3G4SV

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3g4sV00
1N8RW 4WCEV 1M1KW 1VQKV 4WFAV 1VQMV 3CD6V 1K9MW 3CCJV 3CC2V 4WFBV 1NJIW 1KQSU 1KD1W 3CCUV 2QA4V 1YHQV 1YJ9V 1VQ7V 1M90W 1VQ9V 1VQ6V 3CPWU 3I56V 1VQOV 1Q86W 1VQ8V 1K73W 1VQ5V 3CCRV 3CXCU 3CC7V 3CMEV 1KC8W 1JJ2U 1VQ4V 1Q7YW 1QVGU 1VQNV 5DM6V 1YI2V 1Q82W 3G6EV 4WF9V 3I55V 3CMAV 3CCSV 3CCVV 1VQLV 1Q81W 1YIJV 1R73A 1YITV 2OTJV 3CCMV 2D3OW 1W2BU 1K8AW 2OTLV 3G71V 3CCQV 2QEXV 3OW2U 1VQPV 1S72V 1YJWV 1QVFU 3G4SV 3CC4V 1YJNV 3CCLV 3CCEV
chains in the Genus database with same CATH superfamily
3CEIA 3AG2C 5FPOA 1KKDA 2JS3A 1IVSA 3RW0A 5J2UB 2EX3A 1E1RG 4YY3B 2WSSG 5EBLC 5EK0A 1M93A 3N27A 4O4LB 3SYOA 3HKBB 5LP6C 3IFXA 2EIJB 2PTMA 1OCRB 3JASA 3ABUA 2QJ1A 4G28B 3HKEB 3H9VA 3CCRV 4IHJB 3PJSK 5LOVB 4TV8A 4K8XA 4KFMA 2DYRC 1TAEA 4X65B 5IJ0B 1XEQA 2Y0IA 1HWYA 3ZIAG 2ZT9B 1FAFA 2DWDC 1EZJA 1L1FA 1ZL8A 5D5PA 2GV9A 2JEUA 4MTOA 5EYPA 1IZ3A 3CB2A 4RQFA 2N74A 1M1KW 3T2MA 3OT7A 1FPOA 2ZDIC 4LFBB 3JAMN 2JRIA 1GKFA 5FPRA 5JQGB 5EZYB 2L6LA 4CS3A 1QLEB 2JGDA 3W7XA 3AG3C 2YSUB 5KAIZ 3RYCA 1B3QA 2XAFA 1XNRB 1P84F 2JJ1G 3RVZA 4I9QA 1OJHA 4PELA 4DW1A 1MABG 1XUQA 1JJ2U 3OFNG 2ZR2A 4J9ZB 1AR1B 2E5LB 1GH6A 1N36B 3W7TA 2K1EA 4YIPA 4FM1A 1LNQA 2HHHB 1W0KG 4B7KA 1B04A 4MTGA 3SYQA 1PM9A 4YJ3A 3G4SV 4KHPB 1F4NA 5A9GA 4H13B 5ITZB 3T1YB 4NTWA 1QLNA 5LMNB 5KLVH 2Q9LA 3OTFA 5C8YA 4EB6A 4DV0B 1T5EA 2KG7A 5B1NA 1VQ4V 3ASNB 2X7RB 1YIJV 5LHHA 2KB1A 1L0LH 4WFGA 5EC1C 2IJIA 2HG5C 1DLBA 4P30A 4X8AA 3BY6A 1JOYA 4QPKA 1EN4A 3ICXA 4JAAA 1IBLO 4XDLA 1XMQB 3JAKA 5EZYA 1HP8A 2LO1A 4GCZA 5A2QN 5GTHZ 4JV5B 1RSOA 2Q67A 1XNQB 5HFMA 2EZPA 2IJHA 1AI5A 2DJVA 4XBFA 3GVMA 1NT2B 1WNSA 2X6BA 1QQCA 3BPZA 3TGUH 3OGCC 1GMGA 4X1YB 5GW7A 4JI4B 3M8AA 3JD1A 1B06A 2BOBC 1QLEC 3ZBHA 1SZXA 2IBZH 4JASA 5KHJA 2ZE8A 3AG3B 4RUEA 4DR4O 1TVKA 1ZTEA 1AR4A 4JYCA 1QVGU 1ZLZA 3ETDA 2FTKA 4Q20A 4ABMA 4DO2A 2UUAB 2OTJV 2HHHO 3O9OA 1QCEA 2YC0A 1TUEB 3UQ8A 1M57C 4C7UA 1GN2A 1LR1A 3OR6C 2DWEC 1ZSPA 2AHYA 5H6RA 2E74B 2OYQA 3AG1C 1OCRC 1SA0B 4X65O 2UXCB 3H1JH 4WFHA 5H6QA 2Y48A 1THZA 4B3SO 4E4EA 4LF9O 1JA8A 3E35A 4LBEC 3SPJA 2DYRB 3E8HA 1BZKA 2XHBA 5L3DA 1OZ0A 3IC9A 4DV0O 4IL6Z 4OPAA 4TV9A 1RM1B 3ZHVA 3UT5A 1V55C 1WP8A 1FKAO 1NZ6A 3UCSC 3E2EA 2JGUA 4LFCO 4JV5O 2Q5ZA 5JH7A 3RYFB 4ZHQA 3K5OA 3RWRD 4RAIA 2CTRA 2ZE5A 2AGAA 3JD0A 4KXRA 4D7TA 4NXMO 1VQPV 2OCCC 2L35A 2DQ0A 4P9PA 1JR9A 2IU3A 1Q6HA 3B40A 2XUMA 3STLC 1BS3A 5LP6B 1AR5A 4ZI7B 4FMTA 4MTXA 2EIJC 1MSDA 1MZFA 3WG7C 2LQTA 1BT8A 2X0LA 3QVNA 4DV1B 2GDSA 2V7QG 1S5HC 5JWPA 1EFRG 1OCZC 3N2GA 5IY5C 5L3BA 1WAZA 1J5EO 2F23A 3CWBH 3LSUA 5GONB 1NBMG 4MTFA 4LF4B 2UXBO 1VQKV 2FB5A 1SESA 1H2MA 2YICA 3CC2V 1K4CC 1XMOB 4UUJC 2AHZA 3I56V 2WA3A 2WLNA 2QE7G 2EILB 1Y4MA 3DXRA 4I50B 3ASNC 1QHTA 5CBHA 1YITV 2HLDG 1Y76A 4DR6B 1IXBA 1KUQA 2F4VB 1DTOA 1JQ0A 3CJHA 1FFXB 4DR6O 3ZMVA 3K06A 1URFA 3JYCA 3RYFA 5LXTA 4YHHB 3EFFK 3K9AA 4LF7B 1YTFD 1N34O 4R50A 1OCCC 2DMXA 2P4KA 1BHBA 2CTWA 3J81N 5LBQA 4B3TO 3A8TA 2QGNA 4YXWG 2X6AA 1XNRO 1HR0O 1VF5B 5K1XA 4DUZO 1IX9A 5TISZ 2ZR3A 4I55A 2LP7A 5JJNB 5H5NA 2ZQMA 4CS4A 2ZXWB 3C3SA 5E1AC 4TUYB 1Y74A 2LGQA 1RP3B 1M4UA 4TQFA 2LJ2A 5IWAB 3FB6C 1HNWO 1IBMB 1Z5WA 5KHIA 3CHXA 4D7SA 5HFLA 3SJBC 1D5AA 3L75H 3JSNA 1FXKA 3E86A 1UFIA 2KQXA 1EM1A 1AJNA 2DW4A 1G1XB 3B4SA 2OCHA 1PP9H 1XQ8A 2RNBA 1Q6UA 2PI4A 5LXTB 3J80N 1RM1C 3OM3B 2OT5A 3OUFA 4UVCA 4EEQA 3K08A 2QKSA 3E83A 4YIOA 3MAQA 1GN6A 1SETA 5LL6Y 1G6UA 3I5DA 4TT3G 3M99B 2GUZB 2Q8VA 4JI8O 4GKJO 4G27B 3OAAG 3RBZA 1N33O 4JI8B 5EBWC 2HJFC 3MHSC 1KQSU 4J7JA 4R6ZA 1M57B 4MVMA 1N32O 1YZBA 4FJCC 4YHHO 1VIBA 2P67A 4ASUG 4FLVA 3BHPA 5BMVB 4ZBMA 3ZRWA 1XOUA 3G71V 2WLMA 1NH2D 3FYIB 1K5SA 1F51A 3JCUZ 5IYZA 4F6EA 1N8RW 3OTOB 4AI8A 1I5YA 3ZHTA 4TV8B 2ZIMA 3AG7A 1FD9A 3FAVB 1H2NA 3BEHA 4UCVA 4PDRA 3WB0A 2FYUH 3HKCA 1WPBA 2ILMA 4J10A 4CH5A 2UUCB 2R9RB 1MA1A 3EVKA 2JEXA 4DRXA 4X1KA 1YF2A 1B6QA 3K5NA 1PV0A 4LH7A 4LC1A 4WFAV 1JPXA 2QTSA 4CH3A 1QR9A 1TA8A 1F23A 3ZHSA 2GUZA 3ABLB 2Q68A 1R3KC 3GB7C 1XL4A 5B66Z 3AK2A 2ZKOA 4O4HB 2YIBD 1SC5B 5BZBA 5CA1B 1OCZB 1ZWIC 4O4JA 5IY5B 2EIMB 3WU2Z 2CK3G 3LDEA 3K0GA 1WJZA 3R66A 5BMVA 3BRCA 3E22B 3HKEA 4K8ZA 1EN6A 3X2QC 5ITZA 1AP5A 3OMNB 4I0XB 2UUBB 3T1CA 3BA9A 2ADQB 1AI4A 2XTAA 5KX5A 5IYCO 1PL0A 2LW1A 2FL4A 1K73W 2YIBA 1SZTA 1D2DA 1FXHA 2HJDA 1WA8B 2V4DA 4JTDB 1BE3H 4BR6A 1VF6C 1HW7A 3SYCA 2CTPA 3W7SA 1S3JA 4UCUA 3CS5A 4FK5C 3SJQC 3P32A 2RCVA 2ZNJA 4P2ZA 2LFRA 1EZVH 2Q7HA 3VQWA 4KP4A 1NKDA 4WBNA 4Z1MG 2YIDA 2KKWA 2PGGA 4NR1A 1K3EA 4DK0A 2IJJA 2UU9B 4JI6O 2CE4A 2IW5A 3BCCH 3H1HH 1H8HG 5IE9A 4MVSA 1US6A 4JI1B 5FLXN 3CCQV 4ZOLB 1Z2GA 2PI5A 2QKCA 5EIBD 5BY1A 1COWG 2ZXWC 1K9MW 1IBLB 3ZHUA 2OWOA 2B1GA 2VQFO 4HNAA 2B1IA 3F5WC 3N2KB 1LUVA 3RVYA 4H0LB 2H8PC 5C8YB 2F66C 4JI1O 1R73A 1YTFB 3P3NA 1QVFU 2CH7B 3U11A 3RN4A 4X1IA 1O9GA 1F4MA 1XHZA 4NTXA 4B3RO 5E79Z 1VQ9V 1VQ7V 4TWKA 4UB6Z 3SJCC 1AROP 4FFKA 1CEZA 1W0JG 4FLTA 3T1HO 2K9PA 4DR7O 3D3QA 3ETGA 2YIAA 1DK1A 3K3WA 5KHGA 2QWRB 4PDLA 2R70A 3ZRVA 4FZ0A 2BTQA 2EZOA 3UT5B 2WWWA 2XAHA 4FVMA 1VMGA 1WLEA 2XNDG 4FM0A 2QA4V 3G6BA 4J80A 1NVPB 4MVQA 2QWQB 4FZ1A 5AG2A 1YI2V 4ZOLA 1HNXO 4UFZA 3APQA 2BSKA 2OIGA 5GTIZ 4QE7A 3ZN1A 1GAXA 4JI3O 3ZRSA 3CCJV 2QM7A 2NNUA 3FFQA 1YCIA 2LFSA 2Q4PA 2LW7A 3D3IA 3F7YC 2BE3A 3KCYA 1BQZA 1IDSA 3SGIA 3CX5F 1AJQA 2YEVB 3VOUA 4X1IB 2JIZG 3K0DA 5H9CA 3X2QB 3OEHG 3K5MA 1K7DA 3OEEG 3OMIB 4B3RB 2QTOA 1DF4A 2XT9A 2ATKC 4UB8Z 3AG1B 4U3JA 2IJKA 3B8NA 5JJJB 2CUGA 1KBHA 1CXZB 4DR1O 2UUCO 5DN6G 4RO2A 4HBNA 4NVPA 1FFXA 1XILA 3CCEV 4DK1A 4DR2O 3ABTA 3ZEDA 2Q0OC 1N36O 4UCOA 3MHHC 3IGAC 4LNUA 2BSKB 5DM6V 5KMGB 2ZCEA 3RYIA 4MVZA 5LHIA 3JARB 3EXAA 5BR8B 1VQNV 1GTOA 4X20B 2DN9A 2OCCB 4XDKA 3ASOC 3MD0A 4QJFB 1VF7A 5KUMA 3WG7B 4DV4O 3ZX6A 3QNEA 1SQBH 4H44B 1N0JA 2WLIB 4JTCB 5IWAO 1D5NA 2QWNB 1ZUQA 2P22C 3M7MX 1N33B 2YDEA 2Z0AA 5B1AB 2VS0A 4NTYA 2HP8A 5L3EA 3P30A 4JI7O 2IH3C 5CA0A 2Q73A 1M90W 1JFFA 4F6RB 5IDJA 3JATA 4JAUA 5D5QA 3A2FA 3D36C 3CRQA 1YEWA 3C90A 4A5UB 3THOA 2F95B 3DC5A 1YJNV 3BAAA 3K59A 1L0NH 1K4DC 3RYHB 5LGTA 1HDJA 1EN5A 4LNUB 3ML0A 3TXQA 2VWJA 2B9ZA 1BSMA 3ZMTA 5J2UA 1Q7YW 4NKGB 3LSQA 4NXNO 2RQ6A 1OCCB 3JSLA 2Y69C 1PL4A 3CXHF 4O4LA 4DV3B 1P4RA 2F4VO 2W6IG 3B2EE 3VQVA 1MZEA 4DR3B 3H1IH 1PNMA 3JASB 4JYAO 5EIBC 3Q4HA 3K9SA 3C3TA 5DECA 1YSCA 2WLHA 2Y4TA 3ASOB 3UKMA 3OMAB 4JZ2A 3SR2C 3TETA 3AG4B 2F93B 1J5EB 1H8EG 2Z3YA 3OTOO 3CD6V 4I9WA 1KD1W 1YHQV 5H2FZ 3U0ZA 5B1BC 3KCXA 4PDVA 4X62O 5JQGA 2QM8A 4CC5A 2ARHA 1P49A 5LYJA 4I7ZB 2M6YA 2UXCO 5LGUA 4DV7B 4L87A 3CPWU 4U3FH 4DR2B 1BL8A 1IBKO 4R7CA 1KYOF 2YI8A 3BVOA 1HNWB 2Y0PA 1MMMA 1AVMA 4KUMA 3ETQA 1JX9A 3R65A 1N0NA 3LUTB 3J7AU 1QR8A 1UPGA 1R6TA 1GO3F 4LWSB 1AJPA 1L8DA 5CN0A 3FD9A 1KB9F 5IJ9A 4DUZB 1DGSA 4K35A 4Z1VA 1GN3A 2Y4UA 1U97A 1VP7A 1HR0B 2ZM6B 4NXMB 4LF5O 2ETNA 1BMFG 5JCOC 3HKCB 3DC6A 1P7BA 3E8GA 3STZC 1JJOA 4PA4A 2QSAA 4IIJA 5J2TB 4DR5O 4X88A 4MVUA 1GN4A 4EFBA 2QKAA 4DW0A 1GK9A 1WA8A 3ZJZA 2ZIOA 4JI2O 2NN4A 1R6NA 3HR0A 4WF9V 3I55V 5LYJB 1RSOB 1WB8A 2FKXA 1QU7A 4UXNA 4X9QA 1KP2A 3L74H 1JVMA 1IXMA 2B5UA 4N23A 3L72H 4K0KO 2H94A 4PA3A 1BHAA 1YDXA 3WB1A 3UM7A 2CAZC 3K03A 4TSFG 5L3GA 4PD4F 4K3AA 3VBBA 3HKBA 2WAMA 3DTUB 1XMOO 3KKYA 3ABLC 3E22A 1MG1A 3JAWA 1N34B 1S72V 4LWSA 3HKDB 3CE2A 4CZZA 3B09A 3QO7A 1BCCH 3OGIB 5LOVA 3UO2A 3SDLA 1I94B 2EIMC 3TJTA 1SQPH 1E79G 2WA4A 1F7YA 1P7GA 5EBMC 5KX5B 1ZL8B 2CH7A 4HYOA 1XHXA 1H2SB 2QEXV 1R3JC 1TGOA 3PN1A 3FB8C 4DUYB 5LHGA 5J9PC 4N21A 1R3IC 2F1MA 3ZMSA 1V54B 3ZMUA 2GHYA 3AG4C 4DV5B 2E5LO 2VQFB 2WLLB 5B1BB 2PF4E 4NYKA 4X66O 1NI8A 2VRZA 2D3OW 4IGGA 1K8AW 4LF5B 1X59A 2R72A 5B3SC 2P5OA 4GYCB 1FXVA 5CBGA 5IYBO 3W7UA 4KL1A 3ZN0A 2EULA 3LDCA 4ZI7A 5LGNA 1H2LA 4FM2A 2YUAA 4TQDA 1SKVA 4JI2B 3CRCA 4HNAB 2HR3A 4YJ3B 4Q6GA 4GX5A 4WFFA 1W59A 2ZE7A 1WN7A 3BA8A 5IYDO 2YXYA 4WCEV 5LMUO 3DSQA 1AB3A 1N4CA 4EFEA 4O2AA 3CC7V 3E89A 4FLYA 2Z5UA 2PYLA 4DR3O 1XL6A 1S0VA 2E75B 3G80A 3JAKB 4DV3O 2BTQB 2HEPA 4O4IA 1M56C 4U3JB 1R1BA 2WLLA 1SQVH 2MW2B 4XDJA 3CJHB 3F5TA 1NTMH 4DR5B 2AZ0A 1FYJA 1O9HA 4JI5B 1KC8W 4UVBA 4YJ2B 2JK5C 1AI7A 1VF6A 1K5QA 3O65A 1QBZA 2W0XA 4IYIA 3U10A 3K57A 1NS1A 1I08A 4MVRA 4DUYO 2A7WA 4BWAA 1SQFA 1TVKB 3CRAA 2OIEA 5KMGA 5LA6B 4OX9O 3VQXA 4MS2A 4WFEA 1XDCA 5LMNO 3H1LH 4AHCA 4G2KA 2WLKA 4LFAO 1XNQO 4J7KA 1K33A 2R9AA 1IBKB 4LFBO 4TUYA 1IBMO 3ABMC 3OUSA 4DV7O 4YY3O 3JD4A 5CBFA 4JPRA 1VARA 2N04A 4RQEA 4W4KA 4TV9B 1XREA 2OTLV 1LUWA 2UUBO 2O57A 5KHKA 1HNZO 3E8BA 1Q43A 2DYSB 4F6RA 4AILC 1SQQH 4LCUC 4PHZA 2P4VA 3JATB 4YJ2A 1FS0G 5JH7B 2VQEB 1Q90D 3CRRA 2GBOA 2Q0AA 3KZIZ 1M56B 2UXBB 5LP6A 4Z2WA 4GKJB 1J95A 3ABKB 4JF3A 1VQMV 4UV9A 2ITDC 5IT9N 2ZM6O 1VQ8V 1VQ5V 4CH4A 2XAQA 4PI0A 3SPGA 3N2GB 2EINB 3K79A 3RGBA 2R9IA 3P3PA 2NLJC 5JJEB 1G4YB 2PUSA 4LP8A 3QTCA 5JCOA 4I4TB 1NU1H 1K92A 3DXRB 1SERA 3G67A 1ZX3A 2M7WA 2IH1C 3Q4HB 2V1DA 1TUBA 4DV2B 4FLWA 5EC2C 3ZRXA 3NXSA 1RPOA 3B77A 4J11A 2DOSA 4J41A 2P6JA 3FAVA 3GWOA 5DEDA 2GTSA 1OCOB 3ABMB 3UO3A 1NVPD 3H01A 1S76D 5C93A 4J9YB 4X1KB 5B1AC 3JD3A 4O2BA 1K97A 1WPXA 2UXNA 3RYHA 4BAYA 4MW8A 3IC7A 3JALB 2A06H 1VQLV 1PD3A 3CRMA 3QF7A 2F43G 3W7WA 1H2GA 4O4HA 4LFCB 5FNVB 1NJIW 5CA1A 4I55B 2FMLA 4JI3B 5KAFZ 2EIKC 2EJRA 4QGPA 2XAJA 1Y6XA 3MDSA 1FFTB 3CMAV 1Y74B 1Q81W 4I4TA 5B5EZ 4GKKB 4PJ0Z 2Y69B 2NR5A 1GM8A 3L70H 1GM7A 1ORQC 2IU0A 1SF9A 3TXSA 3ZHQA 2CGOA 4I0XA 4U7OA 1YJ9V 1AILA 2QWOB 4LF6B 4LFAB 2A79B 5F2VO 2RDCA 4LF4O 4CC6A 1KMIZ 2H3OA 1NR1A 1SRYA 2CGNA 1CP9A 2DYSC 4DV1O 5BXZA 2EBOA 5L3CA 3RT3C 4NB5A 4BIOA 3D36A 1I94O 3FX7A 2ITCC 2WLJA 4LF8B 2PYJA 5KUKA 1DF5A 4F4LA 4DV2O 4KHPO 2AW9A 4X64O 2BOCC 3ABKC 2P90A 3FYEB 4B3MO 3ZRWB 2VWKA 4OGQB 4PDMA 5IJ9B 5KA5A 1K34A 3AK1A 5IYZB 2EINC 2AZ2A 3HKDA 1FJGO 5IJ0A 4BIZA 4BIUA 3OD4A 2PZSA 1BGYH 3L9DA 3L73H 4EB6B 3NR7A 2EIKB 5EYPB 1GM9A 3LNMB 4B08A 4DRXB 1WB7A 2DE0X 3CCSV 1H38A 1XMQO 4PV1B 2QDOA 3SPIA 4OPHA 3LSSA 2JGDB 1YJWV 2GSMB 3F7VC 4JYBA 3T1HB 2EJ7A 2BCCH 1M9NA 3TK1A 3RYCB 1SS3A 1NTKH 4JI4O 1XI1A 5JVDB 3HB3B 2HVKC 3A0RA 1UJWB 1Y66A 1HNXB 4X1YA 3K58A 4MT8A 3T4DA 3T1YO 4O4JB 2Q69A 1NQTA 4QNHB 5L3FA 1H2KA 3JAWB 1VEWA 4UVAA 4LF6O 3QG5A 4EKWA 3ZCCA 2W6JG 4D6TH 4IYHA 3S3XA 2KG7B 1NTZH 5KA6A 2HVJC 1BQ0A 2CDYA 2UU9O 4UCTA 3CP1A 3CCLV 2YEVA 1SA0A 2P7TC 3JCZA 4QIWF 1V55B 4JYYA 4R8CA 3WFVA 3B8MA 3HPLC 1OCOC 2X6CA 2YXHA 1CPYA 1Q86W 4B3SB 1KECA 4P9OA 1RPRA 4B3MB 1N32B 4H33A 4ICGA 3CCVV 3WB2A 3CCMV 3RFRA 4X66B 2QR4A 2ZE6A 2MK3A 4X64B 2A3QA 1KU9A 4O4IB 3CC4V 4WBNB 4JI5O 3KG2A 3H1KH 1YVWA 1PNKA 2YS8A 4JZGA 4LH6A 2UUAO 2ZDIA 5JVDA 3CCUV 2E76B 1V54C 5FL7G 4DR4B 2XOKG 1G8MA 4FFBB 4JAVA 1PPJH 2DQ3A 4JI6B 4HAMA 1W2BU 1E1QG 2JDIG 3AK3A 4X62B 4HZ3A 1FJGB 1M5IA 4MSWC 2JVDA 2P06A 2ZNIA 2ZD9A 5LA6A 3LNNA 4E2LA 2Q6AA 5B3SB 3ZS8C 5LMUB 2EILC 3N2KA 4X20A 4JI0B 3SYAA 2XAGA 4GX0A 3A0HZ 3SPHA 3GWKC 1KP3A 4DV6O 3CMEV 3IAYA 2CTQA 4DV5O 3LDDA 4O2AB 1SQXH 3K04A 3E8FA 1FXKC 5GONA 3CYOA 4JGSA 4B7EA 1GRJA 3ZMZA 4J7ZA 3K5LA 4LF8O 4GKKO 1VQ6V 2JS5A 3VQYA 2N05A 1YXBA 1RFYA 5CA0B 1Y76B 4UCSA 1SQGA 2KSDA 4CBCA 2RJZA 2G38A 4B3TB 4ZHQB 2RMKB 1R6KA 2JJ2G 4GUNA 4UV8A 2E3CA 3SYPA 1I7FA 2RN9A 1X4TA 3D8CA 4FFBA 3OE7G 1Z5VA 2LGWA 4JYAB 4PA9A 1Q82W 4QE9A 4W4LA 4H37A 3FKSG 3JD2A 4FLUA 1JMKC 2HFEC 1S77D 3OR7C 4K0KB 3ZHRA 3CSXA 2YXLA 4FPPA 4GZRB 4FIPC 3QO8A 1HNZB 4IT5A 3A0BZ 4WFBV 5B1OA 4JI7B 3S3WA 2GTAA 2HKOA 4QPJA 2Q7EA 2PY5A 1ZAUA 4BW5A 3AEIA 4PA6A 2UXDB 1Q5OA 1WP7A 1ROPA 1EBOA 3ETEA 2Q7GA 4I50A 4CH6A 5CMUA 2ODMA 4GLXA 2UXDO 4U7NA 4LF7O 4ZKIA 4AQYB 3SPCA 2ZINA 2QM4A 4MVOA 1NR7A 2A0LA 2XASA 1PNLA 5CB4A 1AI6A 4X89A 4DR1B 4L8JA 3TCUA 3AG2B 1Q6IA 2BTOA 1KKCA 3T4ZA 2W0FC 4DYLA 4NXNB 2IM9A 3APOA 2D2CB 4FLZA 2A9HA 4LR3A 2AXTZ 2UXXA 4O2BB 3SJAC 3QO5A 1PKXA 4OXSA 1R3LC 3JALA 1V9PA 1MNGA 3RYIB 3CXCU 4DV6B 3JARA 4GT1A 1MOFA 2VQEO 1Y67A 4JI0O 2C2AA 4PI2A 1OHHG 5CA3A 1S5LZ 5FNVA 4FLXA 3FB5C 1Q8IA 4DXWA 1S5JA 1I0HA 4TOIA 4J42A 3BABA 5K1PA 1U96A 4LF9B 2WLIA 4AQYO 1I5XA 1JCHA 3L71H 1AP6A 4PA7A 3EHBB 1TUBB 3G6EV 4IHJA 4UCRA 4CS2A 4I5SA 3OW2U 1Q3EA 1FXKB 1ENVA 2YI9A 4MW3A 4GX2A 2WPDG 5CB4B 3IJ4A 1JFFB 3BFRA 4RUFA 4ZIBA 1NH2B 4RWUA 4IIJB 5J2TA 2QWPB 1VQOV 1IURA 4DV4B 5KHHA 4DR7B 1XBLA 4GX1A 3DGEA 1MSWD 4OX9B 1OV9A 1A32A 4BW9A 1QNMA 4JTAB 3FB7C 5BR8O 2ADPA
chains in the Genus database with same CATH topology
1GM7A 1ORQC 1N8RW 2IU0A 3AG2C 1KKDA 5LGUA 4L87A 3RW0A 1I5YA 4U7OA 1YJ9V 3CPWU 1E1RG 1BL8A 3BEHA 2WSSG 4PDRA 4R7CA 5EBLC 5EK0A 2A79B 3SYOA 4KUMA 3R65A 1JX9A 2R9RB 2JEXA 3LUTB 1QR8A 3IFXA 2EIJB 1NR1A 1SRYA 1B6QA 4LC1A 1OCRB 4WFAV 1GO3F 1JPXA 1CP9A 1AJPA 2DYSC 1QR9A 3ABUA 5CN0A 4G28B 1F23A 2EBOA 5L3CA 3CCRV 3PJSK 3ABLB 2Q68A 1R3KC 3GB7C 1XL4A 3D36A 4KFMA 2DYRC 1HWYA 2ITCC 2WLJA 3ZIAG 1BMFG 2DWDC 1EZJA 1L1FA 5KUKA 1DF5A 1P7BA 3E8GA 4F4LA 3STZC 5BZBA 2JEUA 4PA4A 4MTOA 4RQFA 1OCZB 1M1KW 1ZWIC 4MVUA 4X88A 5IY5B 2EIMB 3T2MA 2BOCC 3ABKC 1GK9A 2CK3G 2ZDIC 3ZJZA 2P90A 1GKFA 3FYEB 3LDEA 3K0GA 3ZRWB 1R6NA 4PDMA 1QLEB 5KA5A 4WF9V 3I55V 3W7XA 3AG3C 1K34A 2EINC 3X2QC 4UXNA 2YSUB 1KP2A 3OMNB 1JVMA 4BIZA 1IXMA 2B5UA 4N23A 4BIUA 2XAFA 2H94A 3T1CA 4PA3A 2JJ1G 3RVZA 2EIKB 4PELA 1BHAA 1AI4A 5IYCO 1PL0A 3UM7A 1GM9A 3K03A 4TSFG 5L3GA 1K73W 3LNMB 1MABG 1SZTA 3VBBA 1JJ2U 1FXHA 3OFNG 2ZR2A 4J9ZB 2WAMA 3DTUB 4JTDB 1AR1B 3ABLC 3W7TA 3CCSV 1H38A 3SYCA 2K1EA 1LNQA 3W7SA 1W0KG 1S3JA 1MG1A 3SPIA 4MTGA 3LSSA 1S72V 4FK5C 2GSMB 3F7VC 3SYQA 3G4SV 3SJQC 3P32A 4JYBA 4P2ZA 1F4NA 2LFRA 4CZZA 1M9NA 3QO7A 4KP4A 3TK1A 1QLNA 1NKDA 4Z1MG 2EIMC 1E79G 5B1NA 1VQ4V 3ASNB 5EBMC 3HB3B 1K3EA 2X7RB 2IJJA 2HVKC 2IW5A 3A0RA 4HYOA 1UJWB 1YIJV 1H8HG 5LHHA 4MVSA 1Y66A 2KB1A 3CCQV 4MT8A 1R3JC 2QEXV 3T4DA 4WFGA 3FB8C 5EC1C 2IJIA 2Q69A 1NQTA 5LHGA 4QNHB 5L3FA 2PI5A 2HG5C 1DLBA 4P30A 5J9PC 4N21A 4X8AA 1R3IC 1COWG 3BY6A 3ZMSA 1JOYA 4QPKA 2ZXWC 4UVAA 1V54B 3ZMUA 4XDLA 1K9MW 2GHYA 3AG4C 4GCZA 4EKWA 2B1GA 3ZCCA 2B1IA 2W6JG 3F5WC 2WLLB 2Q67A 3RVYA 2H8PC 5HFMA 2EZPA 5B1BB 2IJHA 1AI5A 1R73A 4XBFA 2D3OW 5KA6A 2HVJC 1K8AW 1YTFB 2X6BA 1QVFU 3CP1A 3CCLV 3OGCC 2YEVA 5B3SC 2P7TC 3JCZA 4QIWF 1GMGA 1V55B 5GW7A 4R8CA 3WFVA 1F4MA 3B8MA 3HPLC 1OCOC 2X6CA 3JD1A 2BOBC 1QLEC 1CPYA 1FXVA 1VQ7V 1VQ9V 4TWKA 4JASA 1Q86W 1AROP 3AG3B 5CBGA 4RUEA 5IYBO 3W7UA 3ZN0A 3LDCA 1KECA 5LGNA 1CEZA 1W0JG 4JYCA 1QVGU 4P9OA 1RPRA 3ETDA 3ETGA 2FTKA 4Q20A 4H33A 3CCVV 2HR3A 4DO2A 3K3WA 2OTJV 3CCMV 1QCEA 4PDLA 2MK3A 3ZRVA 1TUEB 4GX5A 4WFFA 2EZOA 3CC4V 3KG2A 1M57C 2WWWA 5IYDO 2XAHA 4WCEV 1PNKA 3OR6C 2DWEC 2AHYA 5H6RA 1WLEA 2ZDIA 3AG1C 2XNDG 3CCUV 2QA4V 1OCRC 1V54C 1NVPB 5FL7G 4WFHA 5H6QA 4MVQA 2Y48A 3CC7V 3E89A 1THZA 2XOKG 2Z5UA 1G8MA 1YI2V 4JAVA 3E35A 4LBEC 3SPJA 2DQ3A 1XL6A 4HAMA 2DYRB 1E1QG 1W2BU 2JDIG 1S0VA 3E8HA 5L3DA 1OZ0A 4HZ3A 4QE7A 3ZN1A 4MSWC 1RM1B 2ZD9A 4E2LA 1M56C 2Q6AA 3ZRSA 5B3SB 3CCJV 1V55C 2QM7A 2NNUA 2EILC 2WLLA 3SYAA 4XDJA 2XAGA 4GX0A 2LFSA 3SPHA 3E2EA 1KP3A 1KC8W 3CMEV 4UVBA 2JK5C 1AI7A 3D3IA 3F7YC 1K5QA 3LDDA 3K04A 3E8FA 4RAIA 1AJQA 2YEVB 1FXKC 1QBZA 3VOUA 3CYOA 3JD0A 4JGSA 2JIZG 1VQPV 3ZMZA 2OCCC 3K0DA 2DQ0A 4P9PA 5H9CA 2IU3A 3X2QB 4MVRA 3OEHG 1K7DA 3OEEG 3STLC 3OMIB 4FMTA 2QTOA 4MTXA 1DF4A 2EIJC 3WG7C 1VQ6V 2ATKC 3AG1B 2X0LA 2IJKA 4MS2A 4WFEA 3B8NA 2V7QG 1S5HC 5DN6G 1EFRG 4G2KA 1OCZC 4RO2A 2WLKA 4CBCA 5IY5C 5L3BA 1K33A 3CCEV 1R6KA 2JJ2G 1NBMG 4MTFA 4UV8A 3ABTA 1VQKV 3SYPA 1SESA 3CC2V 3ABMC 1K4CC 3OUSA 4UUJC 3MHHC 2AHZA 3I56V 2WLNA 3JD4A 2QE7G 2EILB 1Y4MA 3IGAC 3OE7G 5CBFA 4JPRA 5DM6V 4PA9A 1Q82W 3ASNC 4QE9A 4H37A 3FKSG 5CBHA 3JD2A 4MVZA 1YITV 2HLDG 4RQEA 5LHIA 2HFEC 2OTLV 1S77D 3OR7C 1VQNV 4FPPA 4FIPC 3QO8A 1DTOA 1GTOA 3E8BA 2OCCB 1JQ0A 2DYSB 2Y69B 4XDKA 3ZMVA 3ASOC 3K06A 3MD0A 4LCUC 4WFBV 5B1OA 4QJFB 1FS0G 3JYCA 2HKOA 4QPJA 3EFFK 5KUMA 3WG7B 3K9AA 4BW5A 1YTFD 3AEIA 4PA6A 1OCCC 4R50A 3QNEA 1BHBA 2WLIB 4JTCB 1ROPA 1EBOA 3ETEA 1M56B 5CMUA 4U7NA 5B1AB 5LBQA 4ZKIA 1J95A 5L3EA 3ABKB 3SPCA 4JF3A 1VQMV 4MVOA 1NR7A 2A0LA 2XASA 2ITDC 2IH3C 3P30A 4UV9A 1PNLA 4YXWG 1AI6A 4X89A 1M90W 2X6AA 1VQ8V 1VQ5V 3TCUA 3AG2B 2XAQA 3SPGA 5IDJA 2ZR3A 3T4ZA 2LP7A 2EINB 4JAUA 3K79A 2ZQMA 2R9IA 2W0FC 2NLJC 2ZXWB 5E1AC 1G4YB 2A9HA 1YJNV 4LP8A 2UXXA 3QO5A 1K4DC 5LGTA 1PKXA 1K92A 1SERA 3ML0A 3FB6C 2M7WA 2IH1C 4OXSA 1R3LC 2V1DA 5EC2C 3ZRXA 3ZMTA 3CXCU 1Q7YW 5HFLA 3NXSA 4GT1A 1MOFA 3LSQA 1RPOA 1FXKA 3B77A 2P6JA 1OCCB 3E86A 2C2AA 3GWOA 2Y69C 1OHHG 5CA3A 1AJNA 1OCOB 2DW4A 3ABMB 3FB5C 1P4RA 1NVPD 4DXWA 2W6IG 3H01A 1S76D 2PI4A 5C93A 4J9YB 5B1AC 3JD3A 1RM1C 1K97A 3OM3B 2OT5A 3OUFA 1WPXA 2UXNA 4UVCA 3K08A 1PNMA 2QKSA 2WLIA 3E83A 4BAYA 4MW8A 1I5XA 1JCHA 1SETA 3IC7A 4PA7A 3EHBB 3G6EV 1VQLV 4TT3G 3M99B 1PD3A 1YSCA 2WLHA 4I5SA 3ASOB 3OW2U 3UKMA 2F43G 1FXKB 1ENVA 4MW3A 3W7WA 4GX2A 3OMAB 1H2GA 4G27B 2WPDG 3OAAG 3TETA 3RBZA 3AG4B 1H8EG 2Z3YA 4RUFA 5EBWC 3CD6V 2HJFC 3MHSC 1NJIW 1KQSU 4I9WA 1KD1W 1NH2B 1YHQV 4R6ZA 1M57B 4MVMA 1VQOV 4GX1A 5B1BC 3DGEA 4FJCC 2EIKC 2EJRA 2P67A 1MSWD 4ASUG 2XAJA 4PDVA 1FFTB 3CMAV 2QM8A 4ZBMA 3ZRWA 1Q81W 3G71V 4JTAB 2WLMA 1NH2D 3FYIB 3FB7C 1K5SA 1F51A 1YJWV 1GM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R W;  4WCE V;  1M1K W;  1VQK V;  4WFA V;  1VQM V;  3CD6 V;  1K9M W;  3CCJ V;  3CC2 V;  4WFB V;  1NJI W;  1KQS U;  1KD1 W;  3CCU V;  2QA4 V;  1YHQ V;  1YJ9 V;  1VQ7 V;  1M90 W;  1VQ9 V;  1VQ6 V;  3CPW U;  3I56 V;  1VQO V;  1Q86 W;  1VQ8 V;  1K73 W;  1VQ5 V;  3CCR V;  3CXC U;  3CC7 V;  3CME V;  1KC8 W;  1JJ2 U;  1VQ4 V;  1Q7Y W;  1QVG U;  1VQN V;  5DM6 V;  1YI2 V;  1Q82 W;  3G6E V;  4WF9 V;  3I55 V;  3CMA V;  3CCS V;  3CCV V;  1VQL V;  1Q81 W;  1YIJ V;  1R73 A;  1YIT V;  2OTJ V;  3CCM V;  2D3O W;  1W2B U;  1K8A W;  2OTL V;  3G71 V;  3CCQ V;  2QEX V;  3OW2 U;  1VQP V;  1S72 V;  1YJW V;  1QVF U;  3G4S V;  3CC4 V;  1YJN V;  3CCL V;  3CCE V; 
#chains in the Genus database with same CATH topology
 3CEI A;  3AG2 C;  5FPO A;  1KKD A;  2JS3 A;  1IVS A;  3RW0 A;  5J2U B;  2EX3 A;  1E1R G;  4YY3 B;  2WSS G;  5EBL C;  5EK0 A;  1M93 A;  3N27 A;  4O4L B;  3SYO A;  3HKB B;  5LP6 C;  3IFX A;  2EIJ B;  2PTM A;  1OCR B;  3JAS A;  3ABU A;  2QJ1 A;  4G28 B;  3HKE B;  3H9V A;  3CCR V;  4IHJ B;  3PJS K;  5LOV B;  4TV8 A;  4K8X A;  4KFM A;  2DYR C;  1TAE A;  4X65 B;  5IJ0 B;  1XEQ A;  2Y0I A;  1HWY A;  3ZIA G;  2ZT9 B;  1FAF A;  2DWD C;  1EZJ A;  1L1F A;  1ZL8 A;  5D5P A;  2GV9 A;  2JEU A;  4MTO A;  5EYP A;  1IZ3 A;  3CB2 A;  4RQF A;  2N74 A;  1M1K W;  3T2M A;  3OT7 A;  1FPO A;  2ZDI C;  4LFB B;  3JAM N;  2JRI A;  1GKF A;  5FPR A;  5JQG B;  5EZY B;  2L6L A;  4CS3 A;  1QLE B;  2JGD A;  3W7X A;  3AG3 C;  2YSU B;  5KAI Z;  3RYC A;  1B3Q A;  2XAF A;  1XNR B;  1P84 F;  2JJ1 G;  3RVZ A;  4I9Q A;  1OJH A;  4PEL A;  4DW1 A;  1MAB G;  1XUQ A;  1JJ2 U;  3OFN G;  2ZR2 A;  4J9Z B;  1AR1 B;  2E5L B;  1GH6 A;  1N36 B;  3W7T A;  2K1E A;  4YIP A;  4FM1 A;  1LNQ A;  2HHH B;  1W0K G;  4B7K A;  1B04 A;  4MTG A;  3SYQ A;  1PM9 A;  4YJ3 A;  3G4S V;  4KHP B;  1F4N A;  5A9G A;  4H13 B;  5ITZ B;  3T1Y B;  4NTW A;  1QLN A;  5LMN B;  5KLV H;  2Q9L A;  3OTF A;  5C8Y A;  4EB6 A;  4DV0 B;  1T5E A;  2KG7 A;  5B1N A;  1VQ4 V;  3ASN B;  2X7R B;  1YIJ V;  5LHH A;  2KB1 A;  1L0L H;  4WFG A;  5EC1 C;  2IJI A;  2HG5 C;  1DLB A;  4P30 A;  4X8A A;  3BY6 A;  1JOY A;  4QPK A;  1EN4 A;  3ICX A;  4JAA A;  1IBL O;  4XDL A;  1XMQ B;  3JAK A;  5EZY A;  1HP8 A;  2LO1 A;  4GCZ A;  5A2Q N;  5GTH Z;  4JV5 B;  1RSO A;  2Q67 A;  1XNQ B;  5HFM A;  2EZP A;  2IJH A;  1AI5 A;  2DJV A;  4XBF A;  3GVM A;  1NT2 B;  1WNS A;  2X6B A;  1QQC A;  3BPZ A;  3TGU H;  3OGC C;  1GMG A;  4X1Y B;  5GW7 A;  4JI4 B;  3M8A A;  3JD1 A;  1B06 A;  2BOB C;  1QLE C;  3ZBH A;  1SZX A;  2IBZ H;  4JAS A;  5KHJ A;  2ZE8 A;  3AG3 B;  4RUE A;  4DR4 O;  1TVK A;  1ZTE A;  1AR4 A;  4JYC A;  1QVG U;  1ZLZ A;  3ETD A;  2FTK A;  4Q20 A;  4ABM A;  4DO2 A;  2UUA B;  2OTJ V;  2HHH O;  3O9O A;  1QCE A;  2YC0 A;  1TUE B;  3UQ8 A;  1M57 C;  4C7U A;  1GN2 A;  1LR1 A;  3OR6 C;  2DWE C;  1ZSP A;  2AHY A;  5H6R A;  2E74 B;  2OYQ A;  3AG1 C;  1OCR C;  1SA0 B;  4X65 O;  2UXC B;  3H1J H;  4WFH A;  5H6Q A;  2Y48 A;  1THZ A;  4B3S O;  4E4E A;  4LF9 O;  1JA8 A;  3E35 A;  4LBE C;  3SPJ A;  2DYR B;  3E8H A;  1BZK A;  2XHB A;  5L3D A;  1OZ0 A;  3IC9 A;  4DV0 O;  4IL6 Z;  4OPA A;  4TV9 A;  1RM1 B;  3ZHV A;  3UT5 A;  1V55 C;  1WP8 A;  1FKA O;  1NZ6 A;  3UCS C;  3E2E A;  2JGU A;  4LFC O;  4JV5 O;  2Q5Z A;  5JH7 A;  3RYF B;  4ZHQ A;  3K5O A;  3RWR D;  4RAI A;  2CTR A;  2ZE5 A;  2AGA A;  3JD0 A;  4KXR A;  4D7T A;  4NXM O;  1VQP V;  2OCC C;  2L35 A;  2DQ0 A;  4P9P A;  1JR9 A;  2IU3 A;  1Q6H A;  3B40 A;  2XUM A;  3STL C;  1BS3 A;  5LP6 B;  1AR5 A;  4ZI7 B;  4FMT A;  4MTX A;  2EIJ C;  1MSD A;  1MZF A;  3WG7 C;  2LQT A;  1BT8 A;  2X0L A;  3QVN A;  4DV1 B;  2GDS A;  2V7Q G;  1S5H C;  5JWP A;  1EFR G;  1OCZ C;  3N2G A;  5IY5 C;  5L3B A;  1WAZ A;  1J5E O;  2F23 A;  3CWB H;  3LSU A;  5GON B;  1NBM G;  4MTF A;  4LF4 B;  2UXB O;  1VQK V;  2FB5 A;  1SES A;  1H2M A;  2YIC A;  3CC2 V;  1K4C C;  1XMO B;  4UUJ C;  2AHZ A;  3I56 V;  2WA3 A;  2WLN A;  2QE7 G;  2EIL B;  1Y4M A;  3DXR A;  4I50 B;  3ASN C;  1QHT A;  5CBH A;  1YIT V;  2HLD G;  1Y76 A;  4DR6 B;  1IXB A;  1KUQ A;  2F4V B;  1DTO A;  1JQ0 A;  3CJH A;  1FFX B;  4DR6 O;  3ZMV A;  3K06 A;  1URF A;  3JYC A;  3RYF A;  5LXT A;  4YHH B;  3EFF K;  3K9A A;  4LF7 B;  1YTF D;  1N34 O;  4R50 A;  1OCC C;  2DMX A;  2P4K A;  1BHB A;  2CTW A;  3J81 N;  5LBQ A;  4B3T O;  3A8T A;  2QGN A;  4YXW G;  2X6A A;  1XNR O;  1HR0 O;  1VF5 B;  5K1X A;  4DUZ O;  1IX9 A;  5TIS Z;  2ZR3 A;  4I55 A;  2LP7 A;  5JJN B;  5H5N A;  2ZQM A;  4CS4 A;  2ZXW B;  3C3S A;  5E1A C;  4TUY B;  1Y74 A;  2LGQ A;  1RP3 B;  1M4U A;  4TQF A;  2LJ2 A;  5IWA B;  3FB6 C;  1HNW O;  1IBM B;  1Z5W A;  5KHI A;  3CHX A;  4D7S A;  5HFL A;  3SJB C;  1D5A A;  3L75 H;  3JSN A;  1FXK A;  3E86 A;  1UFI A;  2KQX A;  1EM1 A;  1AJN A;  2DW4 A;  1G1X B;  3B4S A;  2OCH A;  1PP9 H;  1XQ8 A;  2RNB A;  1Q6U A;  2PI4 A;  5LXT B;  3J80 N;  1RM1 C;  3OM3 B;  2OT5 A;  3OUF A;  4UVC A;  4EEQ A;  3K08 A;  2QKS A;  3E83 A;  4YIO A;  3MAQ A;  1GN6 A;  1SET A;  5LL6 Y;  1G6U A;  3I5D A;  4TT3 G;  3M99 B;  2GUZ B;  2Q8V A;  4JI8 O;  4GKJ O;  4G27 B;  3OAA G;  3RBZ A;  1N33 O;  4JI8 B;  5EBW C;  2HJF C;  3MHS C;  1KQS U;  4J7J A;  4R6Z A;  1M57 B;  4MVM A;  1N32 O;  1YZB A;  4FJC C;  4YHH O;  1VIB A;  2P67 A;  4ASU G;  4FLV A;  3BHP A;  5BMV B;  4ZBM A;  3ZRW A;  1XOU A;  3G71 V;  2WLM A;  1NH2 D;  3FYI B;  1K5S A;  1F51 A;  3JCU Z;  5IYZ A;  4F6E A;  1N8R W;  3OTO B;  4AI8 A;  1I5Y A;  3ZHT A;  4TV8 B;  2ZIM A;  3AG7 A;  1FD9 A;  3FAV B;  1H2N A;  3BEH A;  4UCV A;  4PDR A;  3WB0 A;  2FYU H;  3HKC A;  1WPB A;  2ILM A;  4J10 A;  4CH5 A;  2UUC B;  2R9R B;  1MA1 A;  3EVK A;  2JEX A;  4DRX A;  4X1K A;  1YF2 A;  1B6Q A;  3K5N A;  1PV0 A;  4LH7 A;  4LC1 A;  4WFA V;  1JPX A;  2QTS A;  4CH3 A;  1QR9 A;  1TA8 A;  1F23 A;  3ZHS A;  2GUZ A;  3ABL B;  2Q68 A;  1R3K C;  3GB7 C;  1XL4 A;  5B66 Z;  3AK2 A;  2ZKO A;  4O4H B;  2YIB D;  1SC5 B;  5BZB A;  5CA1 B;  1OCZ B;  1ZWI C;  4O4J A;  5IY5 B;  2EIM B;  3WU2 Z;  2CK3 G;  3LDE A;  3K0G A;  1WJZ A;  3R66 A;  5BMV A;  3BRC A;  3E22 B;  3HKE A;  4K8Z A;  1EN6 A;  3X2Q C;  5ITZ A;  1AP5 A;  3OMN B;  4I0X B;  2UUB B;  3T1C A;  3BA9 A;  2ADQ B;  1AI4 A;  2XTA A;  5KX5 A;  5IYC O;  1PL0 A;  2LW1 A;  2FL4 A;  1K73 W;  2YIB A;  1SZT A;  1D2D A;  1FXH A;  2HJD A;  1WA8 B;  2V4D A;  4JTD B;  1BE3 H;  4BR6 A;  1VF6 C;  1HW7 A;  3SYC A;  2CTP A;  3W7S A;  1S3J A;  4UCU A;  3CS5 A;  4FK5 C;  3SJQ C;  3P32 A;  2RCV A;  2ZNJ A;  4P2Z A;  2LFR A;  1EZV H;  2Q7H A;  3VQW A;  4KP4 A;  1NKD A;  4WBN A;  4Z1M G;  2YID A;  2KKW A;  2PGG A;  4NR1 A;  1K3E A;  4DK0 A;  2IJJ A;  2UU9 B;  4JI6 O;  2CE4 A;  2IW5 A;  3BCC H;  3H1H H;  1H8H G;  5IE9 A;  4MVS A;  1US6 A;  4JI1 B;  5FLX N;  3CCQ V;  4ZOL B;  1Z2G A;  2PI5 A;  2QKC A;  5EIB D;  5BY1 A;  1COW G;  2ZXW C;  1K9M W;  1IBL B;  3ZHU A;  2OWO A;  2B1G A;  2VQF O;  4HNA A;  2B1I A;  3F5W C;  3N2K B;  1LUV A;  3RVY A;  4H0L B;  2H8P C;  5C8Y B;  2F66 C;  4JI1 O;  1R73 A;  1YTF B;  3P3N A;  1QVF U;  2CH7 B;  3U11 A;  3RN4 A;  4X1I A;  1O9G A;  1F4M A;  1XHZ A;  4NTX A;  4B3R O;  5E79 Z;  1VQ9 V;  1VQ7 V;  4TWK A;  4UB6 Z;  3SJC C;  1ARO P;  4FFK A;  1CEZ A;  1W0J G;  4FLT A;  3T1H O;  2K9P A;  4DR7 O;  3D3Q A;  3ETG A;  2YIA A;  1DK1 A;  3K3W A;  5KHG A;  2QWR B;  4PDL A;  2R70 A;  3ZRV A;  4FZ0 A;  2BTQ A;  2EZO A;  3UT5 B;  2WWW A;  2XAH A;  4FVM A;  1VMG A;  1WLE A;  2XND G;  4FM0 A;  2QA4 V;  3G6B A;  4J80 A;  1NVP B;  4MVQ A;  2QWQ B;  4FZ1 A;  5AG2 A;  1YI2 V;  4ZOL A;  1HNX O;  4UFZ A;  3APQ A;  2BSK A;  2OIG A;  5GTI Z;  4QE7 A;  3ZN1 A;  1GAX A;  4JI3 O;  3ZRS A;  3CCJ V;  2QM7 A;  2NNU A;  3FFQ A;  1YCI A;  2LFS A;  2Q4P A;  2LW7 A;  3D3I A;  3F7Y C;  2BE3 A;  3KCY A;  1BQZ A;  1IDS A;  3SGI A;  3CX5 F;  1AJQ A;  2YEV B;  3VOU A;  4X1I B;  2JIZ G;  3K0D A;  5H9C A;  3X2Q B;  3OEH G;  3K5M A;  1K7D A;  3OEE G;  3OMI B;  4B3R B;  2QTO A;  1DF4 A;  2XT9 A;  2ATK C;  4UB8 Z;  3AG1 B;  4U3J A;  2IJK A;  3B8N A;  5JJJ B;  2CUG A;  1KBH A;  1CXZ B;  4DR1 O;  2UUC O;  5DN6 G;  4RO2 A;  4HBN A;  4NVP A;  1FFX A;  1XIL A;  3CCE V;  4DK1 A;  4DR2 O;  3ABT A;  3ZED A;  2Q0O C;  1N36 O;  4UCO A;  3MHH C;  3IGA C;  4LNU A;  2BSK B;  5DM6 V;  5KMG B;  2ZCE A;  3RYI A;  4MVZ A;  5LHI A;  3JAR B;  3EXA A;  5BR8 B;  1VQN V;  1GTO A;  4X20 B;  2DN9 A;  2OCC B;  4XDK A;  3ASO C;  3MD0 A;  4QJF B;  1VF7 A;  5KUM A;  3WG7 B;  4DV4 O;  3ZX6 A;  3QNE A;  1SQB H;  4H44 B;  1N0J A;  2WLI B;  4JTC B;  5IWA O;  1D5N A;  2QWN B;  1ZUQ A;  2P22 C;  3M7M X;  1N33 B;  2YDE A;  2Z0A A;  5B1A B;  2VS0 A;  4NTY A;  2HP8 A;  5L3E A;  3P30 A;  4JI7 O;  2IH3 C;  5CA0 A;  2Q73 A;  1M90 W;  1JFF A;  4F6R B;  5IDJ A;  3JAT A;  4JAU A;  5D5Q A;  3A2F A;  3D36 C;  3CRQ A;  1YEW A;  3C90 A;  4A5U B;  3THO A;  2F95 B;  3DC5 A;  1YJN V;  3BAA A;  3K59 A;  1L0N H;  1K4D C;  3RYH B;  5LGT A;  1HDJ A;  1EN5 A;  4LNU B;  3ML0 A;  3TXQ A;  2VWJ A;  2B9Z A;  1BSM A;  3ZMT A;  5J2U A;  1Q7Y W;  4NKG B;  3LSQ A;  4NXN O;  2RQ6 A;  1OCC B;  3JSL A;  2Y69 C;  1PL4 A;  3CXH F;  4O4L A;  4DV3 B;  1P4R A;  2F4V O;  2W6I G;  3B2E E;  3VQV A;  1MZE A;  4DR3 B;  3H1I H;  1PNM A;  3JAS B;  4JYA O;  5EIB C;  3Q4H A;  3K9S A;  3C3T A;  5DEC A;  1YSC A;  2WLH A;  2Y4T A;  3ASO B;  3UKM A;  3OMA B;  4JZ2 A;  3SR2 C;  3TET A;  3AG4 B;  2F93 B;  1J5E B;  1H8E G;  2Z3Y A;  3OTO O;  3CD6 V;  4I9W A;  1KD1 W;  1YHQ V;  5H2F Z;  3U0Z A;  5B1B C;  3KCX A;  4PDV A;  4X62 O;  5JQG A;  2QM8 A;  4CC5 A;  2ARH A;  1P49 A;  5LYJ A;  4I7Z B;  2M6Y A;  2UXC O;  5LGU A;  4DV7 B;  4L87 A;  3CPW U;  4U3F H;  4DR2 B;  1BL8 A;  1IBK O;  4R7C A;  1KYO F;  2YI8 A;  3BVO A;  1HNW B;  2Y0P A;  1MMM A;  1AVM A;  4KUM A;  3ETQ A;  1JX9 A;  3R65 A;  1N0N A;  3LUT B;  3J7A U;  1QR8 A;  1UPG A;  1R6T A;  1GO3 F;  4LWS B;  1AJP A;  1L8D A;  5CN0 A;  3FD9 A;  1KB9 F;  5IJ9 A;  4DUZ B;  1DGS A;  4K35 A;  4Z1V A;  1GN3 A;  2Y4U A;  1U97 A;  1VP7 A;  1HR0 B;  2ZM6 B;  4NXM B;  4LF5 O;  2ETN A;  1BMF G;  5JCO C;  3HKC B;  3DC6 A;  1P7B A;  3E8G A;  3STZ C;  1JJO A;  4PA4 A;  2QSA A;  4IIJ A;  5J2T B;  4DR5 O;  4X88 A;  4MVU A;  1GN4 A;  4EFB A;  2QKA A;  4DW0 A;  1GK9 A;  1WA8 A;  3ZJZ A;  2ZIO A;  4JI2 O;  2NN4 A;  1R6N A;  3HR0 A;  4WF9 V;  3I55 V;  5LYJ B;  1RSO B;  1WB8 A;  2FKX A;  1QU7 A;  4UXN A;  4X9Q A;  1KP2 A;  3L74 H;  1JVM A;  1IXM A;  2B5U A;  4N23 A;  3L72 H;  4K0K O;  2H94 A;  4PA3 A;  1BHA A;  1YDX A;  3WB1 A;  3UM7 A;  2CAZ C;  3K03 A;  4TSF G;  5L3G A;  4PD4 F;  4K3A A;  3VBB A;  3HKB A;  2WAM A;  3DTU B;  1XMO O;  3KKY A;  3ABL C;  3E22 A;  1MG1 A;  3JAW A;  1N34 B;  1S72 V;  4LWS A;  3HKD B;  3CE2 A;  4CZZ A;  3B09 A;  3QO7 A;  1BCC H;  3OGI B;  5LOV A;  3UO2 A;  3SDL A;  1I94 B;  2EIM C;  3TJT A;  1SQP H;  1E79 G;  2WA4 A;  1F7Y A;  1P7G A;  5EBM C;  5KX5 B;  1ZL8 B;  2CH7 A;  4HYO A;  1XHX A;  1H2S B;  2QEX V;  1R3J C;  1TGO A;  3PN1 A;  3FB8 C;  4DUY B;  5LHG A;  5J9P C;  4N21 A;  1R3I C;  2F1M A;  3ZMS A;  1V54 B;  3ZMU A;  2GHY A;  3AG4 C;  4DV5 B;  2E5L O;  2VQF B;  2WLL B;  5B1B B;  2PF4 E;  4NYK A;  4X66 O;  1NI8 A;  2VRZ A;  2D3O W;  4IGG A;  1K8A W;  4LF5 B;  1X59 A;  2R72 A;  5B3S C;  2P5O A;  4GYC B;  1FXV A;  5CBG A;  5IYB O;  3W7U A;  4KL1 A;  3ZN0 A;  2EUL A;  3LDC A;  4ZI7 A;  5LGN A;  1H2L A;  4FM2 A;  2YUA A;  4TQD A;  1SKV A;  4JI2 B;  3CRC A;  4HNA B;  2HR3 A;  4YJ3 B;  4Q6G A;  4GX5 A;  4WFF A;  1W59 A;  2ZE7 A;  1WN7 A;  3BA8 A;  5IYD O;  2YXY A;  4WCE V;  5LMU O;  3DSQ A;  1AB3 A;  1N4C A;  4EFE A;  4O2A A;  3CC7 V;  3E89 A;  4FLY A;  2Z5U A;  2PYL A;  4DR3 O;  1XL6 A;  1S0V A;  2E75 B;  3G80 A;  3JAK B;  4DV3 O;  2BTQ B;  2HEP A;  4O4I A;  1M56 C;  4U3J B;  1R1B A;  2WLL A;  1SQV H;  2MW2 B;  4XDJ A;  3CJH B;  3F5T A;  1NTM H;  4DR5 B;  2AZ0 A;  1FYJ A;  1O9H A;  4JI5 B;  1KC8 W;  4UVB A;  4YJ2 B;  2JK5 C;  1AI7 A;  1VF6 A;  1K5Q A;  3O65 A;  1QBZ A;  2W0X A;  4IYI A;  3U10 A;  3K57 A;  1NS1 A;  1I08 A;  4MVR A;  4DUY O;  2A7W A;  4BWA A;  1SQF A;  1TVK B;  3CRA A;  2OIE A;  5KMG A;  5LA6 B;  4OX9 O;  3VQX A;  4MS2 A;  4WFE A;  1XDC A;  5LMN O;  3H1L H;  4AHC A;  4G2K A;  2WLK A;  4LFA O;  1XNQ O;  4J7K A;  1K33 A;  2R9A A;  1IBK B;  4LFB O;  4TUY A;  1IBM O;  3ABM C;  3OUS A;  4DV7 O;  4YY3 O;  3JD4 A;  5CBF A;  4JPR A;  1VAR A;  2N04 A;  4RQE A;  4W4K A;  4TV9 B;  1XRE A;  2OTL V;  1LUW A;  2UUB O;  2O57 A;  5KHK A;  1HNZ O;  3E8B A;  1Q43 A;  2DYS B;  4F6R A;  4AIL C;  1SQQ H;  4LCU C;  4PHZ A;  2P4V A;  3JAT B;  4YJ2 A;  1FS0 G;  5JH7 B;  2VQE B;  1Q90 D;  3CRR A;  2GBO A;  2Q0A A;  3KZI Z;  1M56 B;  2UXB B;  5LP6 A;  4Z2W A;  4GKJ B;  1J95 A;  3ABK B;  4JF3 A;  1VQM V;  4UV9 A;  2ITD C;  5IT9 N;  2ZM6 O;  1VQ8 V;  1VQ5 V;  4CH4 A;  2XAQ A;  4PI0 A;  3SPG A;  3N2G B;  2EIN B;  3K79 A;  3RGB A;  2R9I A;  3P3P A;  2NLJ C;  5JJE B;  1G4Y B;  2PUS A;  4LP8 A;  3QTC A;  5JCO A;  4I4T B;  1NU1 H;  1K92 A;  3DXR B;  1SER A;  3G67 A;  1ZX3 A;  2M7W A;  2IH1 C;  3Q4H B;  2V1D A;  1TUB A;  4DV2 B;  4FLW A;  5EC2 C;  3ZRX A;  3NXS A;  1RPO A;  3B77 A;  4J11 A;  2DOS A;  4J41 A;  2P6J A;  3FAV A;  3GWO A;  5DED A;  2GTS A;  1OCO B;  3ABM B;  3UO3 A;  1NVP D;  3H01 A;  1S76 D;  5C93 A;  4J9Y B;  4X1K B;  5B1A C;  3JD3 A;  4O2B A;  1K97 A;  1WPX A;  2UXN A;  3RYH A;  4BAY A;  4MW8 A;  3IC7 A;  3JAL B;  2A06 H;  1VQL V;  1PD3 A;  3CRM A;  3QF7 A;  2F43 G;  3W7W A;  1H2G A;  4O4H A;  4LFC B;  5FNV B;  1NJI W;  5CA1 A;  4I55 B;  2FML A;  4JI3 B;  5KAF Z;  2EIK C;  2EJR A;  4QGP A;  2XAJ A;  1Y6X A;  3MDS A;  1FFT B;  3CMA V;  1Y74 B;  1Q81 W;  4I4T A;  5B5E Z;  4GKK B;  4PJ0 Z;  2Y69 B;  2NR5 A;  1GM8 A;  3L70 H;  1GM7 A;  1ORQ C;  2IU0 A;  1SF9 A;  3TXS A;  3ZHQ A;  2CGO A;  4I0X A;  4U7O A;  1YJ9 V;  1AIL A;  2QWO B;  4LF6 B;  4LFA B;  2A79 B;  5F2V O;  2RDC A;  4LF4 O;  4CC6 A;  1KMI Z;  2H3O A;  1NR1 A;  1SRY A;  2CGN A;  1CP9 A;  2DYS C;  4DV1 O;  5BXZ A;  2EBO A;  5L3C A;  3RT3 C;  4NB5 A;  4BIO A;  3D36 A;  1I94 O;  3FX7 A;  2ITC C;  2WLJ A;  4LF8 B;  2PYJ A;  5KUK A;  1DF5 A;  4F4L A;  4DV2 O;  4KHP O;  2AW9 A;  4X64 O;  2BOC C;  3ABK C;  2P90 A;  3FYE B;  4B3M O;  3ZRW B;  2VWK A;  4OGQ B;  4PDM A;  5IJ9 B;  5KA5 A;  1K34 A;  3AK1 A;  5IYZ B;  2EIN C;  2AZ2 A;  3HKD A;  1FJG O;  5IJ0 A;  4BIZ A;  4BIU A;  3OD4 A;  2PZS A;  1BGY H;  3L9D A;  3L73 H;  4EB6 B;  3NR7 A;  2EIK B;  5EYP B;  1GM9 A;  3LNM B;  4B08 A;  4DRX B;  1WB7 A;  2DE0 X;  3CCS V;  1H38 A;  1XMQ O;  4PV1 B;  2QDO A;  3SPI A;  4OPH A;  3LSS A;  2JGD B;  1YJW V;  2GSM B;  3F7V C;  4JYB A;  3T1H B;  2EJ7 A;  2BCC H;  1M9N A;  3TK1 A;  3RYC B;  1SS3 A;  1NTK H;  4JI4 O;  1XI1 A;  5JVD B;  3HB3 B;  2HVK C;  3A0R A;  1UJW B;  1Y66 A;  1HNX B;  4X1Y A;  3K58 A;  4MT8 A;  3T4D A;  3T1Y O;  4O4J B;  2Q69 A;  1NQT A;  4QNH B;  5L3F A;  1H2K A;  3JAW B;  1VEW A;  4UVA A;  4LF6 O;  3QG5 A;  4EKW A;  3ZCC A;  2W6J G;  4D6T H;  4IYH A;  3S3X A;  2KG7 B;  1NTZ H;  5KA6 A;  2HVJ C;  1BQ0 A;  2CDY A;  2UU9 O;  4UCT A;  3CP1 A;  3CCL V;  2YEV A;  1SA0 A;  2P7T C;  3JCZ A;  4QIW F;  1V55 B;  4JYY A;  4R8C A;  3WFV A;  3B8M A;  3HPL C;  1OCO C;  2X6C A;  2YXH A;  1CPY A;  1Q86 W;  4B3S B;  1KEC A;  4P9O A;  1RPR A;  4B3M B;  1N32 B;  4H33 A;  4ICG A;  3CCV V;  3WB2 A;  3CCM V;  3RFR A;  4X66 B;  2QR4 A;  2ZE6 A;  2MK3 A;  4X64 B;  2A3Q A;  1KU9 A;  4O4I B;  3CC4 V;  4WBN B;  4JI5 O;  3KG2 A;  3H1K H;  1YVW A;  1PNK A;  2YS8 A;  4JZG A;  4LH6 A;  2UUA O;  2ZDI A;  5JVD A;  3CCU V;  2E76 B;  1V54 C;  5FL7 G;  4DR4 B;  2XOK G;  1G8M A;  4FFB B;  4JAV A;  1PPJ H;  2DQ3 A;  4JI6 B;  4HAM A;  1W2B U;  1E1Q G;  2JDI G;  3AK3 A;  4X62 B;  4HZ3 A;  1FJG B;  1M5I A;  4MSW C;  2JVD A;  2P06 A;  2ZNI A;  2ZD9 A;  5LA6 A;  3LNN A;  4E2L A;  2Q6A A;  5B3S B;  3ZS8 C;  5LMU B;  2EIL C;  3N2K A;  4X20 A;  4JI0 B;  3SYA A;  2XAG A;  4GX0 A;  3A0H Z;  3SPH A;  3GWK C;  1KP3 A;  4DV6 O;  3CME V;  3IAY A;  2CTQ A;  4DV5 O;  3LDD A;  4O2A B;  1SQX H;  3K04 A;  3E8F A;  1FXK C;  5GON A;  3CYO A;  4JGS A;  4B7E A;  1GRJ A;  3ZMZ A;  4J7Z A;  3K5L A;  4LF8 O;  4GKK O;  1VQ6 V;  2JS5 A;  3VQY A;  2N05 A;  1YXB A;  1RFY A;  5CA0 B;  1Y76 B;  4UCS A;  1SQG A;  2KSD A;  4CBC A;  2RJZ A;  2G38 A;  4B3T B;  4ZHQ B;  2RMK B;  1R6K A;  2JJ2 G;  4GUN A;  4UV8 A;  2E3C A;  3SYP A;  1I7F A;  2RN9 A;  1X4T A;  3D8C A;  4FFB A;  3OE7 G;  1Z5V A;  2LGW A;  4JYA B;  4PA9 A;  1Q82 W;  4QE9 A;  4W4L A;  4H37 A;  3FKS G;  3JD2 A;  4FLU A;  1JMK C;  2HFE C;  1S77 D;  3OR7 C;  4K0K B;  3ZHR A;  3CSX A;  2YXL A;  4FPP A;  4GZR B;  4FIP C;  3QO8 A;  1HNZ B;  4IT5 A;  3A0B Z;  4WFB V;  5B1O A;  4JI7 B;  3S3W A;  2GTA A;  2HKO A;  4QPJ A;  2Q7E A;  2PY5 A;  1ZAU A;  4BW5 A;  3AEI A;  4PA6 A;  2UXD B;  1Q5O A;  1WP7 A;  1ROP A;  1EBO A;  3ETE A;  2Q7G A;  4I50 A;  4CH6 A;  5CMU A;  2ODM A;  4GLX A;  2UXD O;  4U7N A;  4LF7 O;  4ZKI A;  4AQY B;  3SPC A;  2ZIN A;  2QM4 A;  4MVO A;  1NR7 A;  2A0L A;  2XAS A;  1PNL A;  5CB4 A;  1AI6 A;  4X89 A;  4DR1 B;  4L8J A;  3TCU A;  3AG2 B;  1Q6I A;  2BTO A;  1KKC A;  3T4Z A;  2W0F C;  4DYL A;  4NXN B;  2IM9 A;  3APO A;  2D2C B;  4FLZ A;  2A9H A;  4LR3 A;  2AXT Z;  2UXX A;  4O2B B;  3SJA C;  3QO5 A;  1PKX A;  4OXS A;  1R3L C;  3JAL A;  1V9P A;  1MNG A;  3RYI B;  3CXC U;  4DV6 B;  3JAR A;  4GT1 A;  1MOF A;  2VQE O;  1Y67 A;  4JI0 O;  2C2A A;  4PI2 A;  1OHH G;  5CA3 A;  1S5L Z;  5FNV A;  4FLX A;  3FB5 C;  1Q8I A;  4DXW A;  1S5J A;  1I0H A;  4TOI A;  4J42 A;  3BAB A;  5K1P A;  1U96 A;  4LF9 B;  2WLI A;  4AQY O;  1I5X A;  1JCH A;  3L71 H;  1AP6 A;  4PA7 A;  3EHB B;  1TUB B;  3G6E V;  4IHJ A;  4UCR A;  4CS2 A;  4I5S A;  3OW2 U;  1Q3E A;  1FXK B;  1ENV A;  2YI9 A;  4MW3 A;  4GX2 A;  2WPD G;  5CB4 B;  3IJ4 A;  1JFF B;  3BFR A;  4RUF A;  4ZIB A;  1NH2 B;  4RWU A;  4IIJ B;  5J2T A;  2QWP B;  1VQO V;  1IUR A;  4DV4 B;  5KHH A;  4DR7 B;  1XBL A;  4GX1 A;  3DGE A;  1MSW D;  4OX9 B;  1OV9 A;  1A32 A;  4BW9 A;  1QNM A;  4JTA B;  3FB7 C;  5BR8 O;  2ADP A; 
#chains in the Genus database with same CATH homology
 1GM7 A;  1ORQ C;  1N8R W;  2IU0 A;  3AG2 C;  1KKD A;  5LGU A;  4L87 A;  3RW0 A;  1I5Y A;  4U7O A;  1YJ9 V;  3CPW U;  1E1R G;  1BL8 A;  3BEH A;  2WSS G;  4PDR A;  4R7C A;  5EBL C;  5EK0 A;  2A79 B;  3SYO A;  4KUM A;  3R65 A;  1JX9 A;  2R9R B;  2JEX A;  3LUT B;  1QR8 A;  3IFX A;  2EIJ B;  1NR1 A;  1SRY A;  1B6Q A;  4LC1 A;  1OCR B;  4WFA V;  1GO3 F;  1JPX A;  1CP9 A;  1AJP A;  2DYS C;  1QR9 A;  3ABU A;  5CN0 A;  4G28 B;  1F23 A;  2EBO A;  5L3C A;  3CCR V;  3PJS K;  3ABL B;  2Q68 A;  1R3K C;  3GB7 C;  1XL4 A;  3D36 A;  4KFM A;  2DYR C;  1HWY A;  2ITC C;  2WLJ A;  3ZIA G;  1BMF G;  2DWD C;  1EZJ A;  1L1F A;  5KUK A;  1DF5 A;  1P7B A;  3E8G A;  4F4L A;  3STZ C;  5BZB A;  2JEU A;  4PA4 A;  4MTO A;  4RQF A;  1OCZ B;  1M1K W;  1ZWI C;  4MVU A;  4X88 A;  5IY5 B;  2EIM B;  3T2M A;  2BOC C;  3ABK C;  1GK9 A;  2CK3 G;  2ZDI C;  3ZJZ A;  2P90 A;  1GKF A;  3FYE B;  3LDE A;  3K0G A;  3ZRW B;  1R6N A;  4PDM A;  1QLE B;  5KA5 A;  4WF9 V;  3I55 V;  3W7X A;  3AG3 C;  1K34 A;  2EIN C;  3X2Q C;  4UXN A;  2YSU B;  1KP2 A;  3OMN B;  1JVM A;  4BIZ A;  1IXM A;  2B5U A;  4N23 A;  4BIU A;  2XAF A;  2H94 A;  3T1C A;  4PA3 A;  2JJ1 G;  3RVZ A;  2EIK B;  4PEL A;  1BHA A;  1AI4 A;  5IYC O;  1PL0 A;  3UM7 A;  1GM9 A;  3K03 A;  4TSF G;  5L3G A;  1K73 W;  3LNM B;  1MAB G;  1SZT A;  3VBB A;  1JJ2 U;  1FXH A;  3OFN G;  2ZR2 A;  4J9Z B;  2WAM A;  3DTU B;  4JTD B;  1AR1 B;  3ABL C;  3W7T A;  3CCS V;  1H38 A;  3SYC A;  2K1E A;  1LNQ A;  3W7S A;  1W0K G;  1S3J A;  1MG1 A;  3SPI A;  4MTG A;  3LSS A;  1S72 V;  4FK5 C;  2GSM B;  3F7V C;  3SYQ A;  3G4S V;  3SJQ C;  3P32 A;  4JYB A;  4P2Z A;  1F4N A;  2LFR A;  4CZZ A;  1M9N A;  3QO7 A;  4KP4 A;  3TK1 A;  1QLN A;  1NKD A;  4Z1M G;  2EIM C;  1E79 G;  5B1N A;  1VQ4 V;  3ASN B;  5EBM C;  3HB3 B;  1K3E A;  2X7R B;  2IJJ A;  2HVK C;  2IW5 A;  3A0R A;  4HYO A;  1UJW B;  1YIJ V;  1H8H G;  5LHH A;  4MVS A;  1Y66 A;  2KB1 A;  3CCQ V;  4MT8 A;  1R3J C;  2QEX V;  3T4D A;  4WFG A;  3FB8 C;  5EC1 C;  2IJI A;  2Q69 A;  1NQT A;  5LHG A;  4QNH B;  5L3F A;  2PI5 A;  2HG5 C;  1DLB A;  4P30 A;  5J9P C;  4N21 A;  4X8A A;  1R3I C;  1COW G;  3BY6 A;  3ZMS A;  1JOY A;  4QPK A;  2ZXW C;  4UVA A;  1V54 B;  3ZMU A;  4XDL A;  1K9M W;  2GHY A;  3AG4 C;  4GCZ A;  4EKW A;  2B1G A;  3ZCC A;  2B1I A;  2W6J G;  3F5W C;  2WLL B;  2Q67 A;  3RVY A;  2H8P C;  5HFM A;  2EZP A;  5B1B B;  2IJH A;  1AI5 A;  1R73 A;  4XBF A;  2D3O W;  5KA6 A;  2HVJ C;  1K8A W;  1YTF B;  2X6B A;  1QVF U;  3CP1 A;  3CCL V;  3OGC C;  2YEV A;  5B3S C;  2P7T C;  3JCZ A;  4QIW F;  1GMG A;  1V55 B;  5GW7 A;  4R8C A;  3WFV A;  1F4M A;  3B8M A;  3HPL C;  1OCO C;  2X6C A;  3JD1 A;  2BOB C;  1QLE C;  1CPY A;  1FXV A;  1VQ7 V;  1VQ9 V;  4TWK A;  4JAS A;  1Q86 W;  1ARO P;  3AG3 B;  5CBG A;  4RUE A;  5IYB O;  3W7U A;  3ZN0 A;  3LDC A;  1KEC A;  5LGN A;  1CEZ A;  1W0J G;  4JYC A;  1QVG U;  4P9O A;  1RPR A;  3ETD A;  3ETG A;  2FTK A;  4Q20 A;  4H33 A;  3CCV V;  2HR3 A;  4DO2 A;  3K3W A;  2OTJ V;  3CCM V;  1QCE A;  4PDL A;  2MK3 A;  3ZRV A;  1TUE B;  4GX5 A;  4WFF A;  2EZO A;  3CC4 V;  3KG2 A;  1M57 C;  2WWW A;  5IYD O;  2XAH A;  4WCE V;  1PNK A;  3OR6 C;  2DWE C;  2AHY A;  5H6R A;  1WLE A;  2ZDI A;  3AG1 C;  2XND G;  3CCU V;  2QA4 V;  1OCR C;  1V54 C;  1NVP B;  5FL7 G;  4WFH A;  5H6Q A;  4MVQ A;  2Y48 A;  3CC7 V;  3E89 A;  1THZ A;  2XOK G;  2Z5U A;  1G8M A;  1YI2 V;  4JAV A;  3E35 A;  4LBE C;  3SPJ A;  2DQ3 A;  1XL6 A;  4HAM A;  2DYR B;  1E1Q G;  1W2B U;  2JDI G;  1S0V A;  3E8H A;  5L3D A;  1OZ0 A;  4HZ3 A;  4QE7 A;  3ZN1 A;  4MSW C;  1RM1 B;  2ZD9 A;  4E2L A;  1M56 C;  2Q6A A;  3ZRS A;  5B3S B;  3CCJ V;  1V55 C;  2QM7 A;  2NNU A;  2EIL C;  2WLL A;  3SYA A;  4XDJ A;  2XAG A;  4GX0 A;  2LFS A;  3SPH A;  3E2E A;  1KP3 A;  1KC8 W;  3CME V;  4UVB A;  2JK5 C;  1AI7 A;  3D3I A;  3F7Y C;  1K5Q A;  3LDD A;  3K04 A;  3E8F A;  4RAI A;  1AJQ A;  2YEV B;  1FXK C;  1QBZ A;  3VOU A;  3CYO A;  3JD0 A;  4JGS A;  2JIZ G;  1VQP V;  3ZMZ A;  2OCC C;  3K0D A;  2DQ0 A;  4P9P A;  5H9C A;  2IU3 A;  3X2Q B;  4MVR A;  3OEH G;  1K7D A;  3OEE G;  3STL C;  3OMI B;  4FMT A;  2QTO A;  4MTX A;  1DF4 A;  2EIJ C;  3WG7 C;  1VQ6 V;  2ATK C;  3AG1 B;  2X0L A;  2IJK A;  4MS2 A;  4WFE A;  3B8N A;  2V7Q G;  1S5H C;  5DN6 G;  1EFR G;  4G2K A;  1OCZ C;  4RO2 A;  2WLK A;  4CBC A;  5IY5 C;  5L3B A;  1K33 A;  3CCE V;  1R6K A;  2JJ2 G;  1NBM G;  4MTF A;  4UV8 A;  3ABT A;  1VQK V;  3SYP A;  1SES A;  3CC2 V;  3ABM C;  1K4C C;  3OUS A;  4UUJ C;  3MHH C;  2AHZ A;  3I56 V;  2WLN A;  3JD4 A;  2QE7 G;  2EIL B;  1Y4M A;  3IGA C;  3OE7 G;  5CBF A;  4JPR A;  5DM6 V;  4PA9 A;  1Q82 W;  3ASN C;  4QE9 A;  4H37 A;  3FKS G;  5CBH A;  3JD2 A;  4MVZ A;  1YIT V;  2HLD G;  4RQE A;  5LHI A;  2HFE C;  2OTL V;  1S77 D;  3OR7 C;  1VQN V;  4FPP A;  4FIP C;  3QO8 A;  1DTO A;  1GTO A;  3E8B A;  2OCC B;  1JQ0 A;  2DYS B;  2Y69 B;  4XDK A;  3ZMV A;  3ASO C;  3K06 A;  3MD0 A;  4LCU C;  4WFB V;  5B1O A;  4QJF B;  1FS0 G;  3JYC A;  2HKO A;  4QPJ A;  3EFF K;  5KUM A;  3WG7 B;  3K9A A;  4BW5 A;  1YTF D;  3AEI A;  4PA6 A;  1OCC C;  4R50 A;  3QNE A;  1BHB A;  2WLI B;  4JTC B;  1ROP A;  1EBO A;  3ETE A;  1M56 B;  5CMU A;  4U7N A;  5B1A B;  5LBQ A;  4ZKI A;  1J95 A;  5L3E A;  3ABK B;  3SPC A;  4JF3 A;  1VQM V;  4MVO A;  1NR7 A;  2A0L A;  2XAS A;  2ITD C;  2IH3 C;  3P30 A;  4UV9 A;  1PNL A;  4YXW G;  1AI6 A;  4X89 A;  1M90 W;  2X6A A;  1VQ8 V;  1VQ5 V;  3TCU A;  3AG2 B;  2XAQ A;  3SPG A;  5IDJ A;  2ZR3 A;  3T4Z A;  2LP7 A;  2EIN B;  4JAU A;  3K79 A;  2ZQM A;  2R9I A;  2W0F C;  2NLJ C;  2ZXW B;  5E1A C;  1G4Y B;  2A9H A;  1YJN V;  4LP8 A;  2UXX A;  3QO5 A;  1K4D C;  5LGT A;  1PKX A;  1K92 A;  1SER A;  3ML0 A;  3FB6 C;  2M7W A;  2IH1 C;  4OXS A;  1R3L C;  2V1D A;  5EC2 C;  3ZRX A;  3ZMT A;  3CXC U;  1Q7Y W;  5HFL A;  3NXS A;  4GT1 A;  1MOF A;  3LSQ A;  1RPO A;  1FXK A;  3B77 A;  2P6J A;  1OCC B;  3E86 A;  2C2A A;  3GWO A;  2Y69 C;  1OHH G;  5CA3 A;  1AJN A;  1OCO B;  2DW4 A;  3ABM B;  3FB5 C;  1P4R A;  1NVP D;  4DXW A;  2W6I G;  3H01 A;  1S76 D;  2PI4 A;  5C93 A;  4J9Y B;  5B1A C;  3JD3 A;  1RM1 C;  1K97 A;  3OM3 B;  2OT5 A;  3OUF A;  1WPX A;  2UXN A;  4UVC A;  3K08 A;  1PNM A;  2QKS A;  2WLI A;  3E83 A;  4BAY A;  4MW8 A;  1I5X A;  1JCH A;  1SET A;  3IC7 A;  4PA7 A;  3EHB B;  3G6E V;  1VQL V;  4TT3 G;  3M99 B;  1PD3 A;  1YSC A;  2WLH A;  4I5S A;  3ASO B;  3OW2 U;  3UKM A;  2F43 G;  1FXK B;  1ENV A;  4MW3 A;  3W7W A;  4GX2 A;  3OMA B;  1H2G A;  4G27 B;  2WPD G;  3OAA G;  3TET A;  3RBZ A;  3AG4 B;  1H8E G;  2Z3Y A;  4RUF A;  5EBW C;  3CD6 V;  2HJF C;  3MHS C;  1NJI W;  1KQS U;  4I9W A;  1KD1 W;  1NH2 B;  1YHQ V;  4R6Z A;  1M57 B;  4MVM A;  1VQO V;  4GX1 A;  5B1B C;  3DGE A;  4FJC C;  2EIK C;  2EJR A;  2P67 A;  1MSW D;  4ASU G;  2XAJ A;  4PDV A;  1FFT B;  3CMA V;  2QM8 A;  4ZBM A;  3ZRW A;  1Q81 W;  3G71 V;  4JTA B;  2WLM A;  1NH2 D;  3FYI B;  3FB7 C;  1K5S A;  1F51 A;  1YJW V;  1GM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...