3G4SE

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3g4sE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3g4sE01
3G4SE 1K8AG 3CCRE 1YIJE 3CCQE 1VQKE 1JJ2E 3CD6E 4WF9E 3G6EE 1KD1G 3I55E 3CCJE 4WFNE 1VQOE 3J7ZG 1M90G 1VQME 5GAGG 1N8RG 4U67E 1QVGE 3CC2E 2QA4E 4WCEE 1VQ6E 2QEXE 1Q86G 4WFAE 2CQLA 1K9MG 3PIOE 1YJNE 4IOAE 2ZJPE 3CCSE 1YJ9E 1VQ8E 3OW2E 3CXCE 5GAHG 4WFBE 5JVHE 1KQSE 1VQNE 1S72E 3I56E 1RL6A 2OTLE 5JVGE 5HL7E 2ZJRE 4IO9E 4IOCE 1Q81G 1YHQE 5GAEG 5AN9B 1YI2E 3CCUE 1VQ5E 5MLCH 5H1SI 5GADG 3CC7E 1VQ7E 5DM6E 5DM7E 3CCLE 2OTJE 3PIPE 3CMAE 3CC4E 3CCEE 1VQPE 1M1KG 3CMEE 1VQ4E 1VQ9E 1Q82G 1Q7YG 1YJWE 3CPWE 1KC8G 3CCVE 1YITE 3G71E 3CF5E 1W2BE 1NJIG 2ZJQE 4UY8G 1VQLE 3DLLE 1QVFE 1K73G 3CCME
chains in the Genus database with same CATH superfamily
3G4SE 1K8AG 3CCRE 1YIJE 2AF5A 3CCQE 1VQKE 1JJ2E 3CD6E 4WF9E 3IG9A 3G6EE 1KD1G 3I55E 3EC5A 3CCJE 3CKGA 4WFNE 1VQOE 3J7ZG 1M90G 2FKJA 1VQME 2OL8O 5GAGG 2I5VO 1N8RG 4U67E 1QVGE 3CC2E 2QA4E 3CKFA 2OY7A 2OY8A 4WCEE 1VQ6E 2QEXE 5B11O 1Q86G 4WFAE 2CQLA 2OY1O 2I5ZO 3PIOE 1YJNE 1K9MG 4IOAE 2ZJPE 3CCSE 1YJ9E 2FKGA 1VQ8E 3OW2E 3CXCE 5GAHG 4WFBE 5JVHE 1KQSE 2OY5O 1VQNE 1S72E 3I56E 1RL6A 2OTLE 5B10O 5JVGE 5HL7E 1P4PA 2ZJRE 4IO9E 2OL6O 4IOCE 1Q81G 1YHQE 5B3MO 5GAEG 1FJ1E 2PI3O 5AN9B 1YI2E 3CCUE 1VQ5E 5MLCH 5H1SI 5GADG 3CC7E 1VQ7E 5B2AO 5DM6E 5DM7E 3CCLE 2OTJE 3PIPE 3CMAE 3CC4E 3AUMO 3CCEE 1VQPE 1M1KG 1RJLC 3CMEE 1VQ4E 1VQ9E 1Q82G 1Q7YG 1YJWE 3CPWE 2OL7A 1KC8G 3CCVE 1YITE 1OSPO 3G71E 3CF5E 1W2BE 1NJIG 2OYBO 2ZJQE 4UY8G 1VQLE 3DLLE 1QVFE 2G8CO 3IGEA 1K73G 3CCME 2HKDA
chains in the Genus database with same CATH topology
3G4SE 1K8AG 3CCRE 1YIJE 3CCQE 1VQKE 1JJ2E 3CD6E 4WF9E 3G6EE 1KD1G 3I55E 3CCJE 4WFNE 1VQOE 3J7ZG 1M90G 1VQME 5GAGG 1N8RG 4U67E 1QVGE 3CC2E 2QA4E 4WCEE 1VQ6E 2QEXE 1Q86G 4WFAE 2CQLA 1K9MG 3PIOE 1YJNE 4IOAE 2ZJPE 3CCSE 1YJ9E 1VQ8E 3OW2E 3CXCE 5GAHG 4WFBE 5JVHE 1KQSE 1VQNE 1S72E 3I56E 1RL6A 2OTLE 5JVGE 5HL7E 2ZJRE 4IO9E 4IOCE 1Q81G 1YHQE 5GAEG 5AN9B 1YI2E 3CCUE 1VQ5E 5MLCH 5H1SI 5GADG 3CC7E 1VQ7E 5DM6E 5DM7E 3CCLE 2OTJE 3PIPE 3CMAE 3CC4E 3CCEE 1VQPE 1M1KG 3CMEE 1VQ4E 1VQ9E 1Q82G 1Q7YG 1YJWE 3CPWE 1KC8G 3CCVE 1YITE 3G71E 3CF5E 1W2BE 1NJIG 2ZJQE 4UY8G 1VQLE 3DLLE 1QVFE 1K73G 3CCME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S E;  1K8A G;  3CCR E;  1YIJ E;  3CCQ E;  1VQK E;  1JJ2 E;  3CD6 E;  4WF9 E;  3G6E E;  1KD1 G;  3I55 E;  3CCJ E;  4WFN E;  1VQO E;  3J7Z G;  1M90 G;  1VQM E;  5GAG G;  1N8R G;  4U67 E;  1QVG E;  3CC2 E;  2QA4 E;  4WCE E;  1VQ6 E;  2QEX E;  1Q86 G;  4WFA E;  2CQL A;  1K9M G;  3PIO E;  1YJN E;  4IOA E;  2ZJP E;  3CCS E;  1YJ9 E;  1VQ8 E;  3OW2 E;  3CXC E;  5GAH G;  4WFB E;  5JVH E;  1KQS E;  1VQN E;  1S72 E;  3I56 E;  1RL6 A;  2OTL E;  5JVG E;  5HL7 E;  2ZJR E;  4IO9 E;  4IOC E;  1Q81 G;  1YHQ E;  5GAE G;  5AN9 B;  1YI2 E;  3CCU E;  1VQ5 E;  5MLC H;  5H1S I;  5GAD G;  3CC7 E;  1VQ7 E;  5DM6 E;  5DM7 E;  3CCL E;  2OTJ E;  3PIP E;  3CMA E;  3CC4 E;  3CCE E;  1VQP E;  1M1K G;  3CME E;  1VQ4 E;  1VQ9 E;  1Q82 G;  1Q7Y G;  1YJW E;  3CPW E;  1KC8 G;  3CCV E;  1YIT E;  3G71 E;  3CF5 E;  1W2B E;  1NJI G;  2ZJQ E;  4UY8 G;  1VQL E;  3DLL E;  1QVF E;  1K73 G;  3CCM E; 
#chains in the Genus database with same CATH topology
 3G4S E;  1K8A G;  3CCR E;  1YIJ E;  2AF5 A;  3CCQ E;  1VQK E;  1JJ2 E;  3CD6 E;  4WF9 E;  3IG9 A;  3G6E E;  1KD1 G;  3I55 E;  3EC5 A;  3CCJ E;  3CKG A;  4WFN E;  1VQO E;  3J7Z G;  1M90 G;  2FKJ A;  1VQM E;  2OL8 O;  5GAG G;  2I5V O;  1N8R G;  4U67 E;  1QVG E;  3CC2 E;  2QA4 E;  3CKF A;  2OY7 A;  2OY8 A;  4WCE E;  1VQ6 E;  2QEX E;  5B11 O;  1Q86 G;  4WFA E;  2CQL A;  2OY1 O;  2I5Z O;  3PIO E;  1YJN E;  1K9M G;  4IOA E;  2ZJP E;  3CCS E;  1YJ9 E;  2FKG A;  1VQ8 E;  3OW2 E;  3CXC E;  5GAH G;  4WFB E;  5JVH E;  1KQS E;  2OY5 O;  1VQN E;  1S72 E;  3I56 E;  1RL6 A;  2OTL E;  5B10 O;  5JVG E;  5HL7 E;  1P4P A;  2ZJR E;  4IO9 E;  2OL6 O;  4IOC E;  1Q81 G;  1YHQ E;  5B3M O;  5GAE G;  1FJ1 E;  2PI3 O;  5AN9 B;  1YI2 E;  3CCU E;  1VQ5 E;  5MLC H;  5H1S I;  5GAD G;  3CC7 E;  1VQ7 E;  5B2A O;  5DM6 E;  5DM7 E;  3CCL E;  2OTJ E;  3PIP E;  3CMA E;  3CC4 E;  3AUM O;  3CCE E;  1VQP E;  1M1K G;  1RJL C;  3CME E;  1VQ4 E;  1VQ9 E;  1Q82 G;  1Q7Y G;  1YJW E;  3CPW E;  2OL7 A;  1KC8 G;  3CCV E;  1YIT E;  1OSP O;  3G71 E;  3CF5 E;  1W2B E;  1NJI G;  2OYB O;  2ZJQ E;  4UY8 G;  1VQL E;  3DLL E;  1QVF E;  2G8C O;  3IGE A;  1K73 G;  3CCM E;  2HKD A; 
#chains in the Genus database with same CATH homology
 3G4S E;  1K8A G;  3CCR E;  1YIJ E;  3CCQ E;  1VQK E;  1JJ2 E;  3CD6 E;  4WF9 E;  3G6E E;  1KD1 G;  3I55 E;  3CCJ E;  4WFN E;  1VQO E;  3J7Z G;  1M90 G;  1VQM E;  5GAG G;  1N8R G;  4U67 E;  1QVG E;  3CC2 E;  2QA4 E;  4WCE E;  1VQ6 E;  2QEX E;  1Q86 G;  4WFA E;  2CQL A;  1K9M G;  3PIO E;  1YJN E;  4IOA E;  2ZJP E;  3CCS E;  1YJ9 E;  1VQ8 E;  3OW2 E;  3CXC E;  5GAH G;  4WFB E;  5JVH E;  1KQS E;  1VQN E;  1S72 E;  3I56 E;  1RL6 A;  2OTL E;  5JVG E;  5HL7 E;  2ZJR E;  4IO9 E;  4IOC E;  1Q81 G;  1YHQ E;  5GAE G;  5AN9 B;  1YI2 E;  3CCU E;  1VQ5 E;  5MLC H;  5H1S I;  5GAD G;  3CC7 E;  1VQ7 E;  5DM6 E;  5DM7 E;  3CCL E;  2OTJ E;  3PIP E;  3CMA E;  3CC4 E;  3CCE E;  1VQP E;  1M1K G;  3CME E;  1VQ4 E;  1VQ9 E;  1Q82 G;  1Q7Y G;  1YJW E;  3CPW E;  1KC8 G;  3CCV E;  1YIT E;  3G71 E;  3CF5 E;  1W2B E;  1NJI G;  2ZJQ E;  4UY8 G;  1VQL E;  3DLL E;  1QVF E;  1K73 G;  3CCM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...