2LB5A 2Y2GA 3E2LA 5AQ7A 2L4RA 2BTFP 4H6JA 5F83A 3CLOA 2WKHA 3P7NA 3PHYA 2H0TA 3BLMA 1GSVA 4E6WA 1AWIA 4LCMA 2HP5A 1F2KA 3V3RA 4DE3A 2EX8A 3T4QA 2W3HA 3SH7A 1P0ZA 3HL9A 2OAP1 5HAIA 3ZG0A 1MXOA 4LV3A 3D3OA 4MBKA 5KIZA 3G34A 5F82A 2JKRM 4HH3A 3LIBA 3G32A 1IYOA 4RX3A 2PYRA 3PAGA 2EFXA 2O99A 4D60A 5TR7A 2ZM2A 3EEAA 1JNUA 2WKPA 2OLVA 1FR6A 5HDCA 1P9WA 4HH2A 1YLYA 1NYYA 2OLUA 4S2NC 4C75A 4WN5A 3JYIA 1M40A 3IS2A 3PBTA 3NHQA 2G2UA 3OPHA 3PYPA 3N6IA 1CI8A 3BYDA 3I7JA 3VFFA 2W1RA 3B33A 3N7WA 4ETXA 3MR0A 3KX0X 1N9NA 1H0MA 4LGWA 5HPFA 1E3UA 2CMNA 3C7UA 3JVUA 4KZAA 2UWXA 3BFDA 1T18A 4WMCA 1H3QA 4MDZA 3DWKA 1ZC2A 2R78A 5HL6A 3ZYTA 2NUPC 3IWQA 4WZ4A 2C5WB 5L07A 4QWOA 3NJAA 4JXGA 2KX6A 2XD5A 5F5YA 4OOMA 1YLZA 2ZC7A 5FEGA 3H82B 4GS9A 4PAUA 3FWLA 3M2JA 1K4FA 3LY4A 1I2WA 5FQMA 2GX5A 4XUXA 5EVLA 4P85A 1BULA 1YSPA 4DMZA 1O07A 4JXWA 4NXBA 1PZPA 3PXPA 3NOPC 5FDSA 4EQ1A 4B4ZA 4ESPA 1ACFA 3E2KA 1F5MA 3ZQ5A 1S4RA 4XUZA 4OQGA 4NXFA 3IX4A 3N8SA 3G31A 3S22A 1H8YA 2V8CA 4LENA 2XA7M 4PPRA 3WS5A 4Q8IA 4GB7A 2XEPA 2PD7A 4OKPA 1OT9A 3SS3A 1TF1A 3B42A 3KYQA 3HUOA 3E4QA 1S0WA 4ARZB 4GD8A 1W79A 3BWLA 2PU2A 2ZC6B 3O5YA 1YAXA 2Z6CA 2EX9A 4CJNA 5TBMA 2FZ0A 4OQIA 4I39A 1MWUA 3RTYA 2H5SA 3C4OA 5J8XA 1SHVA 5J4EA 2D01A 5IHVA 1K57C 1SDEA 5F6AA 4KZ8A 1N9LA 4JF4A 2HV1A 3F1NB 2K2NA 1FSWA 4UEYA 3BECA 5HDDA 3LUQA 2IWBA 1PNEA 3C30A 3UY6A 3TE8A 2M7UA 2M7VA 4DF6A 3UE6A 3UDFA 4C3QA 4RX2A 4P6ZM 4EW7A 4DE2A 1YLTA 4HESA 3MS6A 3S7QA 5DTKA 1SDNA 5FL3A 4LPZA 2I72A 2OOLA 4WM9A 2ZD8A 5HPIA 1S66L 1J9MA 4I3AA 4R6LA 3EQUA 4L9FA 3PBNA 5EFWA 1HLUP 1BLSA 3SW1A 2OAQ1 3T12B 3UMEA 1W8QA 1PWGA 4LRYC 3LEZA 1UWNX 5A8BA 1E25A 2HDSA 4HQAA 3VOLA 4GOGA 2PD8A 2HDRA 4GKUA 5CECA 1OTBA 1TS7A 2H10A 2Z2LB 2Y2HA 2VKSA 4IEDA 2EX6A 5TJJA 4B88A 3V3SA 4H8RA 4K0WA 1NLYA 3Q7VB 3PTEA 4GNUA 5DF7A 3ZNYA 3WS4A 1OPXA 3VMAA 3QP2A 4OOYA 3OCNA 3UE0A 1LL9A 4ZBEA 3MFXA 5CTMA 3IBRA 2E8IA 3CZDA 3DTKA 1RCJA 2ZQCA 4U0XA 2J3TD 3SS4A 1XJ3A 4KZ9A 1MBLA 4B4XA 3FV7A 1V9YA 4GW9A 3UNWA 3HLDA 3HLWA 5AJGA 2Z2MB 2OSUA 3VP0A 5CGXA 5L2FA 1LHYA 2QZ6A 3G2YA 4HIAA 1CEGA 3QHYA 4E3NA 3FPWA 4S2IA 1M6KA 4EU0A 3F1OA 2V1AA 5HSQA 1SCWA 2OWHA 2PRFA 4JXSA 1Y54A 2P08A 1ES3A 4JF6A 4WUJA 2J9PA 3HJIA 5HX9A 1TD5A 5E2EA 4BD0A 2ZQAA 3BY8A 2EX2A 1K0KA 4QY5A 1K6RA 3ZG5A 4S2JA 5GHZA 3TG9A 3T50A 2Q9MA 2W1TA 3FKWA 3LGOA 4MN6A 4GHIB 4KENB 4BJPA 3D72A 3TW8A 4HY8A 3AGFA 3DBAA 3QP4A 2Y2JA 3WS2A 4Y15A 3HUMA 2Y2KA 1VETB 5DF9A 1EI5A 1D1JA 4LLOB 2PAVP 3C7VA 1K54C 2JKGA 3CMZA 5F68A 4Y13A 2HPBA 1KVMA 3TRCA 4HEFA 5DTTA 1DP9A 1CJFA 2INWA 3TOIA 3MMHA 2VZWA 1YMSA 5AVEA 2XF3A 4IBRA 4S2KA 5BOHA 3LR4A 2QWSA 3HUNA 3OC2A 2ZM8A 1YSQA 1XKZA 2JC7A 3RH8B 4B93A 2VGLS 5FI6A 3L7HA 5DFXA 2ZC4B 2HZ5A 1XFNA 3LIEA 3WWXA 2QHKA 2P9VA 5AQBA 4I38A 2GDNA 1BUEA 3ZG9B 4QB8A 3T1SA 3HJKA 4DRTA 4QD4A 4PM9A 5FQQA 1T19A 2Y2MA 1OJGA 3EGXC 4I5SA 4R3AA 1XP4A 4IVKA 1ONHA 1OTIA 4R1GA 3MSHA 4UA7A 5HW3A 5GLCA 4HBTA 3W4PA 2ZC5B 3KYEA 1IYSA 1BTLA 4Y17A 1L0FA 3UB6A 3OBFA 1ZG4A 2KLIA 3E0YA 5KMWA 4B9OA 3A0VA 2W0NA 2RL3A 5AVFA 4P87A 4MMNA 2W3FA 3ZVWA 1ES5A 3NCKA 4JF5A 3MQ0A 3QP8A 4F3LB 1MWSA 5J7EA 3DTMA 3BLSA 4FOFA 3MJQA 2Y55A 1G6OA 3G35A 3H9WA 5TGFA 1C3BA 2H28A 2WAFA 1GSXA 4OONA 4E04A 3IHAA 2UV0E 4I3IA 4D2OA 1K4EA 4Y5FA 1IKIA 3B3XA 3SOIA 2V20A 3FPVA 1CK3A 3D9YA 4NKPA 3T4LA 5A90A 5FASA 4XT2B 1LI9A 5CERA 3A3JA 4N1XA 3UE3A 3A3FA 1ZG6A 3ZG7B 1YMXA 2EA9A 4Z1WA 4E3IA 5DVAA 5FQKA 2A3UA 4UQIM 3R7WA 4H6JB 2P74A 4EBPA 1IFQA 3PBRA 3MFDA 3G6OA 4JGQA 3U2AA 3Q81A 4WBGA 5FA7A 3LIDA 1PI5A 2O9AA 1VQQA 4U3TA 1KE3A 1CQAA 3W4OA
chains in the Genus database with same CATH topology
3SH9A 4ZJ3A 2H5SA 3C4OA 1ALQA 5J8XA 2FFYA 5EVIB 1FCNA 3IT9A 4BENA 5G18A 1SHVA 3HLFA 4JLFA 3QNBA 3W4QA 5FSRA 4PM6A 5IHVA 1K57C 1SDEA 5JYOA 2IWCA 3D4FA 4FSFA 1G68A 4KZ8A 2B5RA 3SS5A 4JF4A 3M2KA 3G2ZA 2HDUA 1DJCA 1FSWA 1FCOA 1ONGA 3BECA 2IWBA 4JBFA 3ISGA 1HTZA 2DRWA 2QPNA 3UPPA 4LV0A 3UY6A 1VM1A 4DF6A 1FCMA 1L0EA 3IXDA 1PWDA 2DNSA 3GRJA 4UAAA 3UDFA 1XGJA 4C3QA 4RX2A 3O3VA 1IEMA 3ZDJA 3UPOA 2P9VB 5CGSA 4UHUA 1W7FA 4DE2A 1YLTA 4HESA 5CEDA 2Y59A 2ZQ9A 5DTKA 3RXWA 4N9KA 4S2LA 3IF6B 3VFHA 1SDNA 3ZFZA 1K55A 1H5XA 2I72A 4WM9A 2ZD8A 1K38A 4HBUA 4FH4A 4E3OA 4FD8A 1J9MA 1LI0A 1BLHA 4KG2A 4PM8A 3NY4A 3EQUA 5M1AA 3PBNA 4LV1A 3TSGA 1KE4A 2Y4AA 4K91A 1BLSA 5HAQA 3UDXA 5KSHA 1JVJA 4OPZA 2Y2QA 3A3EA 3BEBA 1W8QA 1YLWA 1PWGA 3ZHHA 3LEZA 5HAPA 3C4PA 1WYBA 1E25A 2HDSA 1NRFA 4O7DA 4GOGA 2V1ZA 1HD8A 4LCLA 2CC1A 2WK0A 3RXXA 4S2NA 2HDRA 4GKUA 5GHXA 1RGYA 5CECA 5FI2A 2WKIA 5FQIA 1XA7A 2PBYA 3IXBA 2H10A 1HVBA 2DCFA 2Z2LB 1O7EA 3IHBA 3MXRA 4QHCA 2Y2HA 3C5AA 4IEDA 2EX6A 3NC8A 1K56D 3S1YA 4B88A 2EFUA 2WGWA 3V3SA 4DDYA 4H8RA 1IYQA 4X53A 3V39A 3G4PA 3HVFA 4K0WA 5HARA 4GNUA 3Q7VB 3PTEA 5DF7A 4YFMA 3ZNYA 3MZFA 3FKVA 3WS4A 4FCFA 3VMAA 4Y7PA 4OOYA 1E4DA 1JTGA 3IF6C 3OCNA 4IVIA 1QMFA 1S6RA 2QMIA 3UE0A 3ZGAB 2XFSA 3AGEA 1LL9A 5EUAA 3P98A 5CTMA 4ZBEA 1TDGA 4DKIA 5E2HA 3IF5A 2IWDA 2XGNA 3AGDA 3UN7A 4ID4A 1YLPA 4R23A 3RJUA 5CEBA 4S2MA 2E8IA 3CZDA 4X6TA 4MNRA 5E43A 4KG6A 3M6BA 1OMEA 1RCJA 2XLNA 2ZQCA 3MZDA 4U0XA 4FH2A 3SS4A 3ZNTA 4BD1A 5CRFA 1PYYA 1GCEA 4KZ9A 1NY0A 1MBLA 1TEMA 3G30A 4B4XA 3FV7A 2G2WA 1BLPA 3IH8A 3UNWA 4S2PA 1W8YA 4M3KA 1JWZA 5EVIA 3IXGA 3HLDA 3OCLA 4OP5A 5F1GA 4X55A 3HLWA 3PAEA 2Z2MB 4MEZA 2OSUA 4KZ4A 1ZKJA 3VP0A 5AQAA 5CGXA 5L2FA 2C6WB 1KGFA 3NDGA 5EOEA 4EWFA 4R4RA 2ZLYA 3Q7ZA 1LHYA 3NIAA 2QZ6A 1DY6A 1K54A 3G2YA 3SH8A 3HLBA 2FFFB 1CEGA 4JPMA 3MKEA 3QHYA 4OQHA 3VP3A 3QNCA 4E3NA 1DJBA 1YT4A 3IWIA 3O88A 1PZOA 4N92A 4S2IA 4Z9QA 1M6KA 4WEJA 2Q9NA 1MY8A 5CGWA 5TFQA 3BFEA 4DXBA 4X69A 2BLSA 1KGEA 3DWZA 1EROA 1SCWA 1FSYA 4OVDA 1PI4A 2PU4A 4JXSA 1Y54A 5FDHA 3VSKA 3S4XA 4E3MA 1ES3A 1JWPA 4JF6A 3WRTA 2J9PA 2ZC3B 1MWTA 3DW0A 3HBRA 1SKFA 1MKIA 4NETA 2OV5A 3N8LA 4U0TA 5HX9A 3OPLA 1FOFA 3UO9A 1NZOA 2WZXA 5CHUA 5E2EA 4BD0A 3MKFA 3IH9A 3WS0A 3OZHA 4R3JA 2Y2NA 5HL1A 5FQ9A 1GA0A 2ZQAA 1GHMA 3N4IA 4N9LA 5E2FA 2X71A 3P09A 3M6HA 3ZVTA 5DF8A 5U47A 3Q07A 2EX2A 5FAOA 5D3OA 4WZ5C 2XD1A 4QY5A 4WEKA 1ES4A 1CI9A 1YLJA 4EQIA 1K6RA 3ZG5A 4S2JA 5GHZA 4CPKA 4GD6A 4QJGA 2VGKA 5CHJA 4S2OA 1PW8A 3TG9A 5KSCA 5FAQA 3HLCA 2ZJ9A 1I5QA 2EXBA 3IQAA 1PWCA 1E3UD 3PBSA 5DTSA 2Y2LA 2Q9MA 1XX2A 2XFTA 3W8KA 4KZ5A 3PBOA 3FKWA 2XDMA 2XH9A 2ZQDA 3GV9A 4L0LA 4MBHA 4DDSA 4P0MA 3OPRA 4P6BA 1JTDA 1MWRA 1NJ4A 3OPPA 4OPQA 4KENB 4WMCD 3VSLA 4ZDXA 1EWZA 4BJPA 4GN2A 1NYMA 1K57A 3HLEA 1KVLA 3FYZA 2WAEA 2WZZA 5M18A 5KZHA 4C6YA 4OQ0A 1NXYA 5A91A 4EBNA 5GLBA 2EXAA 4OH0A 3AGFA 1ERMA 3NBLA 4YINA 4RA7A 2X01A 1K56A 2Y2JA 4BL2A 3EQVA 1FR1A 3MBZA 1L0DA 1XPBA 3GSGA 3WS2A 2Y2GA 2Y2PA 3E2LA 3HUMA 2Y2KA 1GHIA 5AQ7A 5EPHA 1BLCA 3BFGA 3LY3A 5DF9A 2X02A 1EI5A 4DE1A 5F83A 3GR2A 1BSGA 4EBLA 3C7VA 1K54C 3BM6A 5JYPA 2WKHA 2BG1A 3CG5A 5EOOA 2H0TA 3CMZA 4E3LA 3LO7A 2HPBA 1KVMA 3BLMA 4HEFA 5DTTA 4KZ6A 1L0GA 5I94A 4E6WA 2WGIA 4Y0OA 2A49A 2WKEA 3UPNA 4LCMA 2HDQA 2HP5A 2J7VA 3A3IA 3V3RA 3PBQA 3TOIA 2J9OA 1GHPA 4DE3A 2EX8A 4OPYA 2V2FF 1TDLA 2WGWB 5EE8A 1ERQA 1AXBA 1LLBA 1YMSA 1RP5A 3SH7A 3ZCZA 2H0YA 2XF3A 3HL9A 5HAIA 4IBRA 4S2KA 3ZG0A 3CJMA 5BOHA 1MXOA 4X68A 5CTNA 3ITAA 4LV3A 4A5RA 5GLAA 4MBKA 4KG5A 4OPRA 3G34A 4N1HA 3GQZA 5F82A 3HUNA 4OOLA 3ZG8B 1K55C 3OC2A 2ZM8A 4ZAMA 1XKZA 2JC7A 3G32A 1IYPA 4EV4A 1IYOA 2Y91A 4OP8A 4RX3A 2WADA 2XR0A 4OLGA 5FI6A 3PAGA 2EFXA 3Q82A 5A92A 4MBFA 2ZC4B 4RYEA 1ESUA 3NDEA 1HZOA 2JCHA 1DJAA 3HREA 4XXRA 4JXVA 2ZM0A 4R4SA 1ES2A 3GVBA 5TR7A 1N9BA 2WUQA 2ZM2A 3WWXA 4Y0UA 2P9VA 5AQBA 4KQRA 1CEFA 2HP6A 3BFFA 2OLVA 1FR6A 5M19A 3LCEA 1YLYA 3WS1A 2GDNA 1WE4A 3IF6A 1BUEA 3ZG9B 4QB8A 2WYXA 4NK3A 4DRTA 3HLGA 1NYYA 3BRMA 3MZEA 2OLUA 4QD4A 1IKGA 4PM9A 4S2NC 5FQQA 4C75A 1IELA 2Y2MA 3JYIA 3UDIA 2Y2IA 1W5DA 1M40A 5GHYA 1QMEA 4IBXA 4WYYA 3VOYA 5AQ9A 1Q2PA 3PBTA 3A3DA 3MXSA 1XP4A 2G2UA 1ONHA 4IVKA 5GLDA 2XK1A 4R1GA 3OPHA 3N6IA 2JE5A 1CI8A 4UA7A 5A93A 4KQOA 1K6SA 3GTCA 5HFOA 5HW3A 5GLCA 3BYDA 3I7JA 4HBTA 3IXHA 4R0QA 3VFFA 1PW1A 2ZQ7A 3W4PA 2ZC5B 3N7WA 4X56A 1IYSA 2RCXA 1XXMA 1BTLA 3V5MA 1BZAA 1L0FA 3Q1FA 3N8RA 3UE1A 1ZG4A 4UA9A 1NZUA 1E3UA 4KZ3A 3C7UA 5KMWA 1FQGA 5GL9A 4KZAA 2RL3A 2UWXA 5CHMA 2R9WA 4EUZA 1I2SA 4P87A 3BFDA 3ZVWA 1ES5A 1XGIA 3NCKA 4WMCA 3DWKA 4JF5A 1ZC2A 3Q7VA 1WYCA 1G6AA 1MWSA 5E2GA 1YM1A 3IWQA 4WZ4A 3DTMA 2C5WB 3BLSA 4R3BA 2Y55A 3BFCA 4JXGA 1ESIA 2Y2OA 3G35A 5EVIC 1JWVA 5TGFA 1LL5A 2XD5A 1C3BA 1U60A 4KZ7A 4OOMA 2WAFA 1YLZA 3GMWA 3O87A 2ZC7A 4KZBA 3VP1A 4PM5A 4OONA 4BQMA 4PM7A 1BT5A 3IHAA 4K0XA 1L2SA 3FWLA 4D2OA 1K4EA 2J8YA 3IWOA 4KQQA 3M2JA 4ZTKA 1K4FA 2VGJA 1H8ZA 3LY4A 1IKIA 1I2WA 1Z6FA 3B3XA 3O86A 5FQMA 3SOIA 4PMAA 4DE0A 1K25A 2V20A 1CK3A 4BLMA 4XUXA 5EVLA 4P85A 1BULA 2WGVA 4ZJ2A 5EECA 5CXWA 1O07A 5A90A 4JXWA 3WRZA 1PZPA 4WZ5A 5FASA 4WELA 4B4ZA 1MPLA 4JKTA 4UA6A 1Q2QA 1LI9A 5CERA 3E2KA 3VP4A 3A3JA 3NI9A 4N1XA 4QU3A 3UE3A 3FZCA 3A3FA 4E3JA 4GDBA 4OQGA 1XA1A 1ZG6A 4XUZA 3ZG7B 1YMXA 5FI7A 5F1FA 4MLLA 5FAPA 4E3IA 4LV2A 5DVAA 2A3UA 3N8SA 5FQKA 3G31A 3S22A 4GDNA 3VP2A 1H8YA 4LENA 4PPRA 4QY6A 4DXCA 3WS5A 4Q8IA 4GB7A 2P74A 4ZJ1A 2XEPA 4BL3A 3PBRA 4EBPA 2ZMAA 3MFDA 1KE0A 4OKPA 3SS3A 1KDSA 1TVFA 4GZBA 3HUOA 4Y0TA 1S0WA 5FATA 3Q81A 4WBGA 4OLDA 3ITBA 5FA7A 2ZQ8A 1YQSA 1GA9A 1KGGA 5EVID 3V50A 3VOZA 1PI5A 4GD8A 1KDWA 1W79A 2XQZA 2PU2A 2ZC6B 2R9XA 2EX9A 5FQJA 1VQQA 4RVAA 4U3TA 4CJNA 4E3KA 4E6XA 2HP9A 2JBFA 1KE3A 4OQIA 4F94A 1N4OA 1RGZA 1PIOA 1MWUA 3W4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SH9 A;  4ZJ3 A;  2H5S A;  3C4O A;  1ALQ A;  5J8X A;  2FFY A;  5EVI B;  1FCN A;  3IT9 A;  4BEN A;  5G18 A;  1SHV A;  3HLF A;  4JLF A;  3QNB A;  3W4Q A;  5FSR A;  4PM6 A;  5IHV A;  1K57 C;  1SDE A;  5JYO A;  2IWC A;  3D4F A;  4FSF A;  1G68 A;  4KZ8 A;  2B5R A;  3SS5 A;  4JF4 A;  3M2K A;  3G2Z A;  2HDU A;  1DJC A;  1FSW A;  1FCO A;  1ONG A;  3BEC A;  2IWB A;  4JBF A;  3ISG A;  1HTZ A;  2DRW A;  2QPN A;  3UPP A;  4LV0 A;  3UY6 A;  1VM1 A;  4DF6 A;  1FCM A;  1L0E A;  3IXD A;  1PWD A;  2DNS A;  3GRJ A;  4UAA A;  3UDF A;  1XGJ A;  4C3Q A;  4RX2 A;  3O3V A;  1IEM A;  3ZDJ A;  3UPO A;  2P9V B;  5CGS A;  4UHU A;  1W7F A;  4DE2 A;  1YLT A;  4HES A;  5CED A;  2Y59 A;  2ZQ9 A;  5DTK A;  3RXW A;  4N9K A;  4S2L A;  3IF6 B;  3VFH A;  1SDN A;  3ZFZ A;  1K55 A;  1H5X A;  2I72 A;  4WM9 A;  2ZD8 A;  1K38 A;  4HBU A;  4FH4 A;  4E3O A;  4FD8 A;  1J9M A;  1LI0 A;  1BLH A;  4KG2 A;  4PM8 A;  3NY4 A;  3EQU A;  5M1A A;  3PBN A;  4LV1 A;  3TSG A;  1KE4 A;  2Y4A A;  4K91 A;  1BLS A;  5HAQ A;  3UDX A;  5KSH A;  1JVJ A;  4OPZ A;  2Y2Q A;  3A3E A;  3BEB A;  1W8Q A;  1YLW A;  1PWG A;  3ZHH A;  3LEZ A;  5HAP A;  3C4P A;  1WYB A;  1E25 A;  2HDS A;  1NRF A;  4O7D A;  4GOG A;  2V1Z A;  1HD8 A;  4LCL A;  2CC1 A;  2WK0 A;  3RXX A;  4S2N A;  2HDR A;  4GKU A;  5GHX A;  1RGY A;  5CEC A;  5FI2 A;  2WKI A;  5FQI A;  1XA7 A;  2PBY A;  3IXB A;  2H10 A;  1HVB A;  2DCF A;  2Z2L B;  1O7E A;  3IHB A;  3MXR A;  4QHC A;  2Y2H A;  3C5A A;  4IED A;  2EX6 A;  3NC8 A;  1K56 D;  3S1Y A;  4B88 A;  2EFU A;  2WGW A;  3V3S A;  4DDY A;  4H8R A;  1IYQ A;  4X53 A;  3V39 A;  3G4P A;  3HVF A;  4K0W A;  5HAR A;  4GNU A;  3Q7V B;  3PTE A;  5DF7 A;  4YFM A;  3ZNY A;  3MZF A;  3FKV A;  3WS4 A;  4FCF A;  3VMA A;  4Y7P A;  4OOY A;  1E4D A;  1JTG A;  3IF6 C;  3OCN A;  4IVI A;  1QMF A;  1S6R A;  2QMI A;  3UE0 A;  3ZGA B;  2XFS A;  3AGE A;  1LL9 A;  5EUA A;  3P98 A;  5CTM A;  4ZBE A;  1TDG A;  4DKI A;  5E2H A;  3IF5 A;  2IWD A;  2XGN A;  3AGD A;  3UN7 A;  4ID4 A;  1YLP A;  4R23 A;  3RJU A;  5CEB A;  4S2M A;  2E8I A;  3CZD A;  4X6T A;  4MNR A;  5E43 A;  4KG6 A;  3M6B A;  1OME A;  1RCJ A;  2XLN A;  2ZQC A;  3MZD A;  4U0X A;  4FH2 A;  3SS4 A;  3ZNT A;  4BD1 A;  5CRF A;  1PYY A;  1GCE A;  4KZ9 A;  1NY0 A;  1MBL A;  1TEM A;  3G30 A;  4B4X A;  3FV7 A;  2G2W A;  1BLP A;  3IH8 A;  3UNW A;  4S2P A;  1W8Y A;  4M3K A;  1JWZ A;  5EVI A;  3IXG A;  3HLD A;  3OCL A;  4OP5 A;  5F1G A;  4X55 A;  3HLW A;  3PAE A;  2Z2M B;  4MEZ A;  2OSU A;  4KZ4 A;  1ZKJ A;  3VP0 A;  5AQA A;  5CGX A;  5L2F A;  2C6W B;  1KGF A;  3NDG A;  5EOE A;  4EWF A;  4R4R A;  2ZLY A;  3Q7Z A;  1LHY A;  3NIA A;  2QZ6 A;  1DY6 A;  1K54 A;  3G2Y A;  3SH8 A;  3HLB A;  2FFF B;  1CEG A;  4JPM A;  3MKE A;  3QHY A;  4OQH A;  3VP3 A;  3QNC A;  4E3N A;  1DJB A;  1YT4 A;  3IWI A;  3O88 A;  1PZO A;  4N92 A;  4S2I A;  4Z9Q A;  1M6K A;  4WEJ A;  2Q9N A;  1MY8 A;  5CGW A;  5TFQ A;  3BFE A;  4DXB A;  4X69 A;  2BLS A;  1KGE A;  3DWZ A;  1ERO A;  1SCW A;  1FSY A;  4OVD A;  1PI4 A;  2PU4 A;  4JXS A;  1Y54 A;  5FDH A;  3VSK A;  3S4X A;  4E3M A;  1ES3 A;  1JWP A;  4JF6 A;  3WRT A;  2J9P A;  2ZC3 B;  1MWT A;  3DW0 A;  3HBR A;  1SKF A;  1MKI A;  4NET A;  2OV5 A;  3N8L A;  4U0T A;  5HX9 A;  3OPL A;  1FOF A;  3UO9 A;  1NZO A;  2WZX A;  5CHU A;  5E2E A;  4BD0 A;  3MKF A;  3IH9 A;  3WS0 A;  3OZH A;  4R3J A;  2Y2N A;  5HL1 A;  5FQ9 A;  1GA0 A;  2ZQA A;  1GHM A;  3N4I A;  4N9L A;  5E2F A;  2X71 A;  3P09 A;  3M6H A;  3ZVT A;  5DF8 A;  5U47 A;  3Q07 A;  2EX2 A;  5FAO A;  5D3O A;  4WZ5 C;  2XD1 A;  4QY5 A;  4WEK A;  1ES4 A;  1CI9 A;  1YLJ A;  4EQI A;  1K6R A;  3ZG5 A;  4S2J A;  5GHZ A;  4CPK A;  4GD6 A;  4QJG A;  2VGK A;  5CHJ A;  4S2O A;  1PW8 A;  3TG9 A;  5KSC A;  5FAQ A;  3HLC A;  2ZJ9 A;  1I5Q A;  2EXB A;  3IQA A;  1PWC A;  1E3U D;  3PBS A;  5DTS A;  2Y2L A;  2Q9M A;  1XX2 A;  2XFT A;  3W8K A;  4KZ5 A;  3PBO A;  3FKW A;  2XDM A;  2XH9 A;  2ZQD A;  3GV9 A;  4L0L A;  4MBH A;  4DDS A;  4P0M A;  3OPR A;  4P6B A;  1JTD A;  1MWR A;  1NJ4 A;  3OPP A;  4OPQ A;  4KEN B;  4WMC D;  3VSL A;  4ZDX A;  1EWZ A;  4BJP A;  4GN2 A;  1NYM A;  1K57 A;  3HLE A;  1KVL A;  3FYZ A;  2WAE A;  2WZZ A;  5M18 A;  5KZH A;  4C6Y A;  4OQ0 A;  1NXY A;  5A91 A;  4EBN A;  5GLB A;  2EXA A;  4OH0 A;  3AGF A;  1ERM A;  3NBL A;  4YIN A;  4RA7 A;  2X01 A;  1K56 A;  2Y2J A;  4BL2 A;  3EQV A;  1FR1 A;  3MBZ A;  1L0D A;  1XPB A;  3GSG A;  3WS2 A;  2Y2G A;  2Y2P A;  3E2L A;  3HUM A;  2Y2K A;  1GHI A;  5AQ7 A;  5EPH A;  1BLC A;  3BFG A;  3LY3 A;  5DF9 A;  2X02 A;  1EI5 A;  4DE1 A;  5F83 A;  3GR2 A;  1BSG A;  4EBL A;  3C7V A;  1K54 C;  3BM6 A;  5JYP A;  2WKH A;  2BG1 A;  3CG5 A;  5EOO A;  2H0T A;  3CMZ A;  4E3L A;  3LO7 A;  2HPB A;  1KVM A;  3BLM A;  4HEF A;  5DTT A;  4KZ6 A;  1L0G A;  5I94 A;  4E6W A;  2WGI A;  4Y0O A;  2A49 A;  2WKE A;  3UPN A;  4LCM A;  2HDQ A;  2HP5 A;  2J7V A;  3A3I A;  3V3R A;  3PBQ A;  3TOI A;  2J9O A;  1GHP A;  4DE3 A;  2EX8 A;  4OPY A;  2V2F F;  1TDL A;  2WGW B;  5EE8 A;  1ERQ A;  1AXB A;  1LLB A;  1YMS A;  1RP5 A;  3SH7 A;  3ZCZ A;  2H0Y A;  2XF3 A;  3HL9 A;  5HAI A;  4IBR A;  4S2K A;  3ZG0 A;  3CJM A;  5BOH A;  1MXO A;  4X68 A;  5CTN A;  3ITA A;  4LV3 A;  4A5R A;  5GLA A;  4MBK A;  4KG5 A;  4OPR A;  3G34 A;  4N1H A;  3GQZ A;  5F82 A;  3HUN A;  4OOL A;  3ZG8 B;  1K55 C;  3OC2 A;  2ZM8 A;  4ZAM A;  1XKZ A;  2JC7 A;  3G32 A;  1IYP A;  4EV4 A;  1IYO A;  2Y91 A;  4OP8 A;  4RX3 A;  2WAD A;  2XR0 A;  4OLG A;  5FI6 A;  3PAG A;  2EFX A;  3Q82 A;  5A92 A;  4MBF A;  2ZC4 B;  4RYE A;  1ESU A;  3NDE A;  1HZO A;  2JCH A;  1DJA A;  3HRE A;  4XXR A;  4JXV A;  2ZM0 A;  4R4S A;  1ES2 A;  3GVB A;  5TR7 A;  1N9B A;  2WUQ A;  2ZM2 A;  3WWX A;  4Y0U A;  2P9V A;  5AQB A;  4KQR A;  1CEF A;  2HP6 A;  3BFF A;  2OLV A;  1FR6 A;  5M19 A;  3LCE A;  1YLY A;  3WS1 A;  2GDN A;  1WE4 A;  3IF6 A;  1BUE A;  3ZG9 B;  4QB8 A;  2WYX A;  4NK3 A;  4DRT A;  3HLG A;  1NYY A;  3BRM A;  3MZE A;  2OLU A;  4QD4 A;  1IKG A;  4PM9 A;  4S2N C;  5FQQ A;  4C75 A;  1IEL A;  2Y2M A;  3JYI A;  3UDI A;  2Y2I A;  1W5D A;  1M40 A;  5GHY A;  1QME A;  4IBX A;  4WYY A;  3VOY A;  5AQ9 A;  1Q2P A;  3PBT A;  3A3D A;  3MXS A;  1XP4 A;  2G2U A;  1ONH A;  4IVK A;  5GLD A;  2XK1 A;  4R1G A;  3OPH A;  3N6I A;  2JE5 A;  1CI8 A;  4UA7 A;  5A93 A;  4KQO A;  1K6S A;  3GTC A;  5HFO A;  5HW3 A;  5GLC A;  3BYD A;  3I7J A;  4HBT A;  3IXH A;  4R0Q A;  3VFF A;  1PW1 A;  2ZQ7 A;  3W4P A;  2ZC5 B;  3N7W A;  4X56 A;  1IYS A;  2RCX A;  1XXM A;  1BTL A;  3V5M A;  1BZA A;  1L0F A;  3Q1F A;  3N8R A;  3UE1 A;  1ZG4 A;  4UA9 A;  1NZU A;  1E3U A;  4KZ3 A;  3C7U A;  5KMW A;  1FQG A;  5GL9 A;  4KZA A;  2RL3 A;  2UWX A;  5CHM A;  2R9W A;  4EUZ A;  1I2S A;  4P87 A;  3BFD A;  3ZVW A;  1ES5 A;  1XGI A;  3NCK A;  4WMC A;  3DWK A;  4JF5 A;  1ZC2 A;  3Q7V A;  1WYC A;  1G6A A;  1MWS A;  5E2G A;  1YM1 A;  3IWQ A;  4WZ4 A;  3DTM A;  2C5W B;  3BLS A;  4R3B A;  2Y55 A;  3BFC A;  4JXG A;  1ESI A;  2Y2O A;  3G35 A;  5EVI C;  1JWV A;  5TGF A;  1LL5 A;  2XD5 A;  1C3B A;  1U60 A;  4KZ7 A;  4OOM A;  2WAF A;  1YLZ A;  3GMW A;  3O87 A;  2ZC7 A;  4KZB A;  3VP1 A;  4PM5 A;  4OON A;  4BQM A;  4PM7 A;  1BT5 A;  3IHA A;  4K0X A;  1L2S A;  3FWL A;  4D2O A;  1K4E A;  2J8Y A;  3IWO A;  4KQQ A;  3M2J A;  4ZTK A;  1K4F A;  2VGJ A;  1H8Z A;  3LY4 A;  1IKI A;  1I2W A;  1Z6F A;  3B3X A;  3O86 A;  5FQM A;  3SOI A;  4PMA A;  4DE0 A;  1K25 A;  2V20 A;  1CK3 A;  4BLM A;  4XUX A;  5EVL A;  4P85 A;  1BUL A;  2WGV A;  4ZJ2 A;  5EEC A;  5CXW A;  1O07 A;  5A90 A;  4JXW A;  3WRZ A;  1PZP A;  4WZ5 A;  5FAS A;  4WEL A;  4B4Z A;  1MPL A;  4JKT A;  4UA6 A;  1Q2Q A;  1LI9 A;  5CER A;  3E2K A;  3VP4 A;  3A3J A;  3NI9 A;  4N1X A;  4QU3 A;  3UE3 A;  3FZC A;  3A3F A;  4E3J A;  4GDB A;  4OQG A;  1XA1 A;  1ZG6 A;  4XUZ A;  3ZG7 B;  1YMX A;  5FI7 A;  5F1F A;  4MLL A;  5FAP A;  4E3I A;  4LV2 A;  5DVA A;  2A3U A;  3N8S A;  5FQK A;  3G31 A;  3S22 A;  4GDN A;  3VP2 A;  1H8Y A;  4LEN A;  4PPR A;  4QY6 A;  4DXC A;  3WS5 A;  4Q8I A;  4GB7 A;  2P74 A;  4ZJ1 A;  2XEP A;  4BL3 A;  3PBR A;  4EBP A;  2ZMA A;  3MFD A;  1KE0 A;  4OKP A;  3SS3 A;  1KDS A;  1TVF A;  4GZB A;  3HUO A;  4Y0T A;  1S0W A;  5FAT A;  3Q81 A;  4WBG A;  4OLD A;  3ITB A;  5FA7 A;  2ZQ8 A;  1YQS A;  1GA9 A;  1KGG A;  5EVI D;  3V50 A;  3VOZ A;  1PI5 A;  4GD8 A;  1KDW A;  1W79 A;  2XQZ A;  2PU2 A;  2ZC6 B;  2R9X A;  2EX9 A;  5FQJ A;  1VQQ A;  4RVA A;  4U3T A;  4CJN A;  4E3K A;  4E6X A;  2HP9 A;  2JBF A;  1KE3 A;  4OQI A;  4F94 A;  1N4O A;  1RGZ A;  1PIO A;  1MWU A;  3W4O A; 
#chains in the Genus database with same CATH topology
 4ZJ3 A;  5EVI B;  2V9A A;  1FCN A;  3HLF A;  3W4Q A;  5JYO A;  1GSW A;  4K08 A;  4O01 A;  1VEU A;  4EXO A;  2QJ5 A;  4JBF A;  4CLC D;  1HTZ A;  4YNR A;  2QPN A;  1VM1 A;  3MXQ A;  2DNS A;  3GRJ A;  1XGJ A;  2YKH A;  3O3V A;  1IEM A;  3ZDJ A;  3E4O A;  5CGS A;  1Y4O A;  1W7F A;  2Y59 A;  2ZQ9 A;  2V8F A;  2JKF A;  2PYP A;  1LSX A;  4E3O A;  1LI0 A;  1BLH A;  2J3T C;  3IS2 B;  4GJ4 A;  4KG2 A;  4PM8 A;  3NY4 A;  5FEF A;  3ULF A;  5EVE A;  4OPZ A;  5HWT A;  3C4P A;  3EOI A;  2GZA A;  2OWJ A;  3EGD C;  4O7D A;  2XRN A;  3T4K A;  3QP5 A;  4LCL A;  2WK0 A;  3LIF A;  4R38 A;  5EM1 A;  3EWK A;  1T1A A;  3IHB A;  2NUT C;  3MXR A;  4BBU A;  1K56 D;  2WGW A;  1IYQ A;  3G4P A;  4IVI A;  1QMF A;  3ZGA B;  1SKO A;  2W3D A;  5E2H A;  3IF5 A;  3AGD A;  3NOU C;  3UN7 A;  4ID4 A;  1YLP A;  3RJU A;  4GS9 B;  4MNR A;  4KG6 A;  2XLN A;  1PFL A;  4NG2 A;  1JWZ A;  2HJE A;  2JKT I;  4G3V A;  3PAE A;  4LRX C;  2C6W B;  3U4L P;  3NDG A;  4EWF A;  4R4R A;  3Q7Z A;  3NIA A;  4EES A;  1K54 A;  4JPM A;  4OQH A;  4YWZ A;  3QNC A;  1PZO A;  4Z9Q A;  1MY8 A;  5CGW A;  3VE4 A;  2BLS A;  4CLC A;  1ERO A;  1PI4 A;  5L10 A;  5FDH A;  3LIA A;  3S4X A;  2HGV A;  3S7O A;  3UMD A;  1XJ2 A;  1F9I A;  2OV5 A;  3UB7 A;  2L0W A;  3OPL A;  1FOF A;  3IH9 A;  5TBM B;  2A24 A;  1GHM A;  4N9L A;  3HCY A;  3ZVT A;  5U47 A;  2O9C A;  2XA7 S;  4WEK A;  4HJ3 A;  3LR5 A;  3FC7 A;  4EQI A;  3SZT A;  4GD6 A;  2WKR A;  1DRM A;  3GDI A;  1NLZ A;  3F1P A;  5KSC A;  5FAQ A;  3HLC A;  3R4K A;  2EXB A;  2W3E A;  5HDS A;  1XX2 A;  4KUK A;  1FIK A;  2XFT A;  3W8K A;  4L0L A;  4P0M A;  5G4Y A;  1NJ4 A;  3OPP A;  3VSL A;  4ZDX A;  3IBJ A;  1NYM A;  3V67 A;  3FYZ A;  2WZZ A;  1NXY A;  5A91 A;  4EBN A;  3NBL A;  3KO6 A;  4RQ9 A;  3LI8 A;  1K56 A;  3EQV A;  1FR1 A;  3MBZ A;  1L0D A;  2Y2P A;  4G3W A;  3KSF A;  5EPH A;  1BLC A;  2X02 A;  4DE1 A;  1XFQ A;  3GR2 A;  4QPR A;  1BSG A;  4EBL A;  2PHY A;  5JYP A;  3BM6 A;  4P6Z S;  5EOO A;  3LO7 A;  2V1B A;  4KZ6 A;  4BBT A;  2WGI A;  4Y0O A;  2J7V A;  3A3I A;  1T1C A;  4HI4 A;  2J9O A;  1STZ A;  2V2F F;  2IA2 A;  1TDL A;  5EE8 A;  1ERQ A;  1AXB A;  1LLB A;  1EW0 A;  3T4O A;  3CJM A;  2HJ9 C;  4WF0 A;  3ITA A;  4A5R A;  4WLA A;  4OPR A;  2Z6D A;  3GQZ A;  4OOL A;  2Y91 A;  4OLG A;  1F98 A;  2EWW A;  3Q82 A;  5A92 A;  4RYE A;  5L09 A;  1ESU A;  5EV0 A;  3NDE A;  1HZO A;  2JCH A;  4NEE D;  3GVB A;  2WUQ A;  3ICY A;  4KQR A;  2HP6 A;  2KDK A;  5M19 A;  3T4S A;  1WE4 A;  3IF6 A;  1LSV A;  2JKT M;  4NK3 A;  3HLG A;  3MZE A;  2Y2I A;  5C5K A;  3VV4 A;  4IBX A;  4I3J A;  4HHD A;  4EET B;  5GLD A;  2G7U A;  2XK1 A;  3S7P A;  4KQO A;  1K6S A;  3GTC A;  4R0Q A;  2ZQ7 A;  4X56 A;  2RCX A;  1XXM A;  3F1O B;  2ZL1 A;  2PT7 A;  3N8R A;  3UB5 P;  4UA9 A;  1NZU A;  4JGP A;  5J3W A;  1FQG A;  5GL9 A;  3EEH A;  4EUZ A;  3CHW P;  1I2S A;  2ZOH A;  4X1L A;  3UB9 A;  5E2G A;  1OTE A;  2V0U A;  3BFC A;  2PR5 A;  2Y2O A;  2HF6 A;  1JWV A;  1LL5 A;  4KZ7 A;  4LRZ E;  4KZB A;  3O87 A;  3OLO A;  3VP1 A;  3H7W A;  5DKL A;  3IWO A;  4ZTK A;  2LB9 A;  2VGJ A;  1H8Z A;  3KSI A;  1Z6F A;  3O86 A;  1OTA A;  2VJW A;  3A0S A;  4HNB A;  3CPT B;  4ZJ2 A;  5CXW A;  2B95 A;  4X1M A;  3S7N A;  1OTD A;  4WZ5 A;  1MPL A;  4JKT A;  4UA6 A;  1Q2Q A;  4CLC C;  3VP4 A;  1XA1 A;  5FAP A;  3VP2 A;  4GDN A;  5IS1 A;  3KSH A;  4DXC A;  4ZJ1 A;  3MF0 A;  2L1M A;  1KE0 A;  4MN5 A;  5FAT A;  4EEU A;  4OLD A;  1YQS A;  5EVI D;  4EER A;  1KDW A;  2XQZ A;  4M4X A;  3LFV A;  5FQJ A;  2DMW A;  3VE3 A;  4RVA A;  2HP9 A;  2JBF A;  2QJ7 A;  2VV6 A;  4F94 A;  1PIO A;  1S67 L;  2FFY A;  3IT9 A;  3MQQ A;  5G18 A;  4JLF A;  5FSR A;  5MC7 A;  2IWC A;  2HDU A;  3C8C A;  1DJC A;  3T1Q B;  2O0Y A;  1FCO A;  1ONG A;  3ISG A;  2VLG A;  5HD5 A;  1S1Z A;  1FCM A;  2KOI A;  3IXD A;  4UAA A;  2BAS A;  2P9V B;  2VV8 A;  4S2L A;  3VFH A;  1K55 A;  2P04 A;  4HBU A;  4FH4 A;  4FD8 A;  3K3C A;  3LIC A;  2Y4A A;  3UDX A;  5KSH A;  1JVJ A;  4Y3I A;  3BEB A;  3DTE A;  1YLW A;  2PDR A;  3W2Z A;  1HD8 A;  4EEP A;  3RXX A;  3NEC A;  5GHX A;  1XJ4 A;  1BYW A;  5FI2 A;  2WKI A;  5FQI A;  1XA7 A;  2PBY A;  3IXB A;  1HVB A;  2DCF A;  4QHC A;  1O7E A;  3C5A A;  1UGU A;  4X25 A;  3NC8 A;  2A2L A;  3V39 A;  1ZTU A;  3HVF A;  5HAR A;  4YFM A;  3MZF A;  4Y7P A;  4Q0H A;  4HP9 A;  1A0K A;  4GCZ A;  3BQA A;  3IF6 C;  1S6R A;  2XFS A;  3P98 A;  4DN0 A;  4DKI A;  3CUE A;  5F69 A;  2XGN A;  4R23 A;  3LI9 A;  5CEB A;  4S2M A;  4X6T A;  4BBV A;  5E43 A;  5L8M A;  3RFB A;  3M6B A;  1OME A;  3MZD A;  3ZNT A;  4BD1 A;  4FH2 A;  1PYY A;  1NY0 A;  1TEM A;  2G2W A;  1NWZ A;  2I9V A;  1BLP A;  3MQO A;  4S2P A;  2K7S A;  1W8Y A;  5EVI A;  3OCL A;  4OP5 A;  5F1G A;  4X55 A;  4L9G A;  4MEZ A;  4KZ4 A;  4PHT A;  5AQA A;  1UWP X;  1KGF A;  4MN7 A;  5EOE A;  1S1Y A;  1DY6 A;  3SH8 A;  4PKY A;  3HLB A;  3MKE A;  3A0R A;  2ACG A;  3R7W B;  1DJB A;  1YT4 A;  4Q0J A;  2Q9N A;  1VHM A;  5DJU A;  1V9Z A;  5TFQ A;  2VA0 A;  3BFE A;  4DXB A;  3LEQ A;  4BMW A;  3DWZ A;  4OVD A;  4E3M A;  5LBR A;  1JWP A;  4Y2F A;  2J80 A;  2ZC3 B;  4HP4 A;  1MWT A;  3DW0 A;  3HBR A;  5CHU A;  3MKF A;  3WS0 A;  4R3J A;  2X71 A;  5DF8 A;  5D3O A;  4WZ5 C;  4UQI S;  1P9R A;  4O8G A;  1VEU B;  1OJ5 A;  1PRQ A;  2D02 A;  4CPK A;  3H82 A;  4QJG A;  2B02 A;  4KQD A;  1PW8 A;  2MJ6 A;  2ZJ9 A;  1I5Q A;  4IUK A;  3IQA A;  1PWC A;  3PBS A;  5DTS A;  3BJN A;  3GEC A;  4EUV A;  2XRO A;  2V0W A;  4KZ5 A;  2XDM A;  2XH9 A;  2ZQD A;  2FH5 A;  3GV9 A;  4DDS A;  3OPR A;  1JTD A;  1MWR A;  4OPQ A;  3B47 A;  4GN2 A;  3HLE A;  4C6Y A;  1ODV A;  2EXA A;  1ERM A;  2ZOI A;  4RA7 A;  3K2N A;  2JHE A;  4BL2 A;  1XPB A;  3GSG A;  4DJ2 A;  3C38 A;  5DKK A;  1W63 M;  1GHI A;  5I5L A;  2PR6 A;  3BFG A;  3LY3 A;  5HD3 A;  2BG1 A;  3CG5 A;  4E3L A;  4CQH A;  4ARZ A;  1MKM A;  1L0G A;  5I94 A;  2EWV A;  2A49 A;  5K5B A;  2WKE A;  3UPN A;  2Y8H A;  2HDQ A;  3T1R A;  3PBQ A;  1GHP A;  4PKY G;  4NXE A;  4OPY A;  3T4T A;  4HJ4 A;  2WGW B;  1RP5 A;  3ZCZ A;  2H0Y A;  4JGR A;  1LL8 A;  3KSG A;  4X68 A;  5CTN A;  5GLA A;  4KG5 A;  4N1H A;  3F1N A;  1S4S A;  3ZG8 B;  1K55 C;  3KYZ A;  4ZAM A;  4YOF A;  1SKO B;  1IYP A;  4EV4 A;  4OP8 A;  2WAD A;  2XR0 A;  4LFU A;  3CWF A;  4MBF A;  3E4P A;  2VK3 A;  3HRE A;  1DJA A;  4XXR A;  4JXV A;  2ZM0 A;  4R4S A;  1ES2 A;  1OT6 A;  1N9B A;  1LT0 A;  5HWV A;  4Y0U A;  4Q0I A;  1CEF A;  2PBD P;  1TS0 A;  1MC0 A;  3BFF A;  3LCE A;  3WS1 A;  3NOT C;  4IUH A;  2WYX A;  2J3W A;  3BRM A;  1IKG A;  1XJ6 A;  1IEL A;  3E98 A;  4CLC E;  3UDI A;  1W5D A;  5GHY A;  1QME A;  4WYY A;  3VOY A;  5AQ9 A;  1Q2P A;  3A3D A;  3MXS A;  1T1B A;  4O0P A;  1YKD A;  2JE5 A;  5A93 A;  5HFO A;  3IXH A;  1PW1 A;  1LSW A;  3V5M A;  1BZA A;  4CLC B;  3Q1F A;  3UE1 A;  3CUE C;  4KZ3 A;  4DJ3 A;  5CHM A;  2R9W A;  1XGI A;  2A24 B;  2ZMF A;  3Q7V A;  1WYC A;  2VX8 A;  1G6A A;  4AFI A;  1YM1 A;  2YKF A;  4R3B A;  4BWI A;  1ESI A;  5EVI C;  3PR6 A;  1KOU A;  1U60 A;  5G4Z A;  1W63 Q;  3GMW A;  4PM5 A;  4BQM A;  4PM7 A;  1BT5 A;  4K0X A;  3F1P B;  2WKQ A;  1L2S A;  2J8Y A;  3BY9 A;  4KQQ A;  3JPU A;  1VB6 A;  4PMA A;  4DE0 A;  1K25 A;  4BLM A;  2QYB A;  2WGV A;  5EEC A;  1G5U A;  3OOV A;  3WRZ A;  4WEL A;  3K3D A;  3NI9 A;  4QU3 A;  3FG8 A;  3FZC A;  3LR0 A;  4E3J A;  3CI6 A;  4GDB A;  5FI7 A;  5F1F A;  4MLL A;  4LV2 A;  5IT5 A;  2ZMV A;  4WL9 A;  4QY6 A;  1MZU A;  4BL3 A;  2ZMA A;  1IOU A;  1FIL A;  2E8J A;  5EM0 A;  1KDS A;  1TVF A;  4GZB A;  4Y0T A;  3ITB A;  2ZQ8 A;  1GA9 A;  1KGG A;  3V50 A;  3VOZ A;  1L3L A;  4MCW A;  2R9X A;  3UB8 A;  3L9K A;  4HJ6 A;  4E3K A;  4E6X A;  4JGO A;  1D7E A;  4FTX A;  1N9O A;  1N4O A;  1RGZ A;  3SH9 A;  1ALQ A;  1TS6 A;  4BEN A;  5DFY A;  3QNB A;  2ZBB A;  4PM6 A;  3D4F A;  4FSF A;  1G68 A;  2B5R A;  4R70 A;  3SS5 A;  3M2K A;  3G2Z A;  2QKP A;  3BW6 A;  3BQ8 A;  2DRW A;  4ETZ A;  3UPP A;  4LV0 A;  1L0E A;  2M1C A;  1PWD A;  2VEA A;  4FUW A;  5HWW A;  3UPO A;  2JN7 A;  4GHI A;  4UHU A;  2Q0O A;  3QP1 A;  5CED A;  3RXW A;  4N9K A;  1Z09 A;  3IF6 B;  3ZFZ A;  5HZH A;  1H5X A;  4GLQ A;  1YPR A;  1K38 A;  2B18 A;  5CX7 A;  3C2W A;  4KUO A;  5M1A A;  2GJ3 A;  4LV1 A;  3TSG A;  1KE4 A;  1D06 A;  4II7 A;  3IX3 A;  4K91 A;  1VET A;  1DP8 A;  5HAQ A;  3QP6 A;  2Y2Q A;  3A3E A;  3ZHH A;  5HAP A;  3TJZ C;  1WYB A;  3CPT A;  4IHQ A;  1NRF A;  2VGL M;  2V1Z A;  2CC1 A;  4S2N A;  1NRJ A;  2ZL1 B;  1RGY A;  2W27 A;  2P7J A;  2W1T B;  3P01 A;  3NUL A;  3S1Y A;  2EFU A;  4IJG A;  1CF0 A;  4DDY A;  4X53 A;  3FKV A;  4FCF A;  1P97 A;  1E4D A;  1JTG A;  1TS8 A;  2QMI A;  5DJT A;  3AGE A;  5EUA A;  3IX8 A;  4HOI A;  1TDG A;  2JKR I;  1Y28 A;  2IWD A;  3H7W B;  2AVX A;  4L9E A;  5CRF A;  1GCE A;  3G30 A;  1DP6 A;  4ZRR A;  3IH8 A;  4M3K A;  1X0O A;  2Y79 A;  4ME4 A;  3IXG A;  5IU1 A;  3T4J A;  1ZKJ A;  1WA9 A;  1ZHH B;  3LYX A;  2ZLY A;  1H8M A;  2FFF B;  3VP3 A;  3IWI A;  3O88 A;  4N92 A;  4WEJ A;  4X69 A;  1KGE A;  2O9B A;  1FSY A;  2PU4 A;  3VSK A;  3WRT A;  3JVV A;  1SKF A;  1MKI A;  1SZV A;  4NET A;  3N8L A;  4U0T A;  3UO9 A;  1NZO A;  2WZX A;  3OZH A;  2Y2N A;  5HL1 A;  5FQ9 A;  1GA0 A;  3N4I A;  5E2F A;  4F3L A;  3LR3 A;  3P09 A;  3M6H A;  3Q07 A;  5FAO A;  2XD1 A;  2VV7 A;  1ES4 A;  1CI9 A;  1YLJ A;  2W3G A;  3T1X A;  2VGK A;  3DAV A;  5CHJ A;  4S2O A;  2K31 A;  3CIT A;  3CAX A;  2GNX A;  1E3U D;  2Y2L A;  3DTI A;  3PBO A;  4MBH A;  4NXG A;  4P6B A;  4WMC D;  2XSS A;  4XT2 A;  1EWZ A;  1K57 A;  1KVL A;  2WAE A;  1G28 A;  5M18 A;  5KZH A;  4OQ0 A;  5GLB A;  4OH0 A;  4YIN A;  2X01 A;  1J3W A;  4G3K A;  2LB5 A;  2Y2G A;  3E2L A;  5AQ7 A;  2L4R A;  2BTF P;  4H6J A;  5F83 A;  3CLO A;  2WKH A;  3P7N A;  3PHY A;  2H0T A;  3BLM A;  1GSV A;  4E6W A;  1AWI A;  4LCM A;  2HP5 A;  1F2K A;  3V3R A;  4DE3 A;  2EX8 A;  3T4Q A;  2W3H A;  3SH7 A;  1P0Z A;  3HL9 A;  2OAP 1;  5HAI A;  3ZG0 A;  1MXO A;  4LV3 A;  3D3O A;  4MBK A;  5KIZ A;  3G34 A;  5F82 A;  2JKR M;  4HH3 A;  3LIB A;  3G32 A;  1IYO A;  4RX3 A;  2PYR A;  3PAG A;  2EFX A;  2O99 A;  4D60 A;  5TR7 A;  2ZM2 A;  3EEA A;  1JNU A;  2WKP A;  2OLV A;  1FR6 A;  5HDC A;  1P9W A;  4HH2 A;  1YLY A;  1NYY A;  2OLU A;  4S2N C;  4C75 A;  4WN5 A;  3JYI A;  1M40 A;  3IS2 A;  3PBT A;  3NHQ A;  2G2U A;  3OPH A;  3PYP A;  3N6I A;  1CI8 A;  3BYD A;  3I7J A;  3VFF A;  2W1R A;  3B33 A;  3N7W A;  4ETX A;  3MR0 A;  3KX0 X;  1N9N A;  1H0M A;  4LGW A;  5HPF A;  1E3U A;  2CMN A;  3C7U A;  3JVU A;  4KZA A;  2UWX A;  3BFD A;  1T18 A;  4WMC A;  1H3Q A;  4MDZ A;  3DWK A;  1ZC2 A;  2R78 A;  5HL6 A;  3ZYT A;  2NUP C;  3IWQ A;  4WZ4 A;  2C5W B;  5L07 A;  4QWO A;  3NJA A;  4JXG A;  2KX6 A;  2XD5 A;  5F5Y A;  4OOM A;  1YLZ A;  2ZC7 A;  5FEG A;  3H82 B;  4GS9 A;  4PAU A;  3FWL A;  3M2J A;  1K4F A;  3LY4 A;  1I2W A;  5FQM A;  2GX5 A;  4XUX A;  5EVL A;  4P85 A;  1BUL A;  1YSP A;  4DMZ A;  1O07 A;  4JXW A;  4NXB A;  1PZP A;  3PXP A;  3NOP C;  5FDS A;  4EQ1 A;  4B4Z A;  4ESP A;  1ACF A;  3E2K A;  1F5M A;  3ZQ5 A;  1S4R A;  4XUZ A;  4OQG A;  4NXF A;  3IX4 A;  3N8S A;  3G31 A;  3S22 A;  1H8Y A;  2V8C A;  4LEN A;  2XA7 M;  4PPR A;  3WS5 A;  4Q8I A;  4GB7 A;  2XEP A;  2PD7 A;  4OKP A;  1OT9 A;  3SS3 A;  1TF1 A;  3B42 A;  3KYQ A;  3HUO A;  3E4Q A;  1S0W A;  4ARZ B;  4GD8 A;  1W79 A;  3BWL A;  2PU2 A;  2ZC6 B;  3O5Y A;  1YAX A;  2Z6C A;  2EX9 A;  4CJN A;  5TBM A;  2FZ0 A;  4OQI A;  4I39 A;  1MWU A;  3RTY A;  2H5S A;  3C4O A;  5J8X A;  1SHV A;  5J4E A;  2D01 A;  5IHV A;  1K57 C;  1SDE A;  5F6A A;  4KZ8 A;  1N9L A;  4JF4 A;  2HV1 A;  3F1N B;  2K2N A;  1FSW A;  4UEY A;  3BEC A;  5HDD A;  3LUQ A;  2IWB A;  1PNE A;  3C30 A;  3UY6 A;  3TE8 A;  2M7U A;  2M7V A;  4DF6 A;  3UE6 A;  3UDF A;  4C3Q A;  4RX2 A;  4P6Z M;  4EW7 A;  4DE2 A;  1YLT A;  4HES A;  3MS6 A;  3S7Q A;  5DTK A;  1SDN A;  5FL3 A;  4LPZ A;  2I72 A;  2OOL A;  4WM9 A;  2ZD8 A;  5HPI A;  1S66 L;  1J9M A;  4I3A A;  4R6L A;  3EQU A;  4L9F A;  3PBN A;  5EFW A;  1HLU P;  1BLS A;  3SW1 A;  2OAQ 1;  3T12 B;  3UME A;  1W8Q A;  1PWG A;  4LRY C;  3LEZ A;  1UWN X;  5A8B A;  1E25 A;  2HDS A;  4HQA A;  3VOL A;  4GOG A;  2PD8 A;  2HDR A;  4GKU A;  5CEC A;  1OTB A;  1TS7 A;  2H10 A;  2Z2L B;  2Y2H A;  2VKS A;  4IED A;  2EX6 A;  5TJJ A;  4B88 A;  3V3S A;  4H8R A;  4K0W A;  1NLY A;  3Q7V B;  3PTE A;  4GNU A;  5DF7 A;  3ZNY A;  3WS4 A;  1OPX A;  3VMA A;  3QP2 A;  4OOY A;  3OCN A;  3UE0 A;  1LL9 A;  4ZBE A;  3MFX A;  5CTM A;  3IBR A;  2E8I A;  3CZD A;  3DTK A;  1RCJ A;  2ZQC A;  4U0X A;  2J3T D;  3SS4 A;  1XJ3 A;  4KZ9 A;  1MBL A;  4B4X A;  3FV7 A;  1V9Y A;  4GW9 A;  3UNW A;  3HLD A;  3HLW A;  5AJG A;  2Z2M B;  2OSU A;  3VP0 A;  5CGX A;  5L2F A;  1LHY A;  2QZ6 A;  3G2Y A;  4HIA A;  1CEG A;  3QHY A;  4E3N A;  3FPW A;  4S2I A;  1M6K A;  4EU0 A;  3F1O A;  2V1A A;  5HSQ A;  1SCW A;  2OWH A;  2PRF A;  4JXS A;  1Y54 A;  2P08 A;  1ES3 A;  4JF6 A;  4WUJ A;  2J9P A;  3HJI A;  5HX9 A;  1TD5 A;  5E2E A;  4BD0 A;  2ZQA A;  3BY8 A;  2EX2 A;  1K0K A;  4QY5 A;  1K6R A;  3ZG5 A;  4S2J A;  5GHZ A;  3TG9 A;  3T50 A;  2Q9M A;  2W1T A;  3FKW A;  3LGO A;  4MN6 A;  4GHI B;  4KEN B;  4BJP A;  3D72 A;  3TW8 A;  4HY8 A;  3AGF A;  3DBA A;  3QP4 A;  2Y2J A;  3WS2 A;  4Y15 A;  3HUM A;  2Y2K A;  1VET B;  5DF9 A;  1EI5 A;  1D1J A;  4LLO B;  2PAV P;  3C7V A;  1K54 C;  2JKG A;  3CMZ A;  5F68 A;  4Y13 A;  2HPB A;  1KVM A;  3TRC A;  4HEF A;  5DTT A;  1DP9 A;  1CJF A;  2INW A;  3TOI A;  3MMH A;  2VZW A;  1YMS A;  5AVE A;  2XF3 A;  4IBR A;  4S2K A;  5BOH A;  3LR4 A;  2QWS A;  3HUN A;  3OC2 A;  2ZM8 A;  1YSQ A;  1XKZ A;  2JC7 A;  3RH8 B;  4B93 A;  2VGL S;  5FI6 A;  3L7H A;  5DFX A;  2ZC4 B;  2HZ5 A;  1XFN A;  3LIE A;  3WWX A;  2QHK A;  2P9V A;  5AQB A;  4I38 A;  2GDN A;  1BUE A;  3ZG9 B;  4QB8 A;  3T1S A;  3HJK A;  4DRT A;  4QD4 A;  4PM9 A;  5FQQ A;  1T19 A;  2Y2M A;  1OJG A;  3EGX C;  4I5S A;  4R3A A;  1XP4 A;  4IVK A;  1ONH A;  1OTI A;  4R1G A;  3MSH A;  4UA7 A;  5HW3 A;  5GLC A;  4HBT A;  3W4P A;  2ZC5 B;  3KYE A;  1IYS A;  1BTL A;  4Y17 A;  1L0F A;  3UB6 A;  3OBF A;  1ZG4 A;  2KLI A;  3E0Y A;  5KMW A;  4B9O A;  3A0V A;  2W0N A;  2RL3 A;  5AVF A;  4P87 A;  4MMN A;  2W3F A;  3ZVW A;  1ES5 A;  3NCK A;  4JF5 A;  3MQ0 A;  3QP8 A;  4F3L B;  1MWS A;  5J7E A;  3DTM A;  3BLS A;  4FOF A;  3MJQ A;  2Y55 A;  1G6O A;  3G35 A;  3H9W A;  5TGF A;  1C3B A;  2H28 A;  2WAF A;  1GSX A;  4OON A;  4E04 A;  3IHA A;  2UV0 E;  4I3I A;  4D2O A;  1K4E A;  4Y5F A;  1IKI A;  3B3X A;  3SOI A;  2V20 A;  3FPV A;  1CK3 A;  3D9Y A;  4NKP A;  3T4L A;  5A90 A;  5FAS A;  4XT2 B;  1LI9 A;  5CER A;  3A3J A;  4N1X A;  3UE3 A;  3A3F A;  1ZG6 A;  3ZG7 B;  1YMX A;  2EA9 A;  4Z1W A;  4E3I A;  5DVA A;  5FQK A;  2A3U A;  4UQI M;  3R7W A;  4H6J B;  2P74 A;  4EBP A;  1IFQ A;  3PBR A;  3MFD A;  3G6O A;  4JGQ A;  3U2A A;  3Q81 A;  4WBG A;  5FA7 A;  3LID A;  1PI5 A;  2O9A A;  1VQQ A;  4U3T A;  1KE3 A;  1CQA A;  3W4O A; 
#chains in the Genus database with same CATH homology
 3SH9 A;  4ZJ3 A;  2H5S A;  3C4O A;  1ALQ A;  5J8X A;  2FFY A;  5EVI B;  1FCN A;  3IT9 A;  4BEN A;  5G18 A;  1SHV A;  3HLF A;  4JLF A;  3QNB A;  3W4Q A;  5FSR A;  4PM6 A;  5IHV A;  1K57 C;  1SDE A;  5JYO A;  2IWC A;  3D4F A;  4FSF A;  1G68 A;  4KZ8 A;  2B5R A;  3SS5 A;  4JF4 A;  3M2K A;  3G2Z A;  2HDU A;  1DJC A;  1FSW A;  1FCO A;  1ONG A;  3BEC A;  2IWB A;  4JBF A;  3ISG A;  1HTZ A;  2DRW A;  2QPN A;  3UPP A;  4LV0 A;  3UY6 A;  1VM1 A;  4DF6 A;  1FCM A;  1L0E A;  3IXD A;  1PWD A;  2DNS A;  3GRJ A;  4UAA A;  3UDF A;  1XGJ A;  4C3Q A;  4RX2 A;  3O3V A;  1IEM A;  3ZDJ A;  3UPO A;  2P9V B;  5CGS A;  4UHU A;  1W7F A;  4DE2 A;  1YLT A;  4HES A;  5CED A;  2Y59 A;  2ZQ9 A;  5DTK A;  3RXW A;  4N9K A;  4S2L A;  3IF6 B;  3VFH A;  1SDN A;  3ZFZ A;  1K55 A;  1H5X A;  2I72 A;  4WM9 A;  2ZD8 A;  1K38 A;  4HBU A;  4FH4 A;  4E3O A;  4FD8 A;  1J9M A;  1LI0 A;  1BLH A;  4KG2 A;  4PM8 A;  3NY4 A;  3EQU A;  5M1A A;  3PBN A;  4LV1 A;  3TSG A;  1KE4 A;  2Y4A A;  4K91 A;  1BLS A;  5HAQ A;  3UDX A;  5KSH A;  1JVJ A;  4OPZ A;  2Y2Q A;  3A3E A;  3BEB A;  1W8Q A;  1YLW A;  1PWG A;  3ZHH A;  3LEZ A;  5HAP A;  3C4P A;  1WYB A;  1E25 A;  2HDS A;  1NRF A;  4O7D A;  4GOG A;  2V1Z A;  1HD8 A;  4LCL A;  2CC1 A;  2WK0 A;  3RXX A;  4S2N A;  2HDR A;  4GKU A;  5GHX A;  1RGY A;  5CEC A;  5FI2 A;  2WKI A;  5FQI A;  1XA7 A;  2PBY A;  3IXB A;  2H10 A;  1HVB A;  2DCF A;  2Z2L B;  1O7E A;  3IHB A;  3MXR A;  4QHC A;  2Y2H A;  3C5A A;  4IED A;  2EX6 A;  3NC8 A;  1K56 D;  3S1Y A;  4B88 A;  2EFU A;  2WGW A;  3V3S A;  4DDY A;  4H8R A;  1IYQ A;  4X53 A;  3V39 A;  3G4P A;  3HVF A;  4K0W A;  5HAR A;  4GNU A;  3Q7V B;  3PTE A;  5DF7 A;  4YFM A;  3ZNY A;  3MZF A;  3FKV A;  3WS4 A;  4FCF A;  3VMA A;  4Y7P A;  4OOY A;  1E4D A;  1JTG A;  3IF6 C;  3OCN A;  4IVI A;  1QMF A;  1S6R A;  2QMI A;  3UE0 A;  3ZGA B;  2XFS A;  3AGE A;  1LL9 A;  5EUA A;  3P98 A;  5CTM A;  4ZBE A;  1TDG A;  4DKI A;  5E2H A;  3IF5 A;  2IWD A;  2XGN A;  3AGD A;  3UN7 A;  4ID4 A;  1YLP A;  4R23 A;  3RJU A;  5CEB A;  4S2M A;  2E8I A;  3CZD A;  4X6T A;  4MNR A;  5E43 A;  4KG6 A;  3M6B A;  1OME A;  1RCJ A;  2XLN A;  2ZQC A;  3MZD A;  4U0X A;  4FH2 A;  3SS4 A;  3ZNT A;  4BD1 A;  5CRF A;  1PYY A;  1GCE A;  4KZ9 A;  1NY0 A;  1MBL A;  1TEM A;  3G30 A;  4B4X A;  3FV7 A;  2G2W A;  1BLP A;  3IH8 A;  3UNW A;  4S2P A;  1W8Y A;  4M3K A;  1JWZ A;  5EVI A;  3IXG A;  3HLD A;  3OCL A;  4OP5 A;  5F1G A;  4X55 A;  3HLW A;  3PAE A;  2Z2M B;  4MEZ A;  2OSU A;  4KZ4 A;  1ZKJ A;  3VP0 A;  5AQA A;  5CGX A;  5L2F A;  2C6W B;  1KGF A;  3NDG A;  5EOE A;  4EWF A;  4R4R A;  2ZLY A;  3Q7Z A;  1LHY A;  3NIA A;  2QZ6 A;  1DY6 A;  1K54 A;  3G2Y A;  3SH8 A;  3HLB A;  2FFF B;  1CEG A;  4JPM A;  3MKE A;  3QHY A;  4OQH A;  3VP3 A;  3QNC A;  4E3N A;  1DJB A;  1YT4 A;  3IWI A;  3O88 A;  1PZO A;  4N92 A;  4S2I A;  4Z9Q A;  1M6K A;  4WEJ A;  2Q9N A;  1MY8 A;  5CGW A;  5TFQ A;  3BFE A;  4DXB A;  4X69 A;  2BLS A;  1KGE A;  3DWZ A;  1ERO A;  1SCW A;  1FSY A;  4OVD A;  1PI4 A;  2PU4 A;  4JXS A;  1Y54 A;  5FDH A;  3VSK A;  3S4X A;  4E3M A;  1ES3 A;  1JWP A;  4JF6 A;  3WRT A;  2J9P A;  2ZC3 B;  1MWT A;  3DW0 A;  3HBR A;  1SKF A;  1MKI A;  4NET A;  2OV5 A;  3N8L A;  4U0T A;  5HX9 A;  3OPL A;  1FOF A;  3UO9 A;  1NZO A;  2WZX A;  5CHU A;  5E2E A;  4BD0 A;  3MKF A;  3IH9 A;  3WS0 A;  3OZH A;  4R3J A;  2Y2N A;  5HL1 A;  5FQ9 A;  1GA0 A;  2ZQA A;  1GHM A;  3N4I A;  4N9L A;  5E2F A;  2X71 A;  3P09 A;  3M6H A;  3ZVT A;  5DF8 A;  5U47 A;  3Q07 A;  2EX2 A;  5FAO A;  5D3O A;  4WZ5 C;  2XD1 A;  4QY5 A;  4WEK A;  1ES4 A;  1CI9 A;  1YLJ A;  4EQI A;  1K6R A;  3ZG5 A;  4S2J A;  5GHZ A;  4CPK A;  4GD6 A;  4QJG A;  2VGK A;  5CHJ A;  4S2O A;  1PW8 A;  3TG9 A;  5KSC A;  5FAQ A;  3HLC A;  2ZJ9 A;  1I5Q A;  2EXB A;  3IQA A;  1PWC A;  1E3U D;  3PBS A;  5DTS A;  2Y2L A;  2Q9M A;  1XX2 A;  2XFT A;  3W8K A;  4KZ5 A;  3PBO A;  3FKW A;  2XDM A;  2XH9 A;  2ZQD A;  3GV9 A;  4L0L A;  4MBH A;  4DDS A;  4P0M A;  3OPR A;  4P6B A;  1JTD A;  1MWR A;  1NJ4 A;  3OPP A;  4OPQ A;  4KEN B;  4WMC D;  3VSL A;  4ZDX A;  1EWZ A;  4BJP A;  4GN2 A;  1NYM A;  1K57 A;  3HLE A;  1KVL A;  3FYZ A;  2WAE A;  2WZZ A;  5M18 A;  5KZH A;  4C6Y A;  4OQ0 A;  1NXY A;  5A91 A;  4EBN A;  5GLB A;  2EXA A;  4OH0 A;  3AGF A;  1ERM A;  3NBL A;  4YIN A;  4RA7 A;  2X01 A;  1K56 A;  2Y2J A;  4BL2 A;  3EQV A;  1FR1 A;  3MBZ A;  1L0D A;  1XPB A;  3GSG A;  3WS2 A;  2Y2G A;  2Y2P A;  3E2L A;  3HUM A;  2Y2K A;  1GHI A;  5AQ7 A;  5EPH A;  1BLC A;  3BFG A;  3LY3 A;  5DF9 A;  2X02 A;  1EI5 A;  4DE1 A;  5F83 A;  3GR2 A;  1BSG A;  4EBL A;  3C7V A;  1K54 C;  3BM6 A;  5JYP A;  2WKH A;  2BG1 A;  3CG5 A;  5EOO A;  2H0T A;  3CMZ A;  4E3L A;  3LO7 A;  2HPB A;  1KVM A;  3BLM A;  4HEF A;  5DTT A;  4KZ6 A;  1L0G A;  5I94 A;  4E6W A;  2WGI A;  4Y0O A;  2A49 A;  2WKE A;  3UPN A;  4LCM A;  2HDQ A;  2HP5 A;  2J7V A;  3A3I A;  3V3R A;  3PBQ A;  3TOI A;  2J9O A;  1GHP A;  4DE3 A;  2EX8 A;  4OPY A;  2V2F F;  1TDL A;  2WGW B;  5EE8 A;  1ERQ A;  1AXB A;  1LLB A;  1YMS A;  1RP5 A;  3SH7 A;  3ZCZ A;  2H0Y A;  2XF3 A;  3HL9 A;  5HAI A;  4IBR A;  4S2K A;  3ZG0 A;  3CJM A;  5BOH A;  1MXO A;  4X68 A;  5CTN A;  3ITA A;  4LV3 A;  4A5R A;  5GLA A;  4MBK A;  4KG5 A;  4OPR A;  3G34 A;  4N1H A;  3GQZ A;  5F82 A;  3HUN A;  4OOL A;  3ZG8 B;  1K55 C;  3OC2 A;  2ZM8 A;  4ZAM A;  1XKZ A;  2JC7 A;  3G32 A;  1IYP A;  4EV4 A;  1IYO A;  2Y91 A;  4OP8 A;  4RX3 A;  2WAD A;  2XR0 A;  4OLG A;  5FI6 A;  3PAG A;  2EFX A;  3Q82 A;  5A92 A;  4MBF A;  2ZC4 B;  4RYE A;  1ESU A;  3NDE A;  1HZO A;  2JCH A;  1DJA A;  3HRE A;  4XXR A;  4JXV A;  2ZM0 A;  4R4S A;  1ES2 A;  3GVB A;  5TR7 A;  1N9B A;  2WUQ A;  2ZM2 A;  3WWX A;  4Y0U A;  2P9V A;  5AQB A;  4KQR A;  1CEF A;  2HP6 A;  3BFF A;  2OLV A;  1FR6 A;  5M19 A;  3LCE A;  1YLY A;  3WS1 A;  2GDN A;  1WE4 A;  3IF6 A;  1BUE A;  3ZG9 B;  4QB8 A;  2WYX A;  4NK3 A;  4DRT A;  3HLG A;  1NYY A;  3BRM A;  3MZE A;  2OLU A;  4QD4 A;  1IKG A;  4PM9 A;  4S2N C;  5FQQ A;  4C75 A;  1IEL A;  2Y2M A;  3JYI A;  3UDI A;  2Y2I A;  1W5D A;  1M40 A;  5GHY A;  1QME A;  4IBX A;  4WYY A;  3VOY A;  5AQ9 A;  1Q2P A;  3PBT A;  3A3D A;  3MXS A;  1XP4 A;  2G2U A;  1ONH A;  4IVK A;  5GLD A;  2XK1 A;  4R1G A;  3OPH A;  3N6I A;  2JE5 A;  1CI8 A;  4UA7 A;  5A93 A;  4KQO A;  1K6S A;  3GTC A;  5HFO A;  5HW3 A;  5GLC A;  3BYD A;  3I7J A;  4HBT A;  3IXH A;  4R0Q A;  3VFF A;  1PW1 A;  2ZQ7 A;  3W4P A;  2ZC5 B;  3N7W A;  4X56 A;  1IYS A;  2RCX A;  1XXM A;  1BTL A;  3V5M A;  1BZA A;  1L0F A;  3Q1F A;  3N8R A;  3UE1 A;  1ZG4 A;  4UA9 A;  1NZU A;  1E3U A;  4KZ3 A;  3C7U A;  5KMW A;  1FQG A;  5GL9 A;  4KZA A;  2RL3 A;  2UWX A;  5CHM A;  2R9W A;  4EUZ A;  1I2S A;  4P87 A;  3BFD A;  3ZVW A;  1ES5 A;  1XGI A;  3NCK A;  4WMC A;  3DWK A;  4JF5 A;  1ZC2 A;  3Q7V A;  1WYC A;  1G6A A;  1MWS A;  5E2G A;  1YM1 A;  3IWQ A;  4WZ4 A;  3DTM A;  2C5W B;  3BLS A;  4R3B A;  2Y55 A;  3BFC A;  4JXG A;  1ESI A;  2Y2O A;  3G35 A;  5EVI C;  1JWV A;  5TGF A;  1LL5 A;  2XD5 A;  1C3B A;  1U60 A;  4KZ7 A;  4OOM A;  2WAF A;  1YLZ A;  3GMW A;  3O87 A;  2ZC7 A;  4KZB A;  3VP1 A;  4PM5 A;  4OON A;  4BQM A;  4PM7 A;  1BT5 A;  3IHA A;  4K0X A;  1L2S A;  3FWL A;  4D2O A;  1K4E A;  2J8Y A;  3IWO A;  4KQQ A;  3M2J A;  4ZTK A;  1K4F A;  2VGJ A;  1H8Z A;  3LY4 A;  1IKI A;  1I2W A;  1Z6F A;  3B3X A;  3O86 A;  5FQM A;  3SOI A;  4PMA A;  4DE0 A;  1K25 A;  2V20 A;  1CK3 A;  4BLM A;  4XUX A;  5EVL A;  4P85 A;  1BUL A;  2WGV A;  4ZJ2 A;  5EEC A;  5CXW A;  1O07 A;  5A90 A;  4JXW A;  3WRZ A;  1PZP A;  4WZ5 A;  5FAS A;  4WEL A;  4B4Z A;  1MPL A;  4JKT A;  4UA6 A;  1Q2Q A;  1LI9 A;  5CER A;  3E2K A;  3VP4 A;  3A3J A;  3NI9 A;  4N1X A;  4QU3 A;  3UE3 A;  3FZC A;  3A3F A;  4E3J A;  4GDB A;  4OQG A;  1XA1 A;  1ZG6 A;  4XUZ A;  3ZG7 B;  1YMX A;  5FI7 A;  5F1F A;  4MLL A;  5FAP A;  4E3I A;  4LV2 A;  5DVA A;  2A3U A;  3N8S A;  5FQK A;  3G31 A;  3S22 A;  4GDN A;  3VP2 A;  1H8Y A;  4LEN A;  4PPR A;  4QY6 A;  4DXC A;  3WS5 A;  4Q8I A;  4GB7 A;  2P74 A;  4ZJ1 A;  2XEP A;  4BL3 A;  3PBR A;  4EBP A;  2ZMA A;  3MFD A;  1KE0 A;  4OKP A;  3SS3 A;  1KDS A;  1TVF A;  4GZB A;  3HUO A;  4Y0T A;  1S0W A;  5FAT A;  3Q81 A;  4WBG A;  4OLD A;  3ITB A;  5FA7 A;  2ZQ8 A;  1YQS A;  1GA9 A;  1KGG A;  5EVI D;  3V50 A;  3VOZ A;  1PI5 A;  4GD8 A;  1KDW A;  1W79 A;  2XQZ A;  2PU2 A;  2ZC6 B;  2R9X A;  2EX9 A;  5FQJ A;  1VQQ A;  4RVA A;  4U3T A;  4CJN A;  4E3K A;  4E6X A;  2HP9 A;  2JBF A;  1KE3 A;  4OQI A;  4F94 A;  1N4O A;  1RGZ A;  1PIO A;  1MWU A;  3W4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...