3G4PA

Oxa-24 beta-lactamase at ph 7.5
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 79
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g4pA00
5TGFA 1ES3A 3MBZA 1SCWA 3G34A 4KENB 5FI6A 4B88A 3WS4A 5HL1A 1GA9A 2JC7A 1K55A 2EXAA 4MBHA 2WYXA 2A49A 4M3KA 1MWSA 4BL3A 5EVIC 3N4IA 5HX9A 5FASA 5GLAA 3W4OA 5KZHA 2X71A 3V50A 1FCMA 2XEPA 3VMAA 1HD8A 4S2KA 4ZAMA 1TEMA 2GDNA 3S1YA 3UE1A 1BLHA 3OCLA 4BENA 2E8IA 3HUOA 1ZC2A 2HP6A 3V3SA 3M2KA 2Y2OA 4E3MA 4DE0A 3CJMA 2ZLYA 1IKIA 5D3OA 3UPPA 3OPLA 3WS5A 1E4DA 2VGKA 3IF6B 2EX2A 1G6AA 4KZ7A 4RX2A 1K54C 5A93A 3BLMA 3OCNA 1JWVA 2HDRA 5CGSA 3WS1A 3QNCA 3UE0A 1MWTA 3HLGA 3Q7ZA 4F94A 1PW8A 4L0LA 4WBGA 4C75A 2ZC6B 5EECA 3OPHA 3Q07A 3IF6C 3EQUA 2XD1A 1EROA 4JXVA 3BFGA 1XA1A 4XUZA 2PU2A 2BG1A 4WM9A 5AQAA 5FAOA 2WAFA 1K6RA 3FWLA 3G35A 1YMSA 4OOMA 2XH9A 1S0WA 3LY3A 3V3RA 1PWGA 3HBRA 4RVAA 4X69A 4PM5A 4WZ5C 5BOHA 3PTEA 4GKUA 3PBNA 3M2JA 5FQIA 1N4OA 4GD8A 4X6TA 1PW1A 3VOZA 4JF6A 5TR7A 3LCEA 4OPYA 4LV2A 5AQ9A 2Y2NA 1ZKJA 5U47A 4E3IA 2V2FF 4X55A 2C6WB 3LO7A 2EX8A 3FV7A 1KGFA 1EI5A 5DTTA 4WMCA 4Y7PA 4JXWA 5A91A 2Y2LA 1NY0A 1FQGA 1E25A 5CGXA 1GHPA 4FD8A 2ZC3B 4MLLA 1JVJA 1ALQA 3AGDA 3VP4A 1MPLA 3ISGA 3CMZA 4KZ3A 1CI8A 2R9WA 3IWQA 2DNSA 1H5XA 1Q2PA 4R3BA 5M19A 4QHCA 3C7VA 3ZG8B 1TVFA 2IWCA 2UWXA 4R3JA 5EOOA 4DXBA 2HPBA 3A3FA 1IEMA 3BECA 2EFUA 2WKIA 3EQVA 3GRJA 4EQIA 1JWZA 3SH8A 1KE0A 1NRFA 1KGGA 3PBTA 4OKPA 5M18A 3ZG0A 2IWBA 1FCOA 2WGVA 4DDSA 4E3OA 4EBPA 5DTKA 3MKEA 1FOFA 3HLBA 5EUAA 2DRWA 2H10A 5TFQA 4CPKA 3BFDA 2JBFA 2HP9A 3HLCA 4LV1A 3TG9A 4Y0TA 5E2EA 5AQ7A 4MBFA 3UPNA 3W8KA 3C5AA 4P6BA 4Q8IA 1W8YA 2Y2JA 2ZM8A 5EVLA 3G32A 4B4ZA 3SS5A 1M6KA 2OSUA 1L2SA 2EX6A 3BFCA 2DCFA 1FSWA 5AQBA 1SHVA 3IHBA 1GCEA 2XF3A 1Y54A 4KQOA 4UA6A 1XGJA 3HL9A 3N8RA 5CXWA 5FAQA 3MXRA 2XR0A 2J9OA 3IHAA 5E2FA 2PU4A 5A90A 1SKFA 1PI5A 3E2LA 3IXGA 1W7FA 1QMEA 1KVLA 4U3TA 5CTMA 4WEJA 4BQMA 4ZBEA 1KDWA 1K57C 3E2KA 3A3EA 2V20A 5F1FA 4N9LA 2Y91A 2Y2GA 3P09A 1PYYA 4QU3A 4EV4A 3V39A 1KVMA 4UA7A 3Q7VB 1ERMA 1L0DA 2P9VB 1XX2A 3GMWA 1WYCA 5E2GA 5GHXA 3MZEA 5DVAA 3WRTA 3OZHA 2QPNA 1IYPA 5F82A 1IYOA 1K56A 3SH7A 3ZNYA 1H8ZA 3O88A 1O07A 2XLNA 4OQGA 4IEDA 2B5RA 1BZAA 2WKHA 2WAEA 5M1AA 1XXMA 2C5WB 3S4XA 1CK3A 5CECA 3Q1FA 4S2OA 2EX9A 4E3JA 2P74A 4N1HA 1GHIA 5FQJA 4KZ8A 3ZNTA 5KMWA 4LV3A 1YLTA 3Q82A 4XXRA 5CHUA 1O7EA 1RGZA 4KG6A 5FI7A 1KE4A 2EXBA 3HUNA 4D2OA 3I7JA 4FH4A 3FYZA 3IQAA 1K38A 2WADA 1IYSA 1ERQA 4R4SA 3VSLA 3PBRA 3VOYA 1K6SA 2EFXA 3ITBA 3ZHHA 1W5DA 2XGNA 2RCXA 3PAEA 1MWUA 4PM7A 3VP2A 5F1GA 4P0MA 2HP5A 1K56D 1W8QA 1YLJA 4KZ9A 4BJPA 4LCMA 4LV0A 2WGWA 3AGFA 1SDNA 5DF9A 3PBQA 5CTNA 4FSFA 4QD4A 4HBTA 1JTDA 4E3NA 1IKGA 5CEBA 5KSHA 1PWDA 5CHMA 3O87A 2XFTA 4IBRA 4O7DA 1DY6A 4OONA 1MY8A 1XGIA 5FQ9A 2R9XA 4KZAA 1FR6A 1MXOA 1VM1A 4S2IA 1FCNA 4S2NC 1LLBA 3BRMA 4E6XA 2XD5A 4GNUA 4RA7A 4P85A 4UAAA 2H5SA 2Y2QA 3NCKA 3NDGA 4A5RA 3BM6A 2XFSA 2VGJA 4PPRA 1ONHA 4DKIA 1LI0A 2X01A 4LCLA 5EVIA 3W4PA 5JYPA 3G4PA 3O3VA 5FQKA 1JTGA 2ZQDA 4GOGA 4DXCA 2WZZA 4EBLA 1E3UA 1XP4A 3SH9A 3BEBA 2I72A 5HAIA 4MEZA 4X53A 3BLSA 4GZBA 5GLDA 1BLPA 1ESIA 1WE4A 3IH8A 3NDEA 5GLCA 4ZJ3A 2Q9MA 2ZM0A 3UDXA 3VP1A 1K4EA 2Y2KA 2JCHA 2ZC4B 3NIAA 4QB8A 1Z6FA 4JXSA 4WELA 3SS4A 1K54A 1NZOA 1U60A 4RX3A 4P87A 1LHYA 2WZXA 1ES4A 1BTLA 2H0YA 4OQ0A 4B4XA 1ES2A 5FDHA 4BL2A 4DE3A 1QMFA 4DRTA 3RXWA 1KDSA 1WYBA 4PM8A 3ZVWA 4JLFA 1K25A 3UE3A 5KSCA 1IELA 4KG2A 1ESUA 3Q81A 4OQIA 4QJGA 4FCFA 4ID4A 4JPMA 5E2HA 3IF6A 4OVDA 3IT9A 4Y0UA 5DF7A 4JKTA 4S2LA 1MBLA 2ZM2A 3BFFA 5EVID 4YINA 1K55C 3OPRA 1NXYA 2XQZA 1E3UD 5FSRA 3BYDA 1XKZA 2WGIA 3IF5A 4GDBA 1BUEA 5FQMA 1RP5A 1CEGA 4DF6A 4WZ5A 3ZG7B 4RYEA 3OPPA 4OH0A 4KG5A 3N6IA 3HLWA 1HVBA 1I5QA 2V1ZA 3M6HA 4N1XA 4BD0A 5HW3A 1DJBA 4GB7A 4WYYA 3GV9A 3IXHA 2H0TA 3HREA 4BLMA 3NY4A 1TDGA 2ZQ7A 3DW0A 4NK3A 2WUQA 3HUMA 2BLSA 2CC1A 4EUZA 2FFYA 4XUXA 4OOLA 1PZOA 3GTCA 4MBKA 3PAGA 1I2WA 1G68A 3HLDA 3JYIA 4S2MA 5FI2A 3UNWA 4EBNA 2XDMA 1C3BA 4ZJ2A 1TDLA 3G30A 4WZ4A 5FATA 3A3DA 2Z2MB 3LY4A 3WWXA 3RXXA 3C4OA 1MKIA 1HZOA 3DWKA 1PIOA 1RCJA 1S6RA 5A92A 2Y2IA 4E3KA 1YM1A 2Z2LB 4FH2A 4UA9A 1BLSA 2G2WA 3MKFA 1ZG4A 1EWZA 4K0WA 4KZ4A 1L0FA 4KQQA 4QY6A 5CGWA 3ZDJA 2ZMAA 4KZ6A 4IVIA 3WRZA 3ZCZA 4U0TA 1FR1A 2G2UA 2J8YA 1AXBA 3MFDA 3BFEA 1YMXA 2ZQAA 4HEFA 5FQQA 5CRFA 5DF8A 4OP5A 3SOIA 1ZG6A 4NETA 1LI9A 4X68A 1ONGA 4ZTKA 4OQHA 3TSGA 3HVFA 3MXSA 3DTMA 5G18A 3G31A 1M40A 3GR2A 5FAPA 4CJNA 4DDYA 5J8XA 1W79A 4R23A 3IXBA 3UDIA 4E6WA 4K0XA 1HTZA 4R0QA 3VFFA 2XK1A 1NYMA 2JE5A 3PBSA 3QNBA 1GHMA 4S2PA 5EE8A 4JBFA 2ZJ9A 1KGEA 2J9PA 3VFHA 1K57A 4KZBA 1GA0A 4GD6A 5I94A 3OC2A 5DTSA 2HDSA 3N8LA 3ZVTA 4OPQA 3IH9A 1XA7A 3CZDA 4ZDXA 2Y59A 1YLZA 4JF4A 3W4QA 4OPRA 2Y4AA 4GDNA 4OOYA 3GSGA 1JWPA 3CG5A 2PBYA 3ZG5A 3UO9A 1XPBA 4Z9QA 4N9KA 5GHZA 3DWZA 4DE1A 2ZC7A 2X02A 3TOIA 3WS0A 4C6YA 4OP8A 3ZG9B 1YT4A 3P98A 2P9VA 3Q7VA 5EOEA 2IWDA 4WEKA 4HESA 3C4PA 3FKWA 3UDFA 1BLCA 1Q2QA 3A3IA 4U0XA 1OMEA 3VP3A 3O86A 4OPZA 1NYYA 1FSYA 4MNRA 3VP0A 4K91A 5HFOA 4OLGA 3G2ZA 4C3QA 1BT5A 4PM6A 3N7WA 1BSGA 3UN7A 3D4FA 3IXDA 2HDUA 2ZQ8A 4KZ5A 3RJUA 5IHVA 3FZCA 4YFMA 2Y2HA 1VQQA 1LL9A 5L2FA 1RGYA 2ZD8A 3IWIA 4EWFA 5F83A 2Q9NA 5CERA 3UY6A 4PMAA 5HAPA 5CHJA 4ZJ1A 3M6BA 1KE3A 3A3JA 4UHUA 4IBXA 1NJ4A 4R4RA 4DE2A 1LL5A 1DJAA 1I2SA 3HLEA 4GN2A 2ZQ9A 2J7VA 1DJCA 2ZC5B 1J9MA 1CI9A 3ITAA 1N9BA 4R1GA 1L0GA 4S2NA 3NBLA 3FKVA 3NI9A 3WS2A 5E43A 4E3LA 3MZDA 4BD1A 1CEFA 1PI4A 1NZUA 3HLFA 2RL3A 3UPOA 5FA7A 3GVBA 1YQSA 1ES5A 1PWCA 1L0EA 4S2JA 3AGEA 1YLWA 5EPHA 3PBOA 3MZFA 1IYQA 3VSKA 1H8YA 2OLVA 2WGWB 4OLDA 1YLPA 2QZ6A 3G2YA 2FFFB 4IVKA 5JYOA 1YLYA 3V5MA 4WMCD 3ZFZA 5HAQA 2OV5A 5GHYA 3GQZA 1BULA 2QMIA 2HDQA 4HBUA 4N92A 3SS3A 4LENA 5HARA 4PM9A 2A3UA 4JXGA 3N8SA 3IWOA 4X56A 3ZGAB 3QHYA 2Y2PA 4Y0OA 5CEDA 3C7UA 1MWRA 5GLBA 3B3XA 1K4FA 2Y55A 3LEZA 4QY5A 1SDEA 2WK0A 2WKEA 5EVIB 2OLUA 4H8RA 4KQRA 2Y2MA 2ZQCA 1PZPA 5GL9A 4JF5A 3NC8A 3S22A
chains in the Genus database with same CATH superfamily
4Q0JA 5TGFA 1ES3A 4KENB 3G34A 1BYWA 3PXPA 1LL8A 4M3KA 2PBDP 5EVIC 5HX9A 5KZHA 3EWKA 3VMAA 2GDNA 3UE1A 4NEED 1BLHA 3OCLA 2E8IA 3HUOA 3V3SA 2HP6A 3IS2B 3M2KA 3PYPA 4E3MA 4DE0A 3KO6A 1E4DA 3KSGA 4KZ7A 5A93A 1JWVA 3NJAA 2L1MA 1PW8A 4WBGA 4C75A 2PYRA 3Q07A 3IF6C 1EROA 4XUZA 1NLZA 1XJ2A 3FWLA 1YMSA 4OOMA 1PWGA 4GKUA 5TJJA 5AQ9A 2Y2NA 2GZAA 4E3IA 3S7OA 4X55A 1STZA 3FV7A 4Y7PA 4JXWA 2Y2LA 1NY0A 1FQGA 3LR3A 1W63M 4LLOB 4MLLA 3VP4A 3ISGA 1H5XA 1TF1A 2UWXA 4PAUA 1WA9A 2WKIA 3GRJA 3QP2A 1XJ6A 5HPFA 3QP1A 1KE0A 3T1QB 3PBTA 4OKPA 4PKYG 3MKEA 4I38A 2VJWA 1NRJA 5E2EA 3UPNA 3W8KA 4LPZA 3F1OB 1W8YA 2QJ7A 2ZM8A 2PHYA 3T4QA 1M6KA 2OSUA 1L2SA 3BFCA 2B95A 4DN0A 2EWVA 4P6ZM 2DCFA 2V9AA 3O5YA 1SHVA 3IHBA 2XF3A 3N8RA 2KX6A 5CXWA 3K3CA 3HJKA 3MXRA 2XR0A 2J9OA 4QWOA 5EM1A 1QMEA 1LSWA 2INWA 5CTMA 4WEJA 4ZBEA 1K57C 3A3EA 2Y91A 3T4OA 3KYZA 1WYCA 1IYPA 3ZNYA 3O88A 2OWHA 1O07A 4OQGA 2WKHA 2WAEA 5M1AA 1XXMA 1Z09A 2EX9A 2VA0A 4KZ8A 4JGQA 4LV3A 2KDKA 4GCZA 1RGZA 5FI7A 1DP9A 4NG2A 3I7JA 5I5LA 1IYSA 3VSLA 3S7NA 3VOYA 3ITBA 3DTEA 1W5DA 2XGNA 1MWUA 4P0MA 4LGWA 3T4LA 4KZ9A 2ZOHA 2VV6A 3AGFA 5DF9A 3PBQA 4QD4A 4E3NA 3LEQA 5CEBA 5EV0A 1KOUA 4O7DA 4I39A 4EERA 1MY8A 1OT6A 1TS0A 1MXOA 4S2IA 3BRMA 5HDDA 3NDGA 1ONHA 1LI0A 3G4PA 5FEGA 2WZZA 5HSQA 3NHQA 5HAIA 2ZL1B 4X53A 1ESIA 3RFBA 1YPRA 3UDXA 2JCHA 3C30A 4FUWA 1OTEA 1U60A 4RX3A 1BTLA 4B4XA 1ACFA 4DE3A 2VEAA 3UE3A 1IELA 4KG2A 1P9WA 4GHIA 3T4JA 4ID4A 4OVDA 3E4PA 5L07A 2ZM2A 4YINA 5MC7A 2XQZA 5FSRA 3BYDA 1T1BA 1CEGA 3ICYA 2V1ZA 1I5QA 4N1XA 2PT7A 4WYYA 3E0YA 3NY4A 1P0ZA 2CC1A 4EUZA 4XUXA 4HH2A 5CX7A 3LIBA 1S4SA 4MBKA 3GECA 2Z6DA 3H82B 3FPWA 2XDMA 3KX0X 1C3BA 4ZJ2A 3WWXA 3G30A 5FATA 2D02A 3LY4A 1HZOA 2W1RA 3DWKA 2Y2IA 4KQDA 2G2WA 1J3WA 4K0WA 4KUKA 1L0FA 5DFYA 2J8YA 3T50A 2ZOIA 2ZQAA 1XJ4A 5CRFA 3EOIA 4OP5A 1ZG6A 4NETA 4M4XA 5AVEA 3HVFA 5G18A 1W79A 4R23A 3H7WA 3UDIA 4K0XA 3A0VA 1HTZA 3NOUC 2XK1A 4JBFA 4EETB 1KGEA 1TS8A 2IA2A 3CI6A 4DJ2A 1Y28A 4OPQA 1XA7A 3D72A 3W4QA 5HL6A 4GDNA 1JWPA 2PBYA 4QPRA 4Z9QA 4Y3IA 2ZC7A 3LI8A 1TD5A 3WS0A 3ZG9B 3P98A 3Q7VA 4X25A 5EOEA 4U0XA 3HJIA 3O86A 4OPZA 4MNRA 3VP0A 4LRZE 4OLGA 3G2ZA 2PR6A 3K3DA 3CHWP 2W1TB 3UN7A 2ZQ8A 4JGPA 3RJUA 3FZCA 2Y2HA 5L2FA 2ZD8A 4EWFA 5CERA 4CLCB 4WLAA 4PMAA 4ZJ1A 4F3LB 3T4SA 4UHUA 4D60A 2JN7A 2VKSA 1LL5A 1DJAA 1I2SA 3HLEA 2MJ6A 2ZC5B 1H3QA 4S2NA 4H6JB 1Y4OA 3MZDA 1PI4A 3HLFA 4K08A 1YQSA 4BBVA 2XA7M 3MZFA 3LICA 1H8YA 2OLVA 4OLDA 2QZ6A 3G2YA 3ZFZA 1CQAA 2OV5A 4WUJA 1BULA 3IX3A 5IU1A 3V67A 4IJGA 3SS3A 4G3KA 3N8SA 3B33A 2Y55A 2WKEA 5EVIB 2Y2MA 3S22A 3MBZA 1SCWA 4B88A 3WS4A 3BJNA 5HL1A 2JC7A 4BL3A 3T12B 3N4IA 1H0MA 2X71A 1ZTUA 4ARZA 2OWJA 1TEMA 3VV4A 4BENA 3CAXA 2Y2OA 3CJMA 3WS5A 4MN7A 3U4LP 2VGKA 3IF6B 2FH5A 2EX2A 1G6AA 2V0UA 2HDRA 2QHKA 3QNCA 4L9GA 4JGOA 1OTIA 2ZC6B 3EQUA 2XD1A 4JXVA 5AJGA 2M7VA 2BG1A 4WM9A 1CF0A 3G35A 4DMZA 3LY3A 3LR5A 3UMDA 3UE6A 5FQIA 2I9VA 3VOZA 4JF6A 3FPVA 3LCEA 1ZKJA 3CPTA 2V2FF 2VV8A 2W3HA 3TRCA 5A91A 2VV7A 1GHPA 2ZC3B 1DP8A 4GS9B 4KZ3A 3TE8A 3UB8A 1Q2PA 5M19A 4ESPA 2WKQA 3ZG8B 1TVFA 4DXBA 4R3JA 3LUQA 3EQVA 4EQIA 3LIEA 4HP9A 2WGVA 5DTKA 1FOFA 4CPKA 2DRWA 4UQIM 3BY9A 2JBFA 4Y0TA 5AQ7A 3C5AA 4P6BA 4Q8IA 1LSVA 2EX6A 2O9CA 4EW7A 3FC7A 5AQBA 4UA6A 1Y54A 3HL9A 5HZHA 5E2FA 3MF0A 1PI5A 3IBJA 2QWSA 4BQMA 1KDWA 4QU3A 1ERMA 5E2GA 3MZEA 3UB6A 1IYOA 1K56A 1F9IA 1BZAA 2OAP1 1A0KA 3S4XA 1XJ3A 1OTDA 3Q1FA 4E3JA 1YAXA 4N1HA 1GHIA 1F5MA 4ETZA 3K2NA 5CHUA 4Y17A 1KE4A 4FH4A 3C38A 2JKRI 3FYZA 3IQAA 2WADA 2PD8A 1K6SA 3CITA 2P04A 3ZHHA 3EGDC 4Q0HA 4IHQA 1K56D 1YLJA 3T4KA 5DKKA 2W3DA 4WL9A 5KSHA 1PWDA 2XFTA 4IBRA 3F1NA 4OONA 3LIFA 2R9XA 4KZAA 2E8JA 3TW8A 4S2NC 2WKPA 4E6XA 4P85A 2H5SA 2PR5A 3NCKA 4A5RA 4Y13A 3BM6A 4PPRA 2VGJA 4LCLA 3W4PA 5FQKA 4GOGA 1XP4A 5KIZA 2YKHA 2I72A 3BEBA 2VZWA 3EGXC 3BLSA 2Y8HA 1BLPA 4LFUA 3IH8A 5EFWA 5GLCA 3RH8B 3VP1A 1K4EA 3SW1A 2ZC4B 1P9RA 4WELA 1K54A 4AFIA 3NECA 2WZXA 1ES4A 2GX5A 4DRTA 3ZVWA 1OTBA 4OQIA 1CJFA 1NLYA 3Q81A 4G3WA 4Y0UA 2Z6CA 2W3EA 1S1YA 4GJ4A 3OOVA 1NXYA 4GDBA 1BUEA 2EWWA 3ZG7B 4RYEA 3OPPA 1G5UA 4BD0A 5HW3A 3M6HA 4P6ZS 3HREA 1TDGA 4HQAA 2BLSA 2FFYA 5F69A 4I3IA 1G68A 4EBNA 3RXXA 4HIAA 1OJGA 5HWWA 2ZMFA 4NXGA 1PIOA 1RCJA 4E3KA 1YM1A 2Z2LB 1G28A 3KSHA 1ZG4A 2VGLM 3ZDJA 3R7WA 4KZ6A 3ZCZA 4U0TA 2JKGA 1AXBA 3MFDA 4HEFA 4HP4A 4Y5FA 2A24A 3SOIA 1LI9A 1G6OA 1ONGA 4ZTKA 3MXSA 4CJNA 3GR2A 5FAPA 4R0QA 3VFFA 1NYMA 2JE5A 3FG8A 5F5YA 2HV1A 1AWIA 2ZJ9A 3VFHA 1GA0A 4GD6A 5DTSA 3LR4A 2GNXA 4JF4A 4IUKA 4OOYA 3UO9A 1XPBA 1SZVA 3CUEA 2X02A 3UB7A 1D06A 2P9VA 4G3VA 4CQHA 2IWDA 3HCYA 1VEUA 1BLCA 4KUOA 4O0PA 3VP3A 4MN6A 5HWVA 2HJ9C 1FSYA 4K91A 1X0OA 1BT5A 3S7QA 2NUPC 4HHDA 4ZRRA 5G4ZA 2JHEA 3TJZC 2HDUA 4KZ5A 5IHVA 1T1AA 1RGYA 3NOTC 5F83A 3UY6A 1IOUA 5CHJA 3M6BA 3A3JA 5DJTA 1F2KA 4GN2A 2ZQ9A 1J9MA 2B02A 4R1GA 4E3LA 4BD1A 1CEFA 3UPOA 5FA7A 1PWCA 2P08A 4S2JA 3AGEA 2VLGA 5F68A 5EPHA 3PBOA 2WKRA 4BMWA 3BW6A 5DKLA 3R4KA 4BBUA 5JYOA 1YLYA 4WMCD 2K31A 5HAQA 5GHYA 1VETA 2HDQA 3W2ZA 2V8CA 4PM9A 4JXGA 3EEHA 4X56A 3T1RA 3RTYA 5CEDA 3C7UA 3B3XA 3LEZA 4QY5A 3UB9A 3MQQA 2QJ5A 2OLUA 3H9WA 3PHYA 4H8RA 4HJ4A 4KQRA 2ZQCA 5GL9A 4JF5A 3BY8A 5HPIA 5FI6A 5FDSA 2A2LA 1K55A 4XT2A 4LRXC 3W4OA 3V50A 1FCMA 5HDCA 1HD8A 4S2KA 1ZC2A 3IX8A 2R78A 4GHIB 1IKIA 5D3OA 3UPPA 1GSXA 4RX2A 1K54C 3BLMA 1PFLA 1XFNA 4MMNA 3WS1A 3UE0A 4IUHA 4L0LA 4B93A 5EECA 4CLCD 5HD3A 1OJ5A 2WAFA 4Y2FA 2PYPA 3V3RA 4RVAA 4X69A 4PM5A 4FOFA 3PTEA 3PBNA 4GD8A 4X6TA 5TR7A 4OPYA 1YKDA 2C6WB 1EI5A 1E25A 4FD8A 4GLQA 3LFVA 2YKFA 3CMZA 1CI8A 2R9WA 3GDIA 5A8BA 3C7VA 5EOOA 1S67L 1NRFA 1KGGA 4MCWA 2IWBA 1FCOA 4DDSA 4E3OA 4EBPA 3HLBA 2PAVP 2V1BA 4LV1A 3HLCA 3H7WB 3F1PA 4MBFA 3G32A 5TBMA 4B4ZA 2HZ5A 1W63Q 2VK3A 1FSWA 2XA7S 3SZTA 5FAQA 4PKYA 1NWZA 1SKFA 3E2LA 3IXGA 3MQOA 1W7FA 2V20A 3QP4A 4N9LA 4EV4A 2V0WA 3Q7VB 1SKOA 3LYXA 3GMWA 3OBFA 3WRTA 3OZHA 5F82A 1H8ZA 3KYQA 2JKFA 3OLOA 2C5WB 3JPUA 1CK3A 5CECA 3CUEC 5L09A 4HY8A 3S7PA 2ZMVA 4HJ6A 4PHTA 5HDSA 1O7EA 4KG6A 2EXBA 5DJUA 3HUNA 1IFQA 1LT0A 4R4SA 3PBRA 2VX8A 1FILA 4L9EA 3PAEA 2M1CA 3E4QA 5F1GA 2HP5A 2ZBBA 4BJPA 2WGWA 1SDNA 4Z1WA 4HBTA 1JTDA 4E04A 1P97A 1IKGA 5CHMA 2J3WA 4YOFA 1YSPA 1S66L 1MC0A 1VM1A 2ACGA 1FCNA 1LLBA 2XD5A 4GNUA 4RA7A 4UAAA 4DJ3A 4EEPA 2Y2QA 2XFSA 2X01A 2JKRM 5JYPA 2ZQDA 3MXQA 4DXCA 3IBRA 4EBLA 3KSIA 4MEZA 4GZBA 5C5KA 1WE4A 3NDEA 2KOIA 4ZJ3A 1L3LA 2PDRA 2Y2KA 3SS4A 4QB8A 4P87A 2O99A 4OQ0A 5FDHA 1QMFA 3IS2A 1KDSA 4PM8A 2DMWA 3CLOA 1K25A 5E2HA 4UEYA 3DAVA 1UWPX 4NKPA 2HGVA 2L0WA 4ARZB 4R38A 3BFFA 4CLCC 1K55C 1H8MA 3OPRA 4UQIS 1RP5A 4DF6A 5F6AA 4WZ5A 1JNUA 3N6IA 3HLWA 1DJBA 4GB7A 3LR0A 3GV9A 3IXHA 1VB6A 4BLMA 1N9LA 3DW0A 4NK3A 2WUQA 3HUMA 1D7EA 4OOLA 5AVFA 1FIKA 3GTCA 3PAGA 3HLDA 5FI2A 4S2MA 1TDLA 4WZ4A 3QP6A 2QYBA 1BLSA 3CPTB 4EXOA 4L9FA 3MR0A 5CGWA 1D1JA 4IVIA 2J3TD 3C2WA 3NOPC 2G2UA 3A0RA 5FQQA 4GW9A 2PD7A 4X1MA 1LSXA 3TSGA 4OQHA 1MZUA 3DTMA 4R70A 1M40A 4DDYA 3IXBA 4E6WA 3QP5A 4MN5A 3F1OA 1GHMA 5EE8A 1T18A 2J9PA 3ZYTA 4RQ9A 4KZBA 5I94A 3OC2A 2HDSA 3ZVTA 3IH9A 4EU0A 4ZDXA 5J4EA 5J7EA 4OPRA 3CG5A 3ZG5A 2HF6A 3D9YA 4N9KA 3NULA 5GHZA 4DE1A 3PR6A 4C6YA 3VOLA 4O8GA 1YT4A 3UDFA 3A3IA 3DTKA 2M7UA 2H28A 5HFOA 1K0KA 3MFXA 4WF0A 4C3QA 3N7WA 1BSGA 3IXDA 1T1CA 3DBAA 4HOIA 3G6OA 3BQ8A 3IWIA 2Q9NA 3E4OA 5HAPA 3VE4A 5FL3A 4IBXA 4R4RA 4X1LA 4DE2A 1V9ZA 3A0SA 1CI9A 3ZQ5A 3NBLA 3NI9A 5E43A 1S1ZA 2RL3A 2FZ0A 3GVBA 2EA9A 2HJEA 1L0EA 2W27A 1F98A 1IYQA 1YLPA 2P7JA 4IVKA 3V5MA 3GQZA 4HBUA 4N92A 2NUTC 3F1NB 4LENA 2A3UA 3IWOA 3ZGAB 3QP8A 2Y2PA 4BWIA 3BQAA 4Y0OA 2XROA 2ZL1A 1K4FA 1SDEA 5EM0A 1PZPA 3NC8A 2VGLS 4MDZA 1GA9A 2EXAA 4MBHA 1V9YA 2WYXA 2A49A 4I3JA 1MWSA 5FASA 5GLAA 5G4YA 2XEPA 4ZAMA 3S1YA 5DFXA 1OT9A 2UV0E 2ZLYA 3OPLA 2K7SA 3OCNA 4HJ3A 5CGSA 3T1XA 2KLIA 1MWTA 3HLGA 3Q7ZA 4F94A 1TS7A 4R3AA 3OPHA 3D3OA 3BFGA 1XA1A 3H82A 2PU2A 5AQAA 5FAOA 1K6RA 2XH9A 1GSWA 1S0WA 3HBRA 4EUVA 4WZ5C 5BOHA 3M2JA 4BBTA 1N4OA 2LB5A 1PW1A 2J3TC 4LV2A 5U47A 3LO7A 2EX8A 2D01A 1KGFA 1YSQA 5DTTA 1N9OA 4WMCA 2PRFA 5CGXA 3DTIA 1JVJA 1ALQA 3AGDA 3MS6A 3UMEA 1MPLA 3IWQA 2DNSA 5HWTA 4R3BA 4QHCA 2IWCA 3R7WB 2O9AA 2HPBA 3A3FA 1IEMA 3BECA 2EFUA 4EEUA 1JWZA 3SH8A 3T4TA 2A24B 5M18A 3ZG0A 3MQ0A 5EUAA 2H10A 5TFQA 3BFDA 2HP9A 3TG9A 3KYEA 3LI9A 3T1SA 2Y2JA 5EVLA 3SS5A 2Q0OA 3P7NA 4KQOA 1GCEA 1XGJA 3IHAA 2PU4A 5A90A 3MSHA 2W0NA 1KVLA 4U3TA 3E2KA 5F1FA 2Y2GA 3P09A 1PYYA 4JGRA 3V39A 1KVMA 4HH3A 4UA7A 2P9VB 1L0DA 5GHXA 1XX2A 2W1TA 5DVAA 2QPNA 1VEUB 3SH7A 4ETXA 2XLNA 4IEDA 2B5RA 5L10A 4CLCA 4S2OA 2P74A 4F3LA 5FQJA 3ZNTA 1HLUP 5KMWA 1YLTA 3Q82A 4XXRA 3LIAA 4D2OA 2O0YA 4Q0IA 1K38A 4H6JA 1DRMA 1ERQA 2EFXA 1MKMA 2RCXA 4PM7A 3VP2A 1W8QA 2W3FA 4LCMA 4LV0A 5CTNA 4FSFA 3O87A 1DY6A 4II7A 1UWNX 1XGIA 5FQ9A 2BASA 1FR6A 4O01A 2JKTM 2J80A 4I3AA 2Y79A 1VETB 4YWZA 4DKIA 3L7HA 5EVIA 3O3VA 1JTGA 4CLCE 1E3UA 3SH9A 5GLDA 2V8FA 2Q9MA 2ZM0A 3NIAA 1Z6FA 4JXSA 1NZOA 1LHYA 2H0YA 3MJQA 1ES2A 4BL2A 3RXWA 1WYBA 4JLFA 4XT2B 5KSCA 1ESUA 2GJ3A 4QJGA 4FCFA 4YNRA 4JPMA 3IF6A 3IT9A 5DF7A 4JKTA 3LIDA 4S2LA 5EVEA 1MBLA 5EVID 4HNBA 3EEAA 1E3UD 4B9OA 1XKZA 2WGIA 3IF5A 5FQMA 3LGOA 4OH0A 2AVXA 4KG5A 1HVBA 2K2NA 2OOLA 3CWFA 2H0TA 2ZQ7A 1XFQA 1S4RA 1OTAA 1PZOA 3B47A 1I2WA 3JYIA 3UNWA 3ULFA 4HI4A 3A3DA 2Z2MB 3C4OA 2BTFP 4EESA 1MKIA 5HD5A 1S6RA 5A92A 3MMHA 4GS9A 4FH2A 4UA9A 2JKTI 4NXFA 3MKFA 4I5SA 5L8MA 3E98A 1EWZA 4KZ4A 4KQQA 4QY6A 2XRNA 2ZMAA 3WRZA 1FR1A 1EW0A 3B42A 2QKPA 3BWLA 3BFEA 1YMXA 5DF8A 4NXEA 5FEFA 4X68A 3JVVA 5J8XA 3G31A 2O9BA 4Y15A 3IX4A 3U2AA 5J3WA 1TS6A 3PBSA 4S2PA 3QNBA 1K57A 1OPXA 2B18A 5K5BA 4ME4A 3N8LA 3CZDA 3F1PB 2Y59A 1YLZA 2Y4AA 3GSGA 5TBMB 3L9KA 2LB9A 4WN5A 3DWZA 3TOIA 4OP8A 1VHMA 4LRYC 4WEKA 4HESA 3C4PA 3FKWA 1Q2QA 1OMEA 1NYYA 1N9NA 5IT5A 4PM6A 1SKOB 3D4FA 2G7UA 3C8CA 4YFMA 1VQQA 1LL9A 1GSVA 2XSSA 1UGUA 1KE3A 1PRQA 1NJ4A 1PNEA 1ODVA 4EQ1A 2J7VA 1DJCA 3ITAA 1N9BA 2OAQ1 3KSFA 1L0GA 3FKVA 3WS2A 1NZUA 5LBRA 1T19A 1ES5A 3UB5P 1YLWA 2V1AA 3VSKA 2WGWB 2L4RA 4NXBA 2FFFB 4R6LA 2QMIA 5IS1A 5HARA 3VE3A 1ZHHB 3QHYA 3P01A 1MWRA 5GLBA 4FTXA 3JVUA 2WK0A 2CMNA 1DP6A 2W3GA
chains in the Genus database with same CATH topology
5TGFA 1ES3A 3MBZA 1SCWA 3G34A 4KENB 5FI6A 4B88A 3WS4A 5HL1A 1GA9A 2JC7A 1K55A 2EXAA 4MBHA 2WYXA 2A49A 4M3KA 1MWSA 4BL3A 5EVIC 3N4IA 5HX9A 5FASA 5GLAA 3W4OA 5KZHA 2X71A 3V50A 1FCMA 2XEPA 3VMAA 1HD8A 4S2KA 4ZAMA 1TEMA 2GDNA 3S1YA 3UE1A 1BLHA 3OCLA 4BENA 2E8IA 3HUOA 1ZC2A 2HP6A 3V3SA 3M2KA 2Y2OA 4E3MA 4DE0A 3CJMA 2ZLYA 1IKIA 5D3OA 3UPPA 3OPLA 3WS5A 1E4DA 2VGKA 3IF6B 2EX2A 1G6AA 4KZ7A 4RX2A 1K54C 5A93A 3BLMA 3OCNA 1JWVA 2HDRA 5CGSA 3WS1A 3QNCA 3UE0A 1MWTA 3HLGA 3Q7ZA 4F94A 1PW8A 4L0LA 4WBGA 4C75A 2ZC6B 5EECA 3OPHA 3Q07A 3IF6C 3EQUA 2XD1A 1EROA 4JXVA 3BFGA 1XA1A 4XUZA 2PU2A 2BG1A 4WM9A 5AQAA 5FAOA 2WAFA 1K6RA 3FWLA 3G35A 1YMSA 4OOMA 2XH9A 1S0WA 3LY3A 3V3RA 1PWGA 3HBRA 4RVAA 4X69A 4PM5A 4WZ5C 5BOHA 3PTEA 4GKUA 3PBNA 3M2JA 5FQIA 1N4OA 4GD8A 4X6TA 1PW1A 3VOZA 4JF6A 5TR7A 3LCEA 4OPYA 4LV2A 5AQ9A 2Y2NA 1ZKJA 5U47A 4E3IA 2V2FF 4X55A 2C6WB 3LO7A 2EX8A 3FV7A 1KGFA 1EI5A 5DTTA 4WMCA 4Y7PA 4JXWA 5A91A 2Y2LA 1NY0A 1FQGA 1E25A 5CGXA 1GHPA 4FD8A 2ZC3B 4MLLA 1JVJA 1ALQA 3AGDA 3VP4A 1MPLA 3ISGA 3CMZA 4KZ3A 1CI8A 2R9WA 3IWQA 2DNSA 1H5XA 1Q2PA 4R3BA 5M19A 4QHCA 3C7VA 3ZG8B 1TVFA 2IWCA 2UWXA 4R3JA 5EOOA 4DXBA 2HPBA 3A3FA 1IEMA 3BECA 2EFUA 2WKIA 3EQVA 3GRJA 4EQIA 1JWZA 3SH8A 1KE0A 1NRFA 1KGGA 3PBTA 4OKPA 5M18A 3ZG0A 2IWBA 1FCOA 2WGVA 4DDSA 4E3OA 4EBPA 5DTKA 3MKEA 1FOFA 3HLBA 5EUAA 2DRWA 2H10A 5TFQA 4CPKA 3BFDA 2JBFA 2HP9A 3HLCA 4LV1A 3TG9A 4Y0TA 5E2EA 5AQ7A 4MBFA 3UPNA 3W8KA 3C5AA 4P6BA 4Q8IA 1W8YA 2Y2JA 2ZM8A 5EVLA 3G32A 4B4ZA 3SS5A 1M6KA 2OSUA 1L2SA 2EX6A 3BFCA 2DCFA 1FSWA 5AQBA 1SHVA 3IHBA 1GCEA 2XF3A 1Y54A 4KQOA 4UA6A 1XGJA 3HL9A 3N8RA 5CXWA 5FAQA 3MXRA 2XR0A 2J9OA 3IHAA 5E2FA 2PU4A 5A90A 1SKFA 1PI5A 3E2LA 3IXGA 1W7FA 1QMEA 1KVLA 4U3TA 5CTMA 4WEJA 4BQMA 4ZBEA 1KDWA 1K57C 3E2KA 3A3EA 2V20A 5F1FA 4N9LA 2Y91A 2Y2GA 3P09A 1PYYA 4QU3A 4EV4A 3V39A 1KVMA 4UA7A 3Q7VB 1ERMA 1L0DA 2P9VB 1XX2A 3GMWA 1WYCA 5E2GA 5GHXA 3MZEA 5DVAA 3WRTA 3OZHA 2QPNA 1IYPA 5F82A 1IYOA 1K56A 3SH7A 3ZNYA 1H8ZA 3O88A 1O07A 2XLNA 4OQGA 4IEDA 2B5RA 1BZAA 2WKHA 2WAEA 5M1AA 1XXMA 2C5WB 3S4XA 1CK3A 5CECA 3Q1FA 4S2OA 2EX9A 4E3JA 2P74A 4N1HA 1GHIA 5FQJA 4KZ8A 3ZNTA 5KMWA 4LV3A 1YLTA 3Q82A 4XXRA 5CHUA 1O7EA 1RGZA 4KG6A 5FI7A 1KE4A 2EXBA 3HUNA 4D2OA 3I7JA 4FH4A 3FYZA 3IQAA 1K38A 2WADA 1IYSA 1ERQA 4R4SA 3VSLA 3PBRA 3VOYA 1K6SA 2EFXA 3ITBA 3ZHHA 1W5DA 2XGNA 2RCXA 3PAEA 1MWUA 4PM7A 3VP2A 5F1GA 4P0MA 2HP5A 1K56D 1W8QA 1YLJA 4KZ9A 4BJPA 4LCMA 4LV0A 2WGWA 3AGFA 1SDNA 5DF9A 3PBQA 5CTNA 4FSFA 4QD4A 4HBTA 1JTDA 4E3NA 1IKGA 5CEBA 5KSHA 1PWDA 5CHMA 3O87A 2XFTA 4IBRA 4O7DA 1DY6A 4OONA 1MY8A 1XGIA 5FQ9A 2R9XA 4KZAA 1FR6A 1MXOA 1VM1A 4S2IA 1FCNA 4S2NC 1LLBA 3BRMA 4E6XA 2XD5A 4GNUA 4RA7A 4P85A 4UAAA 2H5SA 2Y2QA 3NCKA 3NDGA 4A5RA 3BM6A 2XFSA 2VGJA 4PPRA 1ONHA 4DKIA 1LI0A 2X01A 4LCLA 5EVIA 3W4PA 5JYPA 3G4PA 3O3VA 5FQKA 1JTGA 2ZQDA 4GOGA 4DXCA 2WZZA 4EBLA 1E3UA 1XP4A 3SH9A 3BEBA 2I72A 5HAIA 4MEZA 4X53A 3BLSA 4GZBA 5GLDA 1BLPA 1ESIA 1WE4A 3IH8A 3NDEA 5GLCA 4ZJ3A 2Q9MA 2ZM0A 3UDXA 3VP1A 1K4EA 2Y2KA 2JCHA 2ZC4B 3NIAA 4QB8A 1Z6FA 4JXSA 4WELA 3SS4A 1K54A 1NZOA 1U60A 4RX3A 4P87A 1LHYA 2WZXA 1ES4A 1BTLA 2H0YA 4OQ0A 4B4XA 1ES2A 5FDHA 4BL2A 4DE3A 1QMFA 4DRTA 3RXWA 1KDSA 1WYBA 4PM8A 3ZVWA 4JLFA 1K25A 3UE3A 5KSCA 1IELA 4KG2A 1ESUA 3Q81A 4OQIA 4QJGA 4FCFA 4ID4A 4JPMA 5E2HA 3IF6A 4OVDA 3IT9A 4Y0UA 5DF7A 4JKTA 4S2LA 1MBLA 2ZM2A 3BFFA 5EVID 4YINA 1K55C 3OPRA 1NXYA 2XQZA 1E3UD 5FSRA 3BYDA 1XKZA 2WGIA 3IF5A 4GDBA 1BUEA 5FQMA 1RP5A 1CEGA 4DF6A 4WZ5A 3ZG7B 4RYEA 3OPPA 4OH0A 4KG5A 3N6IA 3HLWA 1HVBA 1I5QA 2V1ZA 3M6HA 4N1XA 4BD0A 5HW3A 1DJBA 4GB7A 4WYYA 3GV9A 3IXHA 2H0TA 3HREA 4BLMA 3NY4A 1TDGA 2ZQ7A 3DW0A 4NK3A 2WUQA 3HUMA 2BLSA 2CC1A 4EUZA 2FFYA 4XUXA 4OOLA 1PZOA 3GTCA 4MBKA 3PAGA 1I2WA 1G68A 3HLDA 3JYIA 4S2MA 5FI2A 3UNWA 4EBNA 2XDMA 1C3BA 4ZJ2A 1TDLA 3G30A 4WZ4A 5FATA 3A3DA 2Z2MB 3LY4A 3WWXA 3RXXA 3C4OA 1MKIA 1HZOA 3DWKA 1PIOA 1RCJA 1S6RA 5A92A 2Y2IA 4E3KA 1YM1A 2Z2LB 4FH2A 4UA9A 1BLSA 2G2WA 3MKFA 1ZG4A 1EWZA 4K0WA 4KZ4A 1L0FA 4KQQA 4QY6A 5CGWA 3ZDJA 2ZMAA 4KZ6A 4IVIA 3WRZA 3ZCZA 4U0TA 1FR1A 2G2UA 2J8YA 1AXBA 3MFDA 3BFEA 1YMXA 2ZQAA 4HEFA 5FQQA 5CRFA 5DF8A 4OP5A 3SOIA 1ZG6A 4NETA 1LI9A 4X68A 1ONGA 4ZTKA 4OQHA 3TSGA 3HVFA 3MXSA 3DTMA 5G18A 3G31A 1M40A 3GR2A 5FAPA 4CJNA 4DDYA 5J8XA 1W79A 4R23A 3IXBA 3UDIA 4E6WA 4K0XA 1HTZA 4R0QA 3VFFA 2XK1A 1NYMA 2JE5A 3PBSA 3QNBA 1GHMA 4S2PA 5EE8A 4JBFA 2ZJ9A 1KGEA 2J9PA 3VFHA 1K57A 4KZBA 1GA0A 4GD6A 5I94A 3OC2A 5DTSA 2HDSA 3N8LA 3ZVTA 4OPQA 3IH9A 1XA7A 3CZDA 4ZDXA 2Y59A 1YLZA 4JF4A 3W4QA 4OPRA 2Y4AA 4GDNA 4OOYA 3GSGA 1JWPA 3CG5A 2PBYA 3ZG5A 3UO9A 1XPBA 4Z9QA 4N9KA 5GHZA 3DWZA 4DE1A 2ZC7A 2X02A 3TOIA 3WS0A 4C6YA 4OP8A 3ZG9B 1YT4A 3P98A 2P9VA 3Q7VA 5EOEA 2IWDA 4WEKA 4HESA 3C4PA 3FKWA 3UDFA 1BLCA 1Q2QA 3A3IA 4U0XA 1OMEA 3VP3A 3O86A 4OPZA 1NYYA 1FSYA 4MNRA 3VP0A 4K91A 5HFOA 4OLGA 3G2ZA 4C3QA 1BT5A 4PM6A 3N7WA 1BSGA 3UN7A 3D4FA 3IXDA 2HDUA 2ZQ8A 4KZ5A 3RJUA 5IHVA 3FZCA 4YFMA 2Y2HA 1VQQA 1LL9A 5L2FA 1RGYA 2ZD8A 3IWIA 4EWFA 5F83A 2Q9NA 5CERA 3UY6A 4PMAA 5HAPA 5CHJA 4ZJ1A 3M6BA 1KE3A 3A3JA 4UHUA 4IBXA 1NJ4A 4R4RA 4DE2A 1LL5A 1DJAA 1I2SA 3HLEA 4GN2A 2ZQ9A 2J7VA 1DJCA 2ZC5B 1J9MA 1CI9A 3ITAA 1N9BA 4R1GA 1L0GA 4S2NA 3NBLA 3FKVA 3NI9A 3WS2A 5E43A 4E3LA 3MZDA 4BD1A 1CEFA 1PI4A 1NZUA 3HLFA 2RL3A 3UPOA 5FA7A 3GVBA 1YQSA 1ES5A 1PWCA 1L0EA 4S2JA 3AGEA 1YLWA 5EPHA 3PBOA 3MZFA 1IYQA 3VSKA 1H8YA 2OLVA 2WGWB 4OLDA 1YLPA 2QZ6A 3G2YA 2FFFB 4IVKA 5JYOA 1YLYA 3V5MA 4WMCD 3ZFZA 5HAQA 2OV5A 5GHYA 3GQZA 1BULA 2QMIA 2HDQA 4HBUA 4N92A 3SS3A 4LENA 5HARA 4PM9A 2A3UA 4JXGA 3N8SA 3IWOA 4X56A 3ZGAB 3QHYA 2Y2PA 4Y0OA 5CEDA 3C7UA 1MWRA 5GLBA 3B3XA 1K4FA 2Y55A 3LEZA 4QY5A 1SDEA 2WK0A 2WKEA 5EVIB 2OLUA 4H8RA 4KQRA 2Y2MA 2ZQCA 1PZPA 5GL9A 4JF5A 3NC8A 3S22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TGF A;  1ES3 A;  3MBZ A;  1SCW A;  3G34 A;  4KEN B;  5FI6 A;  4B88 A;  3WS4 A;  5HL1 A;  1GA9 A;  2JC7 A;  1K55 A;  2EXA A;  4MBH A;  2WYX A;  2A49 A;  4M3K A;  1MWS A;  4BL3 A;  5EVI C;  3N4I A;  5HX9 A;  5FAS A;  5GLA A;  3W4O A;  5KZH A;  2X71 A;  3V50 A;  1FCM A;  2XEP A;  3VMA A;  1HD8 A;  4S2K A;  4ZAM A;  1TEM A;  2GDN A;  3S1Y A;  3UE1 A;  1BLH A;  3OCL A;  4BEN A;  2E8I A;  3HUO A;  1ZC2 A;  2HP6 A;  3V3S A;  3M2K A;  2Y2O A;  4E3M A;  4DE0 A;  3CJM A;  2ZLY A;  1IKI A;  5D3O A;  3UPP A;  3OPL A;  3WS5 A;  1E4D A;  2VGK A;  3IF6 B;  2EX2 A;  1G6A A;  4KZ7 A;  4RX2 A;  1K54 C;  5A93 A;  3BLM A;  3OCN A;  1JWV A;  2HDR A;  5CGS A;  3WS1 A;  3QNC A;  3UE0 A;  1MWT A;  3HLG A;  3Q7Z A;  4F94 A;  1PW8 A;  4L0L A;  4WBG A;  4C75 A;  2ZC6 B;  5EEC A;  3OPH A;  3Q07 A;  3IF6 C;  3EQU A;  2XD1 A;  1ERO A;  4JXV A;  3BFG A;  1XA1 A;  4XUZ A;  2PU2 A;  2BG1 A;  4WM9 A;  5AQA A;  5FAO A;  2WAF A;  1K6R A;  3FWL A;  3G35 A;  1YMS A;  4OOM A;  2XH9 A;  1S0W A;  3LY3 A;  3V3R A;  1PWG A;  3HBR A;  4RVA A;  4X69 A;  4PM5 A;  4WZ5 C;  5BOH A;  3PTE A;  4GKU A;  3PBN A;  3M2J A;  5FQI A;  1N4O A;  4GD8 A;  4X6T A;  1PW1 A;  3VOZ A;  4JF6 A;  5TR7 A;  3LCE A;  4OPY A;  4LV2 A;  5AQ9 A;  2Y2N A;  1ZKJ A;  5U47 A;  4E3I A;  2V2F F;  4X55 A;  2C6W B;  3LO7 A;  2EX8 A;  3FV7 A;  1KGF A;  1EI5 A;  5DTT A;  4WMC A;  4Y7P A;  4JXW A;  5A91 A;  2Y2L A;  1NY0 A;  1FQG A;  1E25 A;  5CGX A;  1GHP A;  4FD8 A;  2ZC3 B;  4MLL A;  1JVJ A;  1ALQ A;  3AGD A;  3VP4 A;  1MPL A;  3ISG A;  3CMZ A;  4KZ3 A;  1CI8 A;  2R9W A;  3IWQ A;  2DNS A;  1H5X A;  1Q2P A;  4R3B A;  5M19 A;  4QHC A;  3C7V A;  3ZG8 B;  1TVF A;  2IWC A;  2UWX A;  4R3J A;  5EOO A;  4DXB A;  2HPB A;  3A3F A;  1IEM A;  3BEC A;  2EFU A;  2WKI A;  3EQV A;  3GRJ A;  4EQI A;  1JWZ A;  3SH8 A;  1KE0 A;  1NRF A;  1KGG A;  3PBT A;  4OKP A;  5M18 A;  3ZG0 A;  2IWB A;  1FCO A;  2WGV A;  4DDS A;  4E3O A;  4EBP A;  5DTK A;  3MKE A;  1FOF A;  3HLB A;  5EUA A;  2DRW A;  2H10 A;  5TFQ A;  4CPK A;  3BFD A;  2JBF A;  2HP9 A;  3HLC A;  4LV1 A;  3TG9 A;  4Y0T A;  5E2E A;  5AQ7 A;  4MBF A;  3UPN A;  3W8K A;  3C5A A;  4P6B A;  4Q8I A;  1W8Y A;  2Y2J A;  2ZM8 A;  5EVL A;  3G32 A;  4B4Z A;  3SS5 A;  1M6K A;  2OSU A;  1L2S A;  2EX6 A;  3BFC A;  2DCF A;  1FSW A;  5AQB A;  1SHV A;  3IHB A;  1GCE A;  2XF3 A;  1Y54 A;  4KQO A;  4UA6 A;  1XGJ A;  3HL9 A;  3N8R A;  5CXW A;  5FAQ A;  3MXR A;  2XR0 A;  2J9O A;  3IHA A;  5E2F A;  2PU4 A;  5A90 A;  1SKF A;  1PI5 A;  3E2L A;  3IXG A;  1W7F A;  1QME A;  1KVL A;  4U3T A;  5CTM A;  4WEJ A;  4BQM A;  4ZBE A;  1KDW A;  1K57 C;  3E2K A;  3A3E A;  2V20 A;  5F1F A;  4N9L A;  2Y91 A;  2Y2G A;  3P09 A;  1PYY A;  4QU3 A;  4EV4 A;  3V39 A;  1KVM A;  4UA7 A;  3Q7V B;  1ERM A;  1L0D A;  2P9V B;  1XX2 A;  3GMW A;  1WYC A;  5E2G A;  5GHX A;  3MZE A;  5DVA A;  3WRT A;  3OZH A;  2QPN A;  1IYP A;  5F82 A;  1IYO A;  1K56 A;  3SH7 A;  3ZNY A;  1H8Z A;  3O88 A;  1O07 A;  2XLN A;  4OQG A;  4IED A;  2B5R A;  1BZA A;  2WKH A;  2WAE A;  5M1A A;  1XXM A;  2C5W B;  3S4X A;  1CK3 A;  5CEC A;  3Q1F A;  4S2O A;  2EX9 A;  4E3J A;  2P74 A;  4N1H A;  1GHI A;  5FQJ A;  4KZ8 A;  3ZNT A;  5KMW A;  4LV3 A;  1YLT A;  3Q82 A;  4XXR A;  5CHU A;  1O7E A;  1RGZ A;  4KG6 A;  5FI7 A;  1KE4 A;  2EXB A;  3HUN A;  4D2O A;  3I7J A;  4FH4 A;  3FYZ A;  3IQA A;  1K38 A;  2WAD A;  1IYS A;  1ERQ A;  4R4S A;  3VSL A;  3PBR A;  3VOY A;  1K6S A;  2EFX A;  3ITB A;  3ZHH A;  1W5D A;  2XGN A;  2RCX A;  3PAE A;  1MWU A;  4PM7 A;  3VP2 A;  5F1G A;  4P0M A;  2HP5 A;  1K56 D;  1W8Q A;  1YLJ A;  4KZ9 A;  4BJP A;  4LCM A;  4LV0 A;  2WGW A;  3AGF A;  1SDN A;  5DF9 A;  3PBQ A;  5CTN A;  4FSF A;  4QD4 A;  4HBT A;  1JTD A;  4E3N A;  1IKG A;  5CEB A;  5KSH A;  1PWD A;  5CHM A;  3O87 A;  2XFT A;  4IBR A;  4O7D A;  1DY6 A;  4OON A;  1MY8 A;  1XGI A;  5FQ9 A;  2R9X A;  4KZA A;  1FR6 A;  1MXO A;  1VM1 A;  4S2I A;  1FCN A;  4S2N C;  1LLB A;  3BRM A;  4E6X A;  2XD5 A;  4GNU A;  4RA7 A;  4P85 A;  4UAA A;  2H5S A;  2Y2Q A;  3NCK A;  3NDG A;  4A5R A;  3BM6 A;  2XFS A;  2VGJ A;  4PPR A;  1ONH A;  4DKI A;  1LI0 A;  2X01 A;  4LCL A;  5EVI A;  3W4P A;  5JYP A;  3G4P A;  3O3V A;  5FQK A;  1JTG A;  2ZQD A;  4GOG A;  4DXC A;  2WZZ A;  4EBL A;  1E3U A;  1XP4 A;  3SH9 A;  3BEB A;  2I72 A;  5HAI A;  4MEZ A;  4X53 A;  3BLS A;  4GZB A;  5GLD A;  1BLP A;  1ESI A;  1WE4 A;  3IH8 A;  3NDE A;  5GLC A;  4ZJ3 A;  2Q9M A;  2ZM0 A;  3UDX A;  3VP1 A;  1K4E A;  2Y2K A;  2JCH A;  2ZC4 B;  3NIA A;  4QB8 A;  1Z6F A;  4JXS A;  4WEL A;  3SS4 A;  1K54 A;  1NZO A;  1U60 A;  4RX3 A;  4P87 A;  1LHY A;  2WZX A;  1ES4 A;  1BTL A;  2H0Y A;  4OQ0 A;  4B4X A;  1ES2 A;  5FDH A;  4BL2 A;  4DE3 A;  1QMF A;  4DRT A;  3RXW A;  1KDS A;  1WYB A;  4PM8 A;  3ZVW A;  4JLF A;  1K25 A;  3UE3 A;  5KSC A;  1IEL A;  4KG2 A;  1ESU A;  3Q81 A;  4OQI A;  4QJG A;  4FCF A;  4ID4 A;  4JPM A;  5E2H A;  3IF6 A;  4OVD A;  3IT9 A;  4Y0U A;  5DF7 A;  4JKT A;  4S2L A;  1MBL A;  2ZM2 A;  3BFF A;  5EVI D;  4YIN A;  1K55 C;  3OPR A;  1NXY A;  2XQZ A;  1E3U D;  5FSR A;  3BYD A;  1XKZ A;  2WGI A;  3IF5 A;  4GDB A;  1BUE A;  5FQM A;  1RP5 A;  1CEG A;  4DF6 A;  4WZ5 A;  3ZG7 B;  4RYE A;  3OPP A;  4OH0 A;  4KG5 A;  3N6I A;  3HLW A;  1HVB A;  1I5Q A;  2V1Z A;  3M6H A;  4N1X A;  4BD0 A;  5HW3 A;  1DJB A;  4GB7 A;  4WYY A;  3GV9 A;  3IXH A;  2H0T A;  3HRE A;  4BLM A;  3NY4 A;  1TDG A;  2ZQ7 A;  3DW0 A;  4NK3 A;  2WUQ A;  3HUM A;  2BLS A;  2CC1 A;  4EUZ A;  2FFY A;  4XUX A;  4OOL A;  1PZO A;  3GTC A;  4MBK A;  3PAG A;  1I2W A;  1G68 A;  3HLD A;  3JYI A;  4S2M A;  5FI2 A;  3UNW A;  4EBN A;  2XDM A;  1C3B A;  4ZJ2 A;  1TDL A;  3G30 A;  4WZ4 A;  5FAT A;  3A3D A;  2Z2M B;  3LY4 A;  3WWX A;  3RXX A;  3C4O A;  1MKI A;  1HZO A;  3DWK A;  1PIO A;  1RCJ A;  1S6R A;  5A92 A;  2Y2I A;  4E3K A;  1YM1 A;  2Z2L B;  4FH2 A;  4UA9 A;  1BLS A;  2G2W A;  3MKF A;  1ZG4 A;  1EWZ A;  4K0W A;  4KZ4 A;  1L0F A;  4KQQ A;  4QY6 A;  5CGW A;  3ZDJ A;  2ZMA A;  4KZ6 A;  4IVI A;  3WRZ A;  3ZCZ A;  4U0T A;  1FR1 A;  2G2U A;  2J8Y A;  1AXB A;  3MFD A;  3BFE A;  1YMX A;  2ZQA A;  4HEF A;  5FQQ A;  5CRF A;  5DF8 A;  4OP5 A;  3SOI A;  1ZG6 A;  4NET A;  1LI9 A;  4X68 A;  1ONG A;  4ZTK A;  4OQH A;  3TSG A;  3HVF A;  3MXS A;  3DTM A;  5G18 A;  3G31 A;  1M40 A;  3GR2 A;  5FAP A;  4CJN A;  4DDY A;  5J8X A;  1W79 A;  4R23 A;  3IXB A;  3UDI A;  4E6W A;  4K0X A;  1HTZ A;  4R0Q A;  3VFF A;  2XK1 A;  1NYM A;  2JE5 A;  3PBS A;  3QNB A;  1GHM A;  4S2P A;  5EE8 A;  4JBF A;  2ZJ9 A;  1KGE A;  2J9P A;  3VFH A;  1K57 A;  4KZB A;  1GA0 A;  4GD6 A;  5I94 A;  3OC2 A;  5DTS A;  2HDS A;  3N8L A;  3ZVT A;  4OPQ A;  3IH9 A;  1XA7 A;  3CZD A;  4ZDX A;  2Y59 A;  1YLZ A;  4JF4 A;  3W4Q A;  4OPR A;  2Y4A A;  4GDN A;  4OOY A;  3GSG A;  1JWP A;  3CG5 A;  2PBY A;  3ZG5 A;  3UO9 A;  1XPB A;  4Z9Q A;  4N9K A;  5GHZ A;  3DWZ A;  4DE1 A;  2ZC7 A;  2X02 A;  3TOI A;  3WS0 A;  4C6Y A;  4OP8 A;  3ZG9 B;  1YT4 A;  3P98 A;  2P9V A;  3Q7V A;  5EOE A;  2IWD A;  4WEK A;  4HES A;  3C4P A;  3FKW A;  3UDF A;  1BLC A;  1Q2Q A;  3A3I A;  4U0X A;  1OME A;  3VP3 A;  3O86 A;  4OPZ A;  1NYY A;  1FSY A;  4MNR A;  3VP0 A;  4K91 A;  5HFO A;  4OLG A;  3G2Z A;  4C3Q A;  1BT5 A;  4PM6 A;  3N7W A;  1BSG A;  3UN7 A;  3D4F A;  3IXD A;  2HDU A;  2ZQ8 A;  4KZ5 A;  3RJU A;  5IHV A;  3FZC A;  4YFM A;  2Y2H A;  1VQQ A;  1LL9 A;  5L2F A;  1RGY A;  2ZD8 A;  3IWI A;  4EWF A;  5F83 A;  2Q9N A;  5CER A;  3UY6 A;  4PMA A;  5HAP A;  5CHJ A;  4ZJ1 A;  3M6B A;  1KE3 A;  3A3J A;  4UHU A;  4IBX A;  1NJ4 A;  4R4R A;  4DE2 A;  1LL5 A;  1DJA A;  1I2S A;  3HLE A;  4GN2 A;  2ZQ9 A;  2J7V A;  1DJC A;  2ZC5 B;  1J9M A;  1CI9 A;  3ITA A;  1N9B A;  4R1G A;  1L0G A;  4S2N A;  3NBL A;  3FKV A;  3NI9 A;  3WS2 A;  5E43 A;  4E3L A;  3MZD A;  4BD1 A;  1CEF A;  1PI4 A;  1NZU A;  3HLF A;  2RL3 A;  3UPO A;  5FA7 A;  3GVB A;  1YQS A;  1ES5 A;  1PWC A;  1L0E A;  4S2J A;  3AGE A;  1YLW A;  5EPH A;  3PBO A;  3MZF A;  1IYQ A;  3VSK A;  1H8Y A;  2OLV A;  2WGW B;  4OLD A;  1YLP A;  2QZ6 A;  3G2Y A;  2FFF B;  4IVK A;  5JYO A;  1YLY A;  3V5M A;  4WMC D;  3ZFZ A;  5HAQ A;  2OV5 A;  5GHY A;  3GQZ A;  1BUL A;  2QMI A;  2HDQ A;  4HBU A;  4N92 A;  3SS3 A;  4LEN A;  5HAR A;  4PM9 A;  2A3U A;  4JXG A;  3N8S A;  3IWO A;  4X56 A;  3ZGA B;  3QHY A;  2Y2P A;  4Y0O A;  5CED A;  3C7U A;  1MWR A;  5GLB A;  3B3X A;  1K4F A;  2Y55 A;  3LEZ A;  4QY5 A;  1SDE A;  2WK0 A;  2WKE A;  5EVI B;  2OLU A;  4H8R A;  4KQR A;  2Y2M A;  2ZQC A;  1PZP A;  5GL9 A;  4JF5 A;  3NC8 A;  3S22 A; 
#chains in the Genus database with same CATH topology
 4Q0J A;  5TGF A;  1ES3 A;  4KEN B;  3G34 A;  1BYW A;  3PXP A;  1LL8 A;  4M3K A;  2PBD P;  5EVI C;  5HX9 A;  5KZH A;  3EWK A;  3VMA A;  2GDN A;  3UE1 A;  4NEE D;  1BLH A;  3OCL A;  2E8I A;  3HUO A;  3V3S A;  2HP6 A;  3IS2 B;  3M2K A;  3PYP A;  4E3M A;  4DE0 A;  3KO6 A;  1E4D A;  3KSG A;  4KZ7 A;  5A93 A;  1JWV A;  3NJA A;  2L1M A;  1PW8 A;  4WBG A;  4C75 A;  2PYR A;  3Q07 A;  3IF6 C;  1ERO A;  4XUZ A;  1NLZ A;  1XJ2 A;  3FWL A;  1YMS A;  4OOM A;  1PWG A;  4GKU A;  5TJJ A;  5AQ9 A;  2Y2N A;  2GZA A;  4E3I A;  3S7O A;  4X55 A;  1STZ A;  3FV7 A;  4Y7P A;  4JXW A;  2Y2L A;  1NY0 A;  1FQG A;  3LR3 A;  1W63 M;  4LLO B;  4MLL A;  3VP4 A;  3ISG A;  1H5X A;  1TF1 A;  2UWX A;  4PAU A;  1WA9 A;  2WKI A;  3GRJ A;  3QP2 A;  1XJ6 A;  5HPF A;  3QP1 A;  1KE0 A;  3T1Q B;  3PBT A;  4OKP A;  4PKY G;  3MKE A;  4I38 A;  2VJW A;  1NRJ A;  5E2E A;  3UPN A;  3W8K A;  4LPZ A;  3F1O B;  1W8Y A;  2QJ7 A;  2ZM8 A;  2PHY A;  3T4Q A;  1M6K A;  2OSU A;  1L2S A;  3BFC A;  2B95 A;  4DN0 A;  2EWV A;  4P6Z M;  2DCF A;  2V9A A;  3O5Y A;  1SHV A;  3IHB A;  2XF3 A;  3N8R A;  2KX6 A;  5CXW A;  3K3C A;  3HJK A;  3MXR A;  2XR0 A;  2J9O A;  4QWO A;  5EM1 A;  1QME A;  1LSW A;  2INW A;  5CTM A;  4WEJ A;  4ZBE A;  1K57 C;  3A3E A;  2Y91 A;  3T4O A;  3KYZ A;  1WYC A;  1IYP A;  3ZNY A;  3O88 A;  2OWH A;  1O07 A;  4OQG A;  2WKH A;  2WAE A;  5M1A A;  1XXM A;  1Z09 A;  2EX9 A;  2VA0 A;  4KZ8 A;  4JGQ A;  4LV3 A;  2KDK A;  4GCZ A;  1RGZ A;  5FI7 A;  1DP9 A;  4NG2 A;  3I7J A;  5I5L A;  1IYS A;  3VSL A;  3S7N A;  3VOY A;  3ITB A;  3DTE A;  1W5D A;  2XGN A;  1MWU A;  4P0M A;  4LGW A;  3T4L A;  4KZ9 A;  2ZOH A;  2VV6 A;  3AGF A;  5DF9 A;  3PBQ A;  4QD4 A;  4E3N A;  3LEQ A;  5CEB A;  5EV0 A;  1KOU A;  4O7D A;  4I39 A;  4EER A;  1MY8 A;  1OT6 A;  1TS0 A;  1MXO A;  4S2I A;  3BRM A;  5HDD A;  3NDG A;  1ONH A;  1LI0 A;  3G4P A;  5FEG A;  2WZZ A;  5HSQ A;  3NHQ A;  5HAI A;  2ZL1 B;  4X53 A;  1ESI A;  3RFB A;  1YPR A;  3UDX A;  2JCH A;  3C30 A;  4FUW A;  1OTE A;  1U60 A;  4RX3 A;  1BTL A;  4B4X A;  1ACF A;  4DE3 A;  2VEA A;  3UE3 A;  1IEL A;  4KG2 A;  1P9W A;  4GHI A;  3T4J A;  4ID4 A;  4OVD A;  3E4P A;  5L07 A;  2ZM2 A;  4YIN A;  5MC7 A;  2XQZ A;  5FSR A;  3BYD A;  1T1B A;  1CEG A;  3ICY A;  2V1Z A;  1I5Q A;  4N1X A;  2PT7 A;  4WYY A;  3E0Y A;  3NY4 A;  1P0Z A;  2CC1 A;  4EUZ A;  4XUX A;  4HH2 A;  5CX7 A;  3LIB A;  1S4S A;  4MBK A;  3GEC A;  2Z6D A;  3H82 B;  3FPW A;  2XDM A;  3KX0 X;  1C3B A;  4ZJ2 A;  3WWX A;  3G30 A;  5FAT A;  2D02 A;  3LY4 A;  1HZO A;  2W1R A;  3DWK A;  2Y2I A;  4KQD A;  2G2W A;  1J3W A;  4K0W A;  4KUK A;  1L0F A;  5DFY A;  2J8Y A;  3T50 A;  2ZOI A;  2ZQA A;  1XJ4 A;  5CRF A;  3EOI A;  4OP5 A;  1ZG6 A;  4NET A;  4M4X A;  5AVE A;  3HVF A;  5G18 A;  1W79 A;  4R23 A;  3H7W A;  3UDI A;  4K0X A;  3A0V A;  1HTZ A;  3NOU C;  2XK1 A;  4JBF A;  4EET B;  1KGE A;  1TS8 A;  2IA2 A;  3CI6 A;  4DJ2 A;  1Y28 A;  4OPQ A;  1XA7 A;  3D72 A;  3W4Q A;  5HL6 A;  4GDN A;  1JWP A;  2PBY A;  4QPR A;  4Z9Q A;  4Y3I A;  2ZC7 A;  3LI8 A;  1TD5 A;  3WS0 A;  3ZG9 B;  3P98 A;  3Q7V A;  4X25 A;  5EOE A;  4U0X A;  3HJI A;  3O86 A;  4OPZ A;  4MNR A;  3VP0 A;  4LRZ E;  4OLG A;  3G2Z A;  2PR6 A;  3K3D A;  3CHW P;  2W1T B;  3UN7 A;  2ZQ8 A;  4JGP A;  3RJU A;  3FZC A;  2Y2H A;  5L2F A;  2ZD8 A;  4EWF A;  5CER A;  4CLC B;  4WLA A;  4PMA A;  4ZJ1 A;  4F3L B;  3T4S A;  4UHU A;  4D60 A;  2JN7 A;  2VKS A;  1LL5 A;  1DJA A;  1I2S A;  3HLE A;  2MJ6 A;  2ZC5 B;  1H3Q A;  4S2N A;  4H6J B;  1Y4O A;  3MZD A;  1PI4 A;  3HLF A;  4K08 A;  1YQS A;  4BBV A;  2XA7 M;  3MZF A;  3LIC A;  1H8Y A;  2OLV A;  4OLD A;  2QZ6 A;  3G2Y A;  3ZFZ A;  1CQA A;  2OV5 A;  4WUJ A;  1BUL A;  3IX3 A;  5IU1 A;  3V67 A;  4IJG A;  3SS3 A;  4G3K A;  3N8S A;  3B33 A;  2Y55 A;  2WKE A;  5EVI B;  2Y2M A;  3S22 A;  3MBZ A;  1SCW A;  4B88 A;  3WS4 A;  3BJN A;  5HL1 A;  2JC7 A;  4BL3 A;  3T12 B;  3N4I A;  1H0M A;  2X71 A;  1ZTU A;  4ARZ A;  2OWJ A;  1TEM A;  3VV4 A;  4BEN A;  3CAX A;  2Y2O A;  3CJM A;  3WS5 A;  4MN7 A;  3U4L P;  2VGK A;  3IF6 B;  2FH5 A;  2EX2 A;  1G6A A;  2V0U A;  2HDR A;  2QHK A;  3QNC A;  4L9G A;  4JGO A;  1OTI A;  2ZC6 B;  3EQU A;  2XD1 A;  4JXV A;  5AJG A;  2M7V A;  2BG1 A;  4WM9 A;  1CF0 A;  3G35 A;  4DMZ A;  3LY3 A;  3LR5 A;  3UMD A;  3UE6 A;  5FQI A;  2I9V A;  3VOZ A;  4JF6 A;  3FPV A;  3LCE A;  1ZKJ A;  3CPT A;  2V2F F;  2VV8 A;  2W3H A;  3TRC A;  5A91 A;  2VV7 A;  1GHP A;  2ZC3 B;  1DP8 A;  4GS9 B;  4KZ3 A;  3TE8 A;  3UB8 A;  1Q2P A;  5M19 A;  4ESP A;  2WKQ A;  3ZG8 B;  1TVF A;  4DXB A;  4R3J A;  3LUQ A;  3EQV A;  4EQI A;  3LIE A;  4HP9 A;  2WGV A;  5DTK A;  1FOF A;  4CPK A;  2DRW A;  4UQI M;  3BY9 A;  2JBF A;  4Y0T A;  5AQ7 A;  3C5A A;  4P6B A;  4Q8I A;  1LSV A;  2EX6 A;  2O9C A;  4EW7 A;  3FC7 A;  5AQB A;  4UA6 A;  1Y54 A;  3HL9 A;  5HZH A;  5E2F A;  3MF0 A;  1PI5 A;  3IBJ A;  2QWS A;  4BQM A;  1KDW A;  4QU3 A;  1ERM A;  5E2G A;  3MZE A;  3UB6 A;  1IYO A;  1K56 A;  1F9I A;  1BZA A;  2OAP 1;  1A0K A;  3S4X A;  1XJ3 A;  1OTD A;  3Q1F A;  4E3J A;  1YAX A;  4N1H A;  1GHI A;  1F5M A;  4ETZ A;  3K2N A;  5CHU A;  4Y17 A;  1KE4 A;  4FH4 A;  3C38 A;  2JKR I;  3FYZ A;  3IQA A;  2WAD A;  2PD8 A;  1K6S A;  3CIT A;  2P04 A;  3ZHH A;  3EGD C;  4Q0H A;  4IHQ A;  1K56 D;  1YLJ A;  3T4K A;  5DKK A;  2W3D A;  4WL9 A;  5KSH A;  1PWD A;  2XFT A;  4IBR A;  3F1N A;  4OON A;  3LIF A;  2R9X A;  4KZA A;  2E8J A;  3TW8 A;  4S2N C;  2WKP A;  4E6X A;  4P85 A;  2H5S A;  2PR5 A;  3NCK A;  4A5R A;  4Y13 A;  3BM6 A;  4PPR A;  2VGJ A;  4LCL A;  3W4P A;  5FQK A;  4GOG A;  1XP4 A;  5KIZ A;  2YKH A;  2I72 A;  3BEB A;  2VZW A;  3EGX C;  3BLS A;  2Y8H A;  1BLP A;  4LFU A;  3IH8 A;  5EFW A;  5GLC A;  3RH8 B;  3VP1 A;  1K4E A;  3SW1 A;  2ZC4 B;  1P9R A;  4WEL A;  1K54 A;  4AFI A;  3NEC A;  2WZX A;  1ES4 A;  2GX5 A;  4DRT A;  3ZVW A;  1OTB A;  4OQI A;  1CJF A;  1NLY A;  3Q81 A;  4G3W A;  4Y0U A;  2Z6C A;  2W3E A;  1S1Y A;  4GJ4 A;  3OOV A;  1NXY A;  4GDB A;  1BUE A;  2EWW A;  3ZG7 B;  4RYE A;  3OPP A;  1G5U A;  4BD0 A;  5HW3 A;  3M6H A;  4P6Z S;  3HRE A;  1TDG A;  4HQA A;  2BLS A;  2FFY A;  5F69 A;  4I3I A;  1G68 A;  4EBN A;  3RXX A;  4HIA A;  1OJG A;  5HWW A;  2ZMF A;  4NXG A;  1PIO A;  1RCJ A;  4E3K A;  1YM1 A;  2Z2L B;  1G28 A;  3KSH A;  1ZG4 A;  2VGL M;  3ZDJ A;  3R7W A;  4KZ6 A;  3ZCZ A;  4U0T A;  2JKG A;  1AXB A;  3MFD A;  4HEF A;  4HP4 A;  4Y5F A;  2A24 A;  3SOI A;  1LI9 A;  1G6O A;  1ONG A;  4ZTK A;  3MXS A;  4CJN A;  3GR2 A;  5FAP A;  4R0Q A;  3VFF A;  1NYM A;  2JE5 A;  3FG8 A;  5F5Y A;  2HV1 A;  1AWI A;  2ZJ9 A;  3VFH A;  1GA0 A;  4GD6 A;  5DTS A;  3LR4 A;  2GNX A;  4JF4 A;  4IUK A;  4OOY A;  3UO9 A;  1XPB A;  1SZV A;  3CUE A;  2X02 A;  3UB7 A;  1D06 A;  2P9V A;  4G3V A;  4CQH A;  2IWD A;  3HCY A;  1VEU A;  1BLC A;  4KUO A;  4O0P A;  3VP3 A;  4MN6 A;  5HWV A;  2HJ9 C;  1FSY A;  4K91 A;  1X0O A;  1BT5 A;  3S7Q A;  2NUP C;  4HHD A;  4ZRR A;  5G4Z A;  2JHE A;  3TJZ C;  2HDU A;  4KZ5 A;  5IHV A;  1T1A A;  1RGY A;  3NOT C;  5F83 A;  3UY6 A;  1IOU A;  5CHJ A;  3M6B A;  3A3J A;  5DJT A;  1F2K A;  4GN2 A;  2ZQ9 A;  1J9M A;  2B02 A;  4R1G A;  4E3L A;  4BD1 A;  1CEF A;  3UPO A;  5FA7 A;  1PWC A;  2P08 A;  4S2J A;  3AGE A;  2VLG A;  5F68 A;  5EPH A;  3PBO A;  2WKR A;  4BMW A;  3BW6 A;  5DKL A;  3R4K A;  4BBU A;  5JYO A;  1YLY A;  4WMC D;  2K31 A;  5HAQ A;  5GHY A;  1VET A;  2HDQ A;  3W2Z A;  2V8C A;  4PM9 A;  4JXG A;  3EEH A;  4X56 A;  3T1R A;  3RTY A;  5CED A;  3C7U A;  3B3X A;  3LEZ A;  4QY5 A;  3UB9 A;  3MQQ A;  2QJ5 A;  2OLU A;  3H9W A;  3PHY A;  4H8R A;  4HJ4 A;  4KQR A;  2ZQC A;  5GL9 A;  4JF5 A;  3BY8 A;  5HPI A;  5FI6 A;  5FDS A;  2A2L A;  1K55 A;  4XT2 A;  4LRX C;  3W4O A;  3V50 A;  1FCM A;  5HDC A;  1HD8 A;  4S2K A;  1ZC2 A;  3IX8 A;  2R78 A;  4GHI B;  1IKI A;  5D3O A;  3UPP A;  1GSX A;  4RX2 A;  1K54 C;  3BLM A;  1PFL A;  1XFN A;  4MMN A;  3WS1 A;  3UE0 A;  4IUH A;  4L0L A;  4B93 A;  5EEC A;  4CLC D;  5HD3 A;  1OJ5 A;  2WAF A;  4Y2F A;  2PYP A;  3V3R A;  4RVA A;  4X69 A;  4PM5 A;  4FOF A;  3PTE A;  3PBN A;  4GD8 A;  4X6T A;  5TR7 A;  4OPY A;  1YKD A;  2C6W B;  1EI5 A;  1E25 A;  4FD8 A;  4GLQ A;  3LFV A;  2YKF A;  3CMZ A;  1CI8 A;  2R9W A;  3GDI A;  5A8B A;  3C7V A;  5EOO A;  1S67 L;  1NRF A;  1KGG A;  4MCW A;  2IWB A;  1FCO A;  4DDS A;  4E3O A;  4EBP A;  3HLB A;  2PAV P;  2V1B A;  4LV1 A;  3HLC A;  3H7W B;  3F1P A;  4MBF A;  3G32 A;  5TBM A;  4B4Z A;  2HZ5 A;  1W63 Q;  2VK3 A;  1FSW A;  2XA7 S;  3SZT A;  5FAQ A;  4PKY A;  1NWZ A;  1SKF A;  3E2L A;  3IXG A;  3MQO A;  1W7F A;  2V20 A;  3QP4 A;  4N9L A;  4EV4 A;  2V0W A;  3Q7V B;  1SKO A;  3LYX A;  3GMW A;  3OBF A;  3WRT A;  3OZH A;  5F82 A;  1H8Z A;  3KYQ A;  2JKF A;  3OLO A;  2C5W B;  3JPU A;  1CK3 A;  5CEC A;  3CUE C;  5L09 A;  4HY8 A;  3S7P A;  2ZMV A;  4HJ6 A;  4PHT A;  5HDS A;  1O7E A;  4KG6 A;  2EXB A;  5DJU A;  3HUN A;  1IFQ A;  1LT0 A;  4R4S A;  3PBR A;  2VX8 A;  1FIL A;  4L9E A;  3PAE A;  2M1C A;  3E4Q A;  5F1G A;  2HP5 A;  2ZBB A;  4BJP A;  2WGW A;  1SDN A;  4Z1W A;  4HBT A;  1JTD A;  4E04 A;  1P97 A;  1IKG A;  5CHM A;  2J3W A;  4YOF A;  1YSP A;  1S66 L;  1MC0 A;  1VM1 A;  2ACG A;  1FCN A;  1LLB A;  2XD5 A;  4GNU A;  4RA7 A;  4UAA A;  4DJ3 A;  4EEP A;  2Y2Q A;  2XFS A;  2X01 A;  2JKR M;  5JYP A;  2ZQD A;  3MXQ A;  4DXC A;  3IBR A;  4EBL A;  3KSI A;  4MEZ A;  4GZB A;  5C5K A;  1WE4 A;  3NDE A;  2KOI A;  4ZJ3 A;  1L3L A;  2PDR A;  2Y2K A;  3SS4 A;  4QB8 A;  4P87 A;  2O99 A;  4OQ0 A;  5FDH A;  1QMF A;  3IS2 A;  1KDS A;  4PM8 A;  2DMW A;  3CLO A;  1K25 A;  5E2H A;  4UEY A;  3DAV A;  1UWP X;  4NKP A;  2HGV A;  2L0W A;  4ARZ B;  4R38 A;  3BFF A;  4CLC C;  1K55 C;  1H8M A;  3OPR A;  4UQI S;  1RP5 A;  4DF6 A;  5F6A A;  4WZ5 A;  1JNU A;  3N6I A;  3HLW A;  1DJB A;  4GB7 A;  3LR0 A;  3GV9 A;  3IXH A;  1VB6 A;  4BLM A;  1N9L A;  3DW0 A;  4NK3 A;  2WUQ A;  3HUM A;  1D7E A;  4OOL A;  5AVF A;  1FIK A;  3GTC A;  3PAG A;  3HLD A;  5FI2 A;  4S2M A;  1TDL A;  4WZ4 A;  3QP6 A;  2QYB A;  1BLS A;  3CPT B;  4EXO A;  4L9F A;  3MR0 A;  5CGW A;  1D1J A;  4IVI A;  2J3T D;  3C2W A;  3NOP C;  2G2U A;  3A0R A;  5FQQ A;  4GW9 A;  2PD7 A;  4X1M A;  1LSX A;  3TSG A;  4OQH A;  1MZU A;  3DTM A;  4R70 A;  1M40 A;  4DDY A;  3IXB A;  4E6W A;  3QP5 A;  4MN5 A;  3F1O A;  1GHM A;  5EE8 A;  1T18 A;  2J9P A;  3ZYT A;  4RQ9 A;  4KZB A;  5I94 A;  3OC2 A;  2HDS A;  3ZVT A;  3IH9 A;  4EU0 A;  4ZDX A;  5J4E A;  5J7E A;  4OPR A;  3CG5 A;  3ZG5 A;  2HF6 A;  3D9Y A;  4N9K A;  3NUL A;  5GHZ A;  4DE1 A;  3PR6 A;  4C6Y A;  3VOL A;  4O8G A;  1YT4 A;  3UDF A;  3A3I A;  3DTK A;  2M7U A;  2H28 A;  5HFO A;  1K0K A;  3MFX A;  4WF0 A;  4C3Q A;  3N7W A;  1BSG A;  3IXD A;  1T1C A;  3DBA A;  4HOI A;  3G6O A;  3BQ8 A;  3IWI A;  2Q9N A;  3E4O A;  5HAP A;  3VE4 A;  5FL3 A;  4IBX A;  4R4R A;  4X1L A;  4DE2 A;  1V9Z A;  3A0S A;  1CI9 A;  3ZQ5 A;  3NBL A;  3NI9 A;  5E43 A;  1S1Z A;  2RL3 A;  2FZ0 A;  3GVB A;  2EA9 A;  2HJE A;  1L0E A;  2W27 A;  1F98 A;  1IYQ A;  1YLP A;  2P7J A;  4IVK A;  3V5M A;  3GQZ A;  4HBU A;  4N92 A;  2NUT C;  3F1N B;  4LEN A;  2A3U A;  3IWO A;  3ZGA B;  3QP8 A;  2Y2P A;  4BWI A;  3BQA A;  4Y0O A;  2XRO A;  2ZL1 A;  1K4F A;  1SDE A;  5EM0 A;  1PZP A;  3NC8 A;  2VGL S;  4MDZ A;  1GA9 A;  2EXA A;  4MBH A;  1V9Y A;  2WYX A;  2A49 A;  4I3J A;  1MWS A;  5FAS A;  5GLA A;  5G4Y A;  2XEP A;  4ZAM A;  3S1Y A;  5DFX A;  1OT9 A;  2UV0 E;  2ZLY A;  3OPL A;  2K7S A;  3OCN A;  4HJ3 A;  5CGS A;  3T1X A;  2KLI A;  1MWT A;  3HLG A;  3Q7Z A;  4F94 A;  1TS7 A;  4R3A A;  3OPH A;  3D3O A;  3BFG A;  1XA1 A;  3H82 A;  2PU2 A;  5AQA A;  5FAO A;  1K6R A;  2XH9 A;  1GSW A;  1S0W A;  3HBR A;  4EUV A;  4WZ5 C;  5BOH A;  3M2J A;  4BBT A;  1N4O A;  2LB5 A;  1PW1 A;  2J3T C;  4LV2 A;  5U47 A;  3LO7 A;  2EX8 A;  2D01 A;  1KGF A;  1YSQ A;  5DTT A;  1N9O A;  4WMC A;  2PRF A;  5CGX A;  3DTI A;  1JVJ A;  1ALQ A;  3AGD A;  3MS6 A;  3UME A;  1MPL A;  3IWQ A;  2DNS A;  5HWT A;  4R3B A;  4QHC A;  2IWC A;  3R7W B;  2O9A A;  2HPB A;  3A3F A;  1IEM A;  3BEC A;  2EFU A;  4EEU A;  1JWZ A;  3SH8 A;  3T4T A;  2A24 B;  5M18 A;  3ZG0 A;  3MQ0 A;  5EUA A;  2H10 A;  5TFQ A;  3BFD A;  2HP9 A;  3TG9 A;  3KYE A;  3LI9 A;  3T1S A;  2Y2J A;  5EVL A;  3SS5 A;  2Q0O A;  3P7N A;  4KQO A;  1GCE A;  1XGJ A;  3IHA A;  2PU4 A;  5A90 A;  3MSH A;  2W0N A;  1KVL A;  4U3T A;  3E2K A;  5F1F A;  2Y2G A;  3P09 A;  1PYY A;  4JGR A;  3V39 A;  1KVM A;  4HH3 A;  4UA7 A;  2P9V B;  1L0D A;  5GHX A;  1XX2 A;  2W1T A;  5DVA A;  2QPN A;  1VEU B;  3SH7 A;  4ETX A;  2XLN A;  4IED A;  2B5R A;  5L10 A;  4CLC A;  4S2O A;  2P74 A;  4F3L A;  5FQJ A;  3ZNT A;  1HLU P;  5KMW A;  1YLT A;  3Q82 A;  4XXR A;  3LIA A;  4D2O A;  2O0Y A;  4Q0I A;  1K38 A;  4H6J A;  1DRM A;  1ERQ A;  2EFX A;  1MKM A;  2RCX A;  4PM7 A;  3VP2 A;  1W8Q A;  2W3F A;  4LCM A;  4LV0 A;  5CTN A;  4FSF A;  3O87 A;  1DY6 A;  4II7 A;  1UWN X;  1XGI A;  5FQ9 A;  2BAS A;  1FR6 A;  4O01 A;  2JKT M;  2J80 A;  4I3A A;  2Y79 A;  1VET B;  4YWZ A;  4DKI A;  3L7H A;  5EVI A;  3O3V A;  1JTG A;  4CLC E;  1E3U A;  3SH9 A;  5GLD A;  2V8F A;  2Q9M A;  2ZM0 A;  3NIA A;  1Z6F A;  4JXS A;  1NZO A;  1LHY A;  2H0Y A;  3MJQ A;  1ES2 A;  4BL2 A;  3RXW A;  1WYB A;  4JLF A;  4XT2 B;  5KSC A;  1ESU A;  2GJ3 A;  4QJG A;  4FCF A;  4YNR A;  4JPM A;  3IF6 A;  3IT9 A;  5DF7 A;  4JKT A;  3LID A;  4S2L A;  5EVE A;  1MBL A;  5EVI D;  4HNB A;  3EEA A;  1E3U D;  4B9O A;  1XKZ A;  2WGI A;  3IF5 A;  5FQM A;  3LGO A;  4OH0 A;  2AVX A;  4KG5 A;  1HVB A;  2K2N A;  2OOL A;  3CWF A;  2H0T A;  2ZQ7 A;  1XFQ A;  1S4R A;  1OTA A;  1PZO A;  3B47 A;  1I2W A;  3JYI A;  3UNW A;  3ULF A;  4HI4 A;  3A3D A;  2Z2M B;  3C4O A;  2BTF P;  4EES A;  1MKI A;  5HD5 A;  1S6R A;  5A92 A;  3MMH A;  4GS9 A;  4FH2 A;  4UA9 A;  2JKT I;  4NXF A;  3MKF A;  4I5S A;  5L8M A;  3E98 A;  1EWZ A;  4KZ4 A;  4KQQ A;  4QY6 A;  2XRN A;  2ZMA A;  3WRZ A;  1FR1 A;  1EW0 A;  3B42 A;  2QKP A;  3BWL A;  3BFE A;  1YMX A;  5DF8 A;  4NXE A;  5FEF A;  4X68 A;  3JVV A;  5J8X A;  3G31 A;  2O9B A;  4Y15 A;  3IX4 A;  3U2A A;  5J3W A;  1TS6 A;  3PBS A;  4S2P A;  3QNB A;  1K57 A;  1OPX A;  2B18 A;  5K5B A;  4ME4 A;  3N8L A;  3CZD A;  3F1P B;  2Y59 A;  1YLZ A;  2Y4A A;  3GSG A;  5TBM B;  3L9K A;  2LB9 A;  4WN5 A;  3DWZ A;  3TOI A;  4OP8 A;  1VHM A;  4LRY C;  4WEK A;  4HES A;  3C4P A;  3FKW A;  1Q2Q A;  1OME A;  1NYY A;  1N9N A;  5IT5 A;  4PM6 A;  1SKO B;  3D4F A;  2G7U A;  3C8C A;  4YFM A;  1VQQ A;  1LL9 A;  1GSV A;  2XSS A;  1UGU A;  1KE3 A;  1PRQ A;  1NJ4 A;  1PNE A;  1ODV A;  4EQ1 A;  2J7V A;  1DJC A;  3ITA A;  1N9B A;  2OAQ 1;  3KSF A;  1L0G A;  3FKV A;  3WS2 A;  1NZU A;  5LBR A;  1T19 A;  1ES5 A;  3UB5 P;  1YLW A;  2V1A A;  3VSK A;  2WGW B;  2L4R A;  4NXB A;  2FFF B;  4R6L A;  2QMI A;  5IS1 A;  5HAR A;  3VE3 A;  1ZHH B;  3QHY A;  3P01 A;  1MWR A;  5GLB A;  4FTX A;  3JVU A;  2WK0 A;  2CMN A;  1DP6 A;  2W3G A; 
#chains in the Genus database with same CATH homology
 5TGF A;  1ES3 A;  3MBZ A;  1SCW A;  3G34 A;  4KEN B;  5FI6 A;  4B88 A;  3WS4 A;  5HL1 A;  1GA9 A;  2JC7 A;  1K55 A;  2EXA A;  4MBH A;  2WYX A;  2A49 A;  4M3K A;  1MWS A;  4BL3 A;  5EVI C;  3N4I A;  5HX9 A;  5FAS A;  5GLA A;  3W4O A;  5KZH A;  2X71 A;  3V50 A;  1FCM A;  2XEP A;  3VMA A;  1HD8 A;  4S2K A;  4ZAM A;  1TEM A;  2GDN A;  3S1Y A;  3UE1 A;  1BLH A;  3OCL A;  4BEN A;  2E8I A;  3HUO A;  1ZC2 A;  2HP6 A;  3V3S A;  3M2K A;  2Y2O A;  4E3M A;  4DE0 A;  3CJM A;  2ZLY A;  1IKI A;  5D3O A;  3UPP A;  3OPL A;  3WS5 A;  1E4D A;  2VGK A;  3IF6 B;  2EX2 A;  1G6A A;  4KZ7 A;  4RX2 A;  1K54 C;  5A93 A;  3BLM A;  3OCN A;  1JWV A;  2HDR A;  5CGS A;  3WS1 A;  3QNC A;  3UE0 A;  1MWT A;  3HLG A;  3Q7Z A;  4F94 A;  1PW8 A;  4L0L A;  4WBG A;  4C75 A;  2ZC6 B;  5EEC A;  3OPH A;  3Q07 A;  3IF6 C;  3EQU A;  2XD1 A;  1ERO A;  4JXV A;  3BFG A;  1XA1 A;  4XUZ A;  2PU2 A;  2BG1 A;  4WM9 A;  5AQA A;  5FAO A;  2WAF A;  1K6R A;  3FWL A;  3G35 A;  1YMS A;  4OOM A;  2XH9 A;  1S0W A;  3LY3 A;  3V3R A;  1PWG A;  3HBR A;  4RVA A;  4X69 A;  4PM5 A;  4WZ5 C;  5BOH A;  3PTE A;  4GKU A;  3PBN A;  3M2J A;  5FQI A;  1N4O A;  4GD8 A;  4X6T A;  1PW1 A;  3VOZ A;  4JF6 A;  5TR7 A;  3LCE A;  4OPY A;  4LV2 A;  5AQ9 A;  2Y2N A;  1ZKJ A;  5U47 A;  4E3I A;  2V2F F;  4X55 A;  2C6W B;  3LO7 A;  2EX8 A;  3FV7 A;  1KGF A;  1EI5 A;  5DTT A;  4WMC A;  4Y7P A;  4JXW A;  5A91 A;  2Y2L A;  1NY0 A;  1FQG A;  1E25 A;  5CGX A;  1GHP A;  4FD8 A;  2ZC3 B;  4MLL A;  1JVJ A;  1ALQ A;  3AGD A;  3VP4 A;  1MPL A;  3ISG A;  3CMZ A;  4KZ3 A;  1CI8 A;  2R9W A;  3IWQ A;  2DNS A;  1H5X A;  1Q2P A;  4R3B A;  5M19 A;  4QHC A;  3C7V A;  3ZG8 B;  1TVF A;  2IWC A;  2UWX A;  4R3J A;  5EOO A;  4DXB A;  2HPB A;  3A3F A;  1IEM A;  3BEC A;  2EFU A;  2WKI A;  3EQV A;  3GRJ A;  4EQI A;  1JWZ A;  3SH8 A;  1KE0 A;  1NRF A;  1KGG A;  3PBT A;  4OKP A;  5M18 A;  3ZG0 A;  2IWB A;  1FCO A;  2WGV A;  4DDS A;  4E3O A;  4EBP A;  5DTK A;  3MKE A;  1FOF A;  3HLB A;  5EUA A;  2DRW A;  2H10 A;  5TFQ A;  4CPK A;  3BFD A;  2JBF A;  2HP9 A;  3HLC A;  4LV1 A;  3TG9 A;  4Y0T A;  5E2E A;  5AQ7 A;  4MBF A;  3UPN A;  3W8K A;  3C5A A;  4P6B A;  4Q8I A;  1W8Y A;  2Y2J A;  2ZM8 A;  5EVL A;  3G32 A;  4B4Z A;  3SS5 A;  1M6K A;  2OSU A;  1L2S A;  2EX6 A;  3BFC A;  2DCF A;  1FSW A;  5AQB A;  1SHV A;  3IHB A;  1GCE A;  2XF3 A;  1Y54 A;  4KQO A;  4UA6 A;  1XGJ A;  3HL9 A;  3N8R A;  5CXW A;  5FAQ A;  3MXR A;  2XR0 A;  2J9O A;  3IHA A;  5E2F A;  2PU4 A;  5A90 A;  1SKF A;  1PI5 A;  3E2L A;  3IXG A;  1W7F A;  1QME A;  1KVL A;  4U3T A;  5CTM A;  4WEJ A;  4BQM A;  4ZBE A;  1KDW A;  1K57 C;  3E2K A;  3A3E A;  2V20 A;  5F1F A;  4N9L A;  2Y91 A;  2Y2G A;  3P09 A;  1PYY A;  4QU3 A;  4EV4 A;  3V39 A;  1KVM A;  4UA7 A;  3Q7V B;  1ERM A;  1L0D A;  2P9V B;  1XX2 A;  3GMW A;  1WYC A;  5E2G A;  5GHX A;  3MZE A;  5DVA A;  3WRT A;  3OZH A;  2QPN A;  1IYP A;  5F82 A;  1IYO A;  1K56 A;  3SH7 A;  3ZNY A;  1H8Z A;  3O88 A;  1O07 A;  2XLN A;  4OQG A;  4IED A;  2B5R A;  1BZA A;  2WKH A;  2WAE A;  5M1A A;  1XXM A;  2C5W B;  3S4X A;  1CK3 A;  5CEC A;  3Q1F A;  4S2O A;  2EX9 A;  4E3J A;  2P74 A;  4N1H A;  1GHI A;  5FQJ A;  4KZ8 A;  3ZNT A;  5KMW A;  4LV3 A;  1YLT A;  3Q82 A;  4XXR A;  5CHU A;  1O7E A;  1RGZ A;  4KG6 A;  5FI7 A;  1KE4 A;  2EXB A;  3HUN A;  4D2O A;  3I7J A;  4FH4 A;  3FYZ A;  3IQA A;  1K38 A;  2WAD A;  1IYS A;  1ERQ A;  4R4S A;  3VSL A;  3PBR A;  3VOY A;  1K6S A;  2EFX A;  3ITB A;  3ZHH A;  1W5D A;  2XGN A;  2RCX A;  3PAE A;  1MWU A;  4PM7 A;  3VP2 A;  5F1G A;  4P0M A;  2HP5 A;  1K56 D;  1W8Q A;  1YLJ A;  4KZ9 A;  4BJP A;  4LCM A;  4LV0 A;  2WGW A;  3AGF A;  1SDN A;  5DF9 A;  3PBQ A;  5CTN A;  4FSF A;  4QD4 A;  4HBT A;  1JTD A;  4E3N A;  1IKG A;  5CEB A;  5KSH A;  1PWD A;  5CHM A;  3O87 A;  2XFT A;  4IBR A;  4O7D A;  1DY6 A;  4OON A;  1MY8 A;  1XGI A;  5FQ9 A;  2R9X A;  4KZA A;  1FR6 A;  1MXO A;  1VM1 A;  4S2I A;  1FCN A;  4S2N C;  1LLB A;  3BRM A;  4E6X A;  2XD5 A;  4GNU A;  4RA7 A;  4P85 A;  4UAA A;  2H5S A;  2Y2Q A;  3NCK A;  3NDG A;  4A5R A;  3BM6 A;  2XFS A;  2VGJ A;  4PPR A;  1ONH A;  4DKI A;  1LI0 A;  2X01 A;  4LCL A;  5EVI A;  3W4P A;  5JYP A;  3G4P A;  3O3V A;  5FQK A;  1JTG A;  2ZQD A;  4GOG A;  4DXC A;  2WZZ A;  4EBL A;  1E3U A;  1XP4 A;  3SH9 A;  3BEB A;  2I72 A;  5HAI A;  4MEZ A;  4X53 A;  3BLS A;  4GZB A;  5GLD A;  1BLP A;  1ESI A;  1WE4 A;  3IH8 A;  3NDE A;  5GLC A;  4ZJ3 A;  2Q9M A;  2ZM0 A;  3UDX A;  3VP1 A;  1K4E A;  2Y2K A;  2JCH A;  2ZC4 B;  3NIA A;  4QB8 A;  1Z6F A;  4JXS A;  4WEL A;  3SS4 A;  1K54 A;  1NZO A;  1U60 A;  4RX3 A;  4P87 A;  1LHY A;  2WZX A;  1ES4 A;  1BTL A;  2H0Y A;  4OQ0 A;  4B4X A;  1ES2 A;  5FDH A;  4BL2 A;  4DE3 A;  1QMF A;  4DRT A;  3RXW A;  1KDS A;  1WYB A;  4PM8 A;  3ZVW A;  4JLF A;  1K25 A;  3UE3 A;  5KSC A;  1IEL A;  4KG2 A;  1ESU A;  3Q81 A;  4OQI A;  4QJG A;  4FCF A;  4ID4 A;  4JPM A;  5E2H A;  3IF6 A;  4OVD A;  3IT9 A;  4Y0U A;  5DF7 A;  4JKT A;  4S2L A;  1MBL A;  2ZM2 A;  3BFF A;  5EVI D;  4YIN A;  1K55 C;  3OPR A;  1NXY A;  2XQZ A;  1E3U D;  5FSR A;  3BYD A;  1XKZ A;  2WGI A;  3IF5 A;  4GDB A;  1BUE A;  5FQM A;  1RP5 A;  1CEG A;  4DF6 A;  4WZ5 A;  3ZG7 B;  4RYE A;  3OPP A;  4OH0 A;  4KG5 A;  3N6I A;  3HLW A;  1HVB A;  1I5Q A;  2V1Z A;  3M6H A;  4N1X A;  4BD0 A;  5HW3 A;  1DJB A;  4GB7 A;  4WYY A;  3GV9 A;  3IXH A;  2H0T A;  3HRE A;  4BLM A;  3NY4 A;  1TDG A;  2ZQ7 A;  3DW0 A;  4NK3 A;  2WUQ A;  3HUM A;  2BLS A;  2CC1 A;  4EUZ A;  2FFY A;  4XUX A;  4OOL A;  1PZO A;  3GTC A;  4MBK A;  3PAG A;  1I2W A;  1G68 A;  3HLD A;  3JYI A;  4S2M A;  5FI2 A;  3UNW A;  4EBN A;  2XDM A;  1C3B A;  4ZJ2 A;  1TDL A;  3G30 A;  4WZ4 A;  5FAT A;  3A3D A;  2Z2M B;  3LY4 A;  3WWX A;  3RXX A;  3C4O A;  1MKI A;  1HZO A;  3DWK A;  1PIO A;  1RCJ A;  1S6R A;  5A92 A;  2Y2I A;  4E3K A;  1YM1 A;  2Z2L B;  4FH2 A;  4UA9 A;  1BLS A;  2G2W A;  3MKF A;  1ZG4 A;  1EWZ A;  4K0W A;  4KZ4 A;  1L0F A;  4KQQ A;  4QY6 A;  5CGW A;  3ZDJ A;  2ZMA A;  4KZ6 A;  4IVI A;  3WRZ A;  3ZCZ A;  4U0T A;  1FR1 A;  2G2U A;  2J8Y A;  1AXB A;  3MFD A;  3BFE A;  1YMX A;  2ZQA A;  4HEF A;  5FQQ A;  5CRF A;  5DF8 A;  4OP5 A;  3SOI A;  1ZG6 A;  4NET A;  1LI9 A;  4X68 A;  1ONG A;  4ZTK A;  4OQH A;  3TSG A;  3HVF A;  3MXS A;  3DTM A;  5G18 A;  3G31 A;  1M40 A;  3GR2 A;  5FAP A;  4CJN A;  4DDY A;  5J8X A;  1W79 A;  4R23 A;  3IXB A;  3UDI A;  4E6W A;  4K0X A;  1HTZ A;  4R0Q A;  3VFF A;  2XK1 A;  1NYM A;  2JE5 A;  3PBS A;  3QNB A;  1GHM A;  4S2P A;  5EE8 A;  4JBF A;  2ZJ9 A;  1KGE A;  2J9P A;  3VFH A;  1K57 A;  4KZB A;  1GA0 A;  4GD6 A;  5I94 A;  3OC2 A;  5DTS A;  2HDS A;  3N8L A;  3ZVT A;  4OPQ A;  3IH9 A;  1XA7 A;  3CZD A;  4ZDX A;  2Y59 A;  1YLZ A;  4JF4 A;  3W4Q A;  4OPR A;  2Y4A A;  4GDN A;  4OOY A;  3GSG A;  1JWP A;  3CG5 A;  2PBY A;  3ZG5 A;  3UO9 A;  1XPB A;  4Z9Q A;  4N9K A;  5GHZ A;  3DWZ A;  4DE1 A;  2ZC7 A;  2X02 A;  3TOI A;  3WS0 A;  4C6Y A;  4OP8 A;  3ZG9 B;  1YT4 A;  3P98 A;  2P9V A;  3Q7V A;  5EOE A;  2IWD A;  4WEK A;  4HES A;  3C4P A;  3FKW A;  3UDF A;  1BLC A;  1Q2Q A;  3A3I A;  4U0X A;  1OME A;  3VP3 A;  3O86 A;  4OPZ A;  1NYY A;  1FSY A;  4MNR A;  3VP0 A;  4K91 A;  5HFO A;  4OLG A;  3G2Z A;  4C3Q A;  1BT5 A;  4PM6 A;  3N7W A;  1BSG A;  3UN7 A;  3D4F A;  3IXD A;  2HDU A;  2ZQ8 A;  4KZ5 A;  3RJU A;  5IHV A;  3FZC A;  4YFM A;  2Y2H A;  1VQQ A;  1LL9 A;  5L2F A;  1RGY A;  2ZD8 A;  3IWI A;  4EWF A;  5F83 A;  2Q9N A;  5CER A;  3UY6 A;  4PMA A;  5HAP A;  5CHJ A;  4ZJ1 A;  3M6B A;  1KE3 A;  3A3J A;  4UHU A;  4IBX A;  1NJ4 A;  4R4R A;  4DE2 A;  1LL5 A;  1DJA A;  1I2S A;  3HLE A;  4GN2 A;  2ZQ9 A;  2J7V A;  1DJC A;  2ZC5 B;  1J9M A;  1CI9 A;  3ITA A;  1N9B A;  4R1G A;  1L0G A;  4S2N A;  3NBL A;  3FKV A;  3NI9 A;  3WS2 A;  5E43 A;  4E3L A;  3MZD A;  4BD1 A;  1CEF A;  1PI4 A;  1NZU A;  3HLF A;  2RL3 A;  3UPO A;  5FA7 A;  3GVB A;  1YQS A;  1ES5 A;  1PWC A;  1L0E A;  4S2J A;  3AGE A;  1YLW A;  5EPH A;  3PBO A;  3MZF A;  1IYQ A;  3VSK A;  1H8Y A;  2OLV A;  2WGW B;  4OLD A;  1YLP A;  2QZ6 A;  3G2Y A;  2FFF B;  4IVK A;  5JYO A;  1YLY A;  3V5M A;  4WMC D;  3ZFZ A;  5HAQ A;  2OV5 A;  5GHY A;  3GQZ A;  1BUL A;  2QMI A;  2HDQ A;  4HBU A;  4N92 A;  3SS3 A;  4LEN A;  5HAR A;  4PM9 A;  2A3U A;  4JXG A;  3N8S A;  3IWO A;  4X56 A;  3ZGA B;  3QHY A;  2Y2P A;  4Y0O A;  5CED A;  3C7U A;  1MWR A;  5GLB A;  3B3X A;  1K4F A;  2Y55 A;  3LEZ A;  4QY5 A;  1SDE A;  2WK0 A;  2WKE A;  5EVI B;  2OLU A;  4H8R A;  4KQR A;  2Y2M A;  2ZQC A;  1PZP A;  5GL9 A;  4JF5 A;  3NC8 A;  3S22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...