3G4SV

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3g4sV00
3CMAV 1KD1W 1VQOV 3CCVV 2QA4V 3CCSV 1JJ2U 2QEXV 1YJ9V 1Q86W 3CPWU 3CCEV 3CC7V 1VQPV 1VQ8V 3I56V 2OTLV 3CD6V 1YI2V 4WFAV 3CCUV 3CCQV 3CCRV 1Q7YW 3G6EV 4WCEV 1NJIW 5DM6V 3CCLV 1S72V 3CMEV 2OTJV 3CCMV 1M1KW 1K8AW 3I55V 1Q82W 1QVGU 1QVFU 1KQSU 1VQ4V 1VQNV 1N8RW 1VQLV 2D3OW 1R73A 3G71V 1KC8W 1VQ5V 3OW2U 1VQKV 1VQ7V 1Q81W 1VQ9V 3CC2V 3G4SV 4WFBV 4WF9V 3CC4V 1VQ6V 1YIJV 1K73W 1VQMV 1W2BU 1YITV 1YJNV 1M90W 3CCJV 1YHQV 3CXCU 1K9MW 1YJWV
chains in the Genus database with same CATH superfamily
2QKAA 4JZGA 1WN7A 5HFLA 3JSLA 4P2ZA 4CH4A 2DYSB 2XUMA 4B3MB 1PM9A 3K3WA 1QBZA 3FAVB 2Q0AA 4JZ2A 3CWBH 4BIUA 1YJNV 2P90A 1EN5A 4PDMA 5IYCO 3P32A 1TVKA 1AI4A 5CB4A 4PA7A 3ETEA 1BS3A 4JYYA 4NTXA 4MW8A 5ITZB 2UUBO 3G4SV 1XQ8A 2GBOA 1RFYA 4J10A 5LOVB 5IWAO 4HBNA 2E75B 3FAVA 1Q3EA 2XAGA 1V54C 2CGNA 1MG1A 3FB6C 5J2TB 2GHYA 3K9SA 1F4NA 2IJHA 4WFFA 4NB5A 3ZCCA 2Q0OC 3OW2U 5L3DA 4X88A 3L73H 2EIKB 2WLLA 4CS2A 1X59A 2BTQA 2UXCB 5J2UB 4DV1B 3TETA 4DV6O 5L3BA 1Y74B 3ZRSA 5KA5A 5LL6Y 4DW1A 3UM7A 1MOFA 1EN6A 2JRIA 2A7WA 1HNZO 3ZRWB 1NI8A 1H2KA 2K1EA 5IJ0A 1ORQC 1GAXA 1NH2B 3JCUZ 1FAFA 1NS1A 2ADQB 1SZXA 4JYAB 1L1FA 4G2KA 2QKCA 3X2QB 1GN6A 3F5WC 3HKBB 4PV1B 2B5UA 2VS0A 1XOUA 4BAYA 2JS5A 4MVSA 4O4HA 3OUFA 3BFRA 1Y74A 4YY3O 1VQMV 4MVQA 2KKWA 3DXRB 1XI1A 2X7RB 1HR0B 1HWYA 2P6JA 4ZHQB 2H94A 2HHHO 2KQXA 3BVOA 3BABA 1YI2V 3WB1A 2BCCH 2W6JG 4NXNO 1FFXB 2Y0IA 5LXTB 4X64B 4JAUA 3K9AA 2L35A 2Q73A 2YXLA 2YDEA 1K8AW 1PL4A 2Q67A 1XNRB 4NKGB 2ZM6O 2AZ0A 3JARB 3J81N 4LBEC 4K0KB 2OIGA 1PNKA 4BWAA 3OAAG 1H8HG 3CCEV 1RSOB 5E79Z 5LP6B 4JI7B 2LP7A 3UQ8A 4E2LA 2ZE6A 1S72V 5FPRA 1OCRC 1K97A 1KECA 4MVRA 5LGTA 2A3QA 1M57C 1NU1H 2A79B 1B3QA 4PDLA 1MZEA 2UU9B 5LXTA 3JALB 3JAWB 4C7UA 1ZUQA 3FX7A 2QM8A 3JATA 3CHXA 1U96A 3FYIB 1MZFA 2IM9A 1HDJA 3ABLB 5EYPA 2DYRC 4FLUA 3G71V 4X66O 1IBMB 3QO8A 5LYJA 1AILA 4DUZO 4MTGA 5KUMA 3JASB 2KG7B 5H6RA 4DYLA 4X62B 4UCUA 3S3WA 4MSWC 4UCTA 1FYJA 4LFBO 2UXXA 4MT8A 2JGDB 1YCIA 1H2NA 3K5OA 3G80A 3VQXA 3OR7C 3GB7C 4OGQB 4IYIA 1BSMA 2Q5ZA 4WF9V 4JV5O 1YEWA 2WLHA 3L70H 3SPGA 1FXKB 1QLEC 2UXDO 1NTKH 4FFBB 2WPDG 4MS2A 3B40A 4TWKA 2HP8A 1AJPA 5BZBA 1K92A 2A06H 2KG7A 3W7UA 2YEVB 1NT2B 4LC1A 5B3SC 1MSDA 4FLWA 4B7KA 2YI9A 3FB7C 2IU3A 2ZDIC 3SPCA 2F1MA 5BMVA 2N04A 4DR6O 1J5EB 1NZ6A 5IWAB 1Z2GA 1CP9A 1AVMA 1O9HA 2OT5A 2E3CA 2EIJC 3ASNB 1GO3F 1S3JA 3TJTA 1XMQB 2QWNB 1DTOA 1NBMG 3STLC 3G6BA 3W7SA 2RMKB 4KFMA 1KKDA 1IXBA 5EBWC 2YEVA 2IBZH 4JPRA 3M8AA 3ABKC 2CTRA 4W4KA 2BTOA 1K9MW 2OIEA 1H38A 4B3TO 3CYOA 1SA0B 1XHZA 2ZR3A 3THOA 4EKWA 1QU7A 3CMEV 1RM1C 1M5IA 3C90A 3OMIB 5JVDB 4E4EA 1VQKV 4NYKA 3ML0A 5EBMC 1VQ6V 4DV7O 1HNZB 4JI8B 1L0LH 1U97A 3ZHSA 2ZIMA 1NTMH 1E79G 4GCZA 1XMOO 1YJWV 3AG7A 1YJ9V 4DR1O 5LGUA 1SKVA 2CUGA 3SYAA 1S0VA 2QDOA 3E83A 5KLVH 2C2AA 4J9ZB 3ZMVA 3CRAA 1VQ5V 2KSDA 3BA8A 4A5UB 1E1QG 3ETDA 4OXSA 4O2AB 4FPPA 1JJ2U 2HHHB 4FM1A 4ABMA 4NXNB 4FM0A 4I4TA 4B3MO 3JAMN 4CS4A 1H2LA 2GTAA 4KXRA 2QM7A 2ZM6B 1N0NA 3ZRXA 5A2QN 1EBOA 2ZD9A 4QGPA 3NR7A 2RJZA 4J9YB 1R3JC 4KHPB 1UJWB 4JF3A 2XOKG 3LSQA 4RQFA 4LF8B 4H13B 4O2AA 4WCEV 1Z5VA 5EZYA 3K03A 5D5QA 2HFEC 2EZPA 2D3OW 3PN1A 1RPOA 1JPXA 4MVZA 1EN4A 4HAMA 4W4LA 4NR1A 5KHHA 1Y76A 2FTKA 3RVZA 4AI8A 3CRMA 3HKCA 1M93A 5LMNO 2EILB 3CD6V 3C3SA 3CB2A 4U7NA 4PJ0Z 1LNQA 4L87A 1EM1A 4UVBA 1AI7A 5EIBC 2V1DA 1OCZC 2ITDC 1WB8A 1TAEA 4U3FH 1M56C 2XTAA 1W2BU 3DC6A 4F6RB 3T4DA 1V55C 4LFBB 4PI2A 3I56V 2JJ1G 4BW5A 3CCUV 2XAJA 1WJZA 2UXCO 1H8EG 2Q7HA 3LUTB 3HKDA 4QIWF 2H8PC 2VWKA 4K8XA 1XUQA 1Q82W 1VQLV 1CXZB 3H01A 1VQ7V 1A32A 3A8TA 2UXDB 1AP5A 4R50A 2CE4A 1K5SA 4X1YA 4LF9O 4PA9A 4JYAO 3AG1C 3E8HA 1SQBH 1UPGA 5H9CA 3KKYA 1AROP 4KUMA 3H1KH 3AK3A 4F4LA 2YIDA 2PF4E 1K5QA 3RGBA 4ASUG 4IYHA 1KKCA 4O4LB 3FB8C 5JQGA 3ASOC 3ZN1A 4DRXB 5H2FZ 4D6TH 2RCVA 1HR0O 4OPHA 1BL8A 4O4IB 5B1NA 4JAVA 1JOYA 4DK0A 3WU2Z 1KP2A 1AJQA 4X64O 1B04A 4UCVA 1VF6C 4JTDB 1OCOB 4UB8Z 2CH7A 4AILC 4K0KO 3OMAB 3MAQA 3LNNA 3HB3B 4B3TB 4O4LA 4EFEA 4DV0O 4J7JA 3L75H 4DRXA 3MHHC 3HR0A 4LF4B 1OCCB 2OWOA 3K0DA 4UV8A 4O4IA 2EULA 4U3JB 3B8NA 4DV7B 1VMGA 4NXMO 1Y4MA 2UU9O 1RP3B 4D7SA 4X20B 4JI2B 4RAIA 4B3SO 2WLMA 3RYIB 1JX9A 4FK5C 3E8FA 2HVKC 4CBCA 4X89A 3B8MA 3DTUB 2HJDA 1ZAUA 5B1OA 3T1CA 4TV9B 4K8ZA 1DLBA 1IBMO 3B09A 3VQVA 1I0HA 2Z0AA 4X62O 3CCVV 4LFAB 2EJ7A 4F6EA 1H2SB 1JFFB 3N2GA 3I5DA 4U3JA 5LGNA 1KU9A 3D36C 2ADPA 1JJOA 1W0KG 4X20A 4YJ3A 2B1GA 1RPRA 2UUCO 4GX0A 1S5HC 4TV8B 3RYIA 1PNMA 4DV4B 2PGGA 2Y4TA 4FLVA 1SF9A 1YSCA 1K73W 1N34O 1YHQV 1NKDA 2IH1C 1QR8A 4Z1VA 1N0JA 3P3PA 4CH3A 3HKEA 4NTWA 1EZVH 3SDLA 4H0LB 3U0ZA 4EB6B 5CMUA 3RN4A 1NH2D 2EINC 4IIJB 2ZIOA 4OPAA 3TCUA 4FLXA 1B06A 1SESA 3E8BA 2H3OA 2WA3A 3N2KB 3TXSA 2P5OA 1TGOA 1CEZA 1J5EO 4PHZA 5KAIZ 3OEEG 3B77A 1VQOV 5LMNB 1NR1A 3QF7A 1XMQO 1W0JG 4EEQA 4RUFA 5DECA 3ZMTA 4J41A 1IVSA 4I55B 5L3EA 5LHHA 3SGIA 4JYCA 1M1KW 2KB1A 1K34A 3GVMA 3OGCC 4EB6A 1S77D 1R3IC 1AI5A 5GTHZ 5A9GA 1YIJV 2ILMA 1GM9A 3AG3C 5ITZA 2EIMC 2PI4A 3APOA 3SJQC 3TXQA 3T1YB 3OR6C 1QR9A 1XREA 5LOVA 3D8CA 5B66Z 5KHJA 4AQYO 4X1IB 2ZQMA 2ZE8A 4DR7O 4D7TA 2PY5A 5J2TA 4JI8O 3OM3B 3CEIA 5JJJB 1PPJH 4LF9B 1AR4A 4QE7A 5DM6V 4I9QA 1SERA 3ETGA 1BQZA 3KG2A 3PJSK 1B6QA 2NNUA 2CAZC 2R9RB 4NVPA 5KX5B 2CK3G 3STZC 5J2UA 3ABMC 2FB5A 4PELA 1WNSA 2BE3A 2CGOA 1EFRG 4XDJA 1YVWA 2WLIB 4X65O 1PV0A 4JI5B 3ZRWA 1BCCH 4JYBA 3VOUA 3ZX6A 1R3KC 3F5TA 1KQSU 1PKXA 5LA6B 4G27B 4RWUA 1LR1A 1WPBA 1ZLZA 1GMGA 3GWKC 2P06A 4KL1A 1QNMA 2LQTA 3HKBA 1YF2A 4KHPO 3CXCU 1Z5WA 2JIZG 3U10A 2Q6AA 1BZKA 1Q5OA 1IURA 1KMIZ 3EFFK 3F7VC 5KX5A 4DV0B 2EX3A 2DYRB 3DXRA 4LF8O 4GX2A 4BW9A 4ZHQA 5KHGA 4UB6Z 3X2QC 1BGYH 1SQXH 4JASA 1OZ0A 1XL4A 4NXMB 1BHBA 2HG5C 3F7YC 1FFXA 3SYQA 2P7TC 4B3SB 3CXHF 2GTSA 2PTMA 1PL0A 4LR3A 2UUAO 3JARA 5GW7A 1Q6HA 1I5XA 1QLEB 3OTOB 1RSOA 4GX1A 5LP6A 3UCSC 3AK2A 1US6A 2QJ1A 4GX5A 3E86A 4QE9A 4GYCB 3WG7B 1R1BA 2R70A 4UCSA 3JALA 2P67A 2XNDG 3JAWA 2UUCB 4I0XB 3LDCA 3K5NA 3BEHA 3EXAA 4UUJC 2X6CA 1BHAA 4QJFB 3RYHB 1FS0G 2V7QG 3JD3A 1MMMA 1GK9A 3ZS8C 4BR6A 2ZNIA 3TK1A 1N34B 3EVKA 2NLJC 2LW7A 2QWQB 2JGUA 5L3GA 3JASA 5EK0A 2OCCC 4GZRB 3SJBC 3SYOA 2Y69B 5IYBO 2IJJA 1LUWA 3ABKB 1D5AA 1QVGU 2IU0A 5KAFZ 5FLXN 2GUZB 1GKFA 2JGDA 4I0XA 4N21A 1YZBA 1HNWB 4MVOA 1SZTA 3JAKB 3N27A 2R72A 4GKKB 5IYDO 3E35A 3RBZA 1FXKA 4DV2B 3H9VA 4FFBA 3ETQA 3SYCA 2ZXWC 3W7TA 3P30A 1I5YA 2ODMA 4P30A 5FL7G 4DK1A 3KCXA 1Q81W 4DR2O 1K33A 1K3EA 1ZL8B 5LMUB 1XL6A 2GDSA 1T5EA 1NQTA 1IXMA 3VQWA 2CTQA 3UKMA 1ZSPA 1L8DA 1NTZH 2LW1A 3FKSG 4IHJB 3H1IH 5LBQA 4AQYB 1IBLO 3H1LH 4OX9O 4I50B 4LF4O 5CA1B 4BIOA 4DR7B 1JQ0A 1VEWA 3JYCA 2HEPA 1V9PA 3CJHB 3BRCA 4ZI7B 4FZ1A 2P22C 3WB0A 4JI2O 4DV5B 2P4KA 2YC0A 4YHHB 1PNLA 3ABTA 3SPIA 3T4ZA 4CC5A 1MNGA 1IX9A 1COWG 1SA0A 3SYPA 4JTAB 5IY5C 3LNMB 2AHYA 5J9PC 2N05A 3CMAV 1KD1W 5JVDA 4X65B 4LFAO 3CCQV 2EBOA 4YJ2B 1F7YA 3CJHA 1KUQA 5K1XA 4DW0A 1GTOA 2QWPB 1VQ4V 3H1JH 2ZKOA 4HZ3A 1URFA 2M7WA 4DV4O 4CS3A 2IJKA 5KUKA 4JI4B 1ROPA 1WB7A 2WLJA 4DUYB 1OCZB 2YUAA 3LSUA 3ZMUA 3RYFB 4FLYA 1WP7A 2X0LA 1Q7YW 3CX5F 2W0FC 4LH6A 2DOSA 1ZWIC 2Y48A 1Q90D 4FLZA 5JWPA 4IT5A 1D2DA 3IJ4A 3RFRA 3RT3C 3E2EA 1Q43A 4DV3B 4YJ2A 5IE9A 2FL4A 4WFHA 4JGSA 1XILA 4ZBMA 5EC2C 1GN4A 2UUAB 2DMXA 4LWSB 4Z2WA 2YI8A 3Q4HB 3A2FA 3OTFA 4R7CA 4PD4F 2Q69A 3G6EV 1QCEA 4UFZA 2Q4PA 1S5JA 3OMNB 2RQ6A 4L8JA 4PA6A 1HNXB 3ZBHA 4R8CA 3QNEA 1N8RW 2XT9A 3KCYA 4TOIA 4WBNB 1N33B 5BY1A 2PYLA 1THZA 3AG1B 3AG2B 4K3AA 4I9WA 1FJGB 3T1YO 2YIBD 3K08A 3ASOB 1QVFU 4KP4A 4LWSA 2QR4A 3Q4HA 3BCCH 2PI5A 3KZIZ 3SJAC 2MK3A 3OD4A 4PI0A 4LFCB 2PZSA 4LF5O 3OFNG 2HLDG 4WBNA 2BOBC 2QTSA 5B1BC 5CBFA 1VF7A 3BY6A 4F6RA 1IDSA 2EILC 5DN6G 3ZMSA 4CH5A 4PDRA 1WA8B 1GN2A 5B1AB 2AGAA 1IZ3A 5EBLC 1KBHA 1K4DC 2QEXV 3ZMZA 5B5EZ 1AR1B 3MD0A 5IJ9B 5KMGB 2JDIG 4TUYB 2OTJV 4JI5O 1VIBA 4QPJA 2Y0PA 2ITCC 5GONB 5FNVB 2YXHA 2QE7G 4DR2B 4YXWG 3DGEA 2B9ZA 4CC6A 3MHSC 4DXWA 3IGAC 1CPYA 5BR8B 3SPHA 3OT7A 1WA8A 1WP8A 1JR9A 2UXNA 4J42A 2WLNA 1DF5A 4P9PA 2OTLV 4PA3A 1Y67A 1IBLB 1I7FA 2R9AA 4OX9B 1I94O 4PDVA 3ZJZA 1JMKC 5JCOA 5GONA 1OV9A 2BSKB 1TA8A 2ETNA 4LH7A 3U11A 2Y4UA 3IC7A 4LNUB 4BIZA 4MVMA 3ZIAG 3P3NA 3QO5A 1WLEA 5L3FA 1SC5B 2Z3YA 4ICGA 1SQVH 2YIBA 4FMTA 4G28B 3OTOO 2A0LA 2YICA 4JI6B 2HR3A 2F4VB 3ZEDA 2K9PA 2YS8A 3T1HO 2EINB 2HKOA 1P84F 2DN9A 1VQ8V 4GKJO 4I5SA 1JA8A 3RW0A 2JEXA 4JI0B 1P7GA 1MSWD 3CCMV 3I55V 5KHKA 4FM2A 3ZHQA 1N36O 1GH6A 1VF5B 1TVKB 3FB5C 3R65A 3AG4C 2VQEB 2CDYA 5FPOA 1V54B 1H2MA 2Q8VA 1XBLA 4O2BB 1E1RG 1W59A 3SPJA 4TV9A 2PUSA 2F43G 2UXBB 4J11A 4Z1MG 1KYOF 1GM8A 2GSMB 3SJCC 1TUBB 1AP6A 4JI1B 1JFFA 1K7DA 2JK5C 1YTFB 3JD1A 4FLTA 3AG3B 2O57A 4UVAA 3K5MA 4PA4A 1FPOA 2EIMB 4EFBA 2VQFB 4TV8A 1HNWO 2QA4V 4XDKA 4DR5B 3JCZA 5IDJA 4UVCA 4GUNA 4LF7B 4GKKO 1O9GA 1FFTB 4FIPC 4GLXA 3WB2A 2WLLB 4DV2O 3ICXA 3VBBA 4O2BA 2DYSC 4O4JB 4FZ0A 3TGUH 2ZINA 2BTQB 1XHXA 3CC4V 3IFXA 4IIJA 5LMUO 1TUBA 3W7WA 5K1PA 4JI3B 2AHZA 1P4RA 1XDCA 3N2KA 1YXBA 1VARA 4XBFA 3J80N 5IJ0B 3ABMB 1F51A 2E74B 3C3TA 4P9OA 4MVUA 2FMLA 1YITV 4I55A 4HYOA 4ZIBA 4H44B 4O4JA 4LF5B 2P4VA 3CPWU 2CTWA 4NTYA 4IL6Z 2ZNJA 4DV5O 5TISZ 4O4HB 2E5LB 3K58A 4YHHO 4HNAB 5KA6A 1KP3A 2AW9A 2F95B 2FKXA 1ZTEA 1DGSA 4MTXA 2CTPA 2OYQA 2ZT9B 3K06A 2DQ3A 2M6YA 2DW4A 3A0HZ 3L71H 4Q6GA 3BPZA 1WAZA 4DR3B 4X1IA 3A0BZ 2EIKC 1EZJA 1OCRB 1ZX3A 3E89A 1M57B 1SS3A 2QM4A 1F23A 2QTOA 3JD0A 1IBKB 1VQNV 2WLKA 4K35A 3K5LA 1SETA 1JCHA 4HNAA 2QWRB 3CCJV 4JI4O 3CSXA 4IGGA 4CZZA 3CC7V 4DUYO 3D3IA 2DQ0A 2F23A 4TQDA 3CCLV 1S5LZ 1UFIA 2Q7GA 1I94B 3E22B 2Q9LA 2Q7EA 5CA3A 1BQ0A 3JATB 2WLIA 2GV9A 3B2EE 1S76D 1BT8A 2HJFC 2W6IG 4DV3O 1XNQO 4X9QA 5EYPB 1LUVA 5LA6A 3QO7A 2LFSA 2JJ2G 5LYJB 1G4YB 4YIOA 3GWOA 1H2GA 3OGIB 3RYCB 2MW2B 4DR4O 5LHGA 1M9NA 1HNXO 4JTCB 3T1HB 2JS3A 3E22A 2IW5A 1N33O 1BE3H 3D3QA 4XDLA 2OCCB 5B3SB 2QKSA 4GKJB 1FJGO 1Y66A 3K79A 1VP7A 1N36B 3RVYA 5LP6C 2EJRA 3CRCA 5BXZA 4QNHB 2EIJB 2QWOB 4RUEA 5E1AC 3RYCA 1FXVA 1I08A 4B3RO 4LCUC 4LFCO 5BMVB 2ZXWB 4DO2A 4LF6O 3CE2A 4MTOA 4WFEA 4FJCC 3JSNA 4Q20A 3APQA 1PP9H 3ABLC 1FD9A 2ZDIA 1OJHA 2YIAA 3ZHVA 5JJNB 4FFKA 3RYHA 2LGQA 2Q68A 1RM1B 3CCRV 4QPKA 3WG7C 2OCHA 1GN3A 2UUBB 1X4TA 3O9OA 4JAAA 1J95A 3JD2A 1KB9F 5LHIA 2W0XA 2RDCA 2R9IA 2L6LA 1AB3A 3BHPA 1DF4A 5C8YB 5BR8O 1FXKC 1F4MA 1NR7A 2GUZA 4N23A 1YDXA 2D2CB 4X8AA 4TSFG 2E76B 2WA4A 5EIBD 2LJ2A 3JAKA 3K04A 3QG5A 5C93A 1BMFG 5IY5B 1KC8W 1SQGA 1D5NA 2ZR2A 2Y69C 4J80A 1P49A 4B08A 1MA1A 2ZE5A 5H6QA 5CN0A 1AJNA 4RO2A 1AI6A 3K0GA 3DC5A 1HP8A 4U7OA 3CRRA 3NXSA 5JH7B 2DWEC 4DV6B 2AZ2A 1ZL8A 2AXTZ 1NJIW 2F66C 3W7XA 3ASNC 5IT9N 5C8YA 4UV9A 2X6BA 1G8MA 5HFMA 3LDDA 4H37A 3CP1A 2YSUB 1N32O 2LFRA 2XHBA 1QHTA 2QSAA 4IHJA 2ZE7A 4JI6O 4I4TB 2F4VO 3ZHTA 2NN4A 4GT1A 4I50A 5CA1A 3QTCA 1Y6XA 4J7ZA 3BA9A 3ZHRA 2YXYA 3SR2C 4ZI7A 5CBGA 4JI0O 2F93B 5JH7A 3S3XA 4YY3B 3O65A 1Q8IA 3DSQA 5JJEB 3FD9A 5EZYB 3K59A 2VRZA 3VQYA 2VQEO 3CCSV 1K4CC 3CRQA 4FVMA 2XAQA 1G6UA 3QVNA 2UXBO 1Y76B 3UO2A 1M56B 4UXNA 3HKCB 3UO3A 5H5NA 2LO1A 4I7ZB 4CH6A 3L72H 1N4CA 4JI1O 1V55B 3EHBB 1HW7A 3HPLC 1P7BA 1ENVA 1XNQB 3L74H 3OE7G 2VQFO 2NR5A 1VQPV 1NVPD 4DR5O 1QLNA 3B4SA 4LF7O 3ZHUA 4DR4B 2IJIA 2WWWA 4WFGA 3K57A 3RYFA 1VQ9V 1G1XB 2N74A 5F2VO 2RN9A 3HKDB 1FKAO 1R6KA 1DK1A 5B1BB 3IAYA 1MABG 1SQPH 4JI3O 1R6TA 4WFAV 2FYUH 4H33A 3AEIA 1SQQH 1Q6UA 3LDEA 4ZOLB 4X66B 3ZRVA 4DUZB 1R73A 4MTFA 4X1YB 4UCOA 2IH3C 3RWRD 4R6ZA 4B7EA 3FFQA 4B3RB 3IC9A 2WSSG 5GTIZ 1SQFA 1JVMA 3M99B 1QQCA 2ATKC 5JQGB 4LF6B 4DV1O 2E5LO 5IYZB 5KHIA 5AG2A 4JV5B 4UCRA 4WFBV 3H1HH 1NVPB 4ZOLA 4DR3O 2JEUA 5EC1C 3J7AU 2QGNA 4MW3A 4YIPA 2BOCC 3AG2C 3BAAA 3UT5B 4TQFA 3E8GA 2CH7B 1PD3A 5DEDA 3CS5A 2G38A 3ZN0A 3G67A 5D5PA 3MDSA 4DR6B 1XEQA 1IBKO 1GM7A 1VF6A 1L0NH 5IYZA 3JD4A 5CA0B 1M4UA 4AHCA 3T2MA 1OHHG 3ABUA 3OUSA 2HVJC 2DWDC 3WFVA 3A0RA 2PYJA 5CBHA 2VWJA 4X1KB 3M7MX 2ARHA 5IJ9A 2JVDA 1XNRO 3UT5A 2DE0X 4RQEA 2WAMA 5KMGA 4TUYA 5B1AC 1M90W 2LGWA 4TT3G 1YTFD 2XAHA 5FNVA 3OEHG 4JI7O 5CA0A 2RNBA 2ZCEA 2Z5UA 2X6AA 1TUEB 3AG4B 3L9DA 3N2GB 2XASA 5L3CA 1N32B 3CC2V 3R66A 5JCOC 2V4DA 1XMOB 4YJ3B 3FYEB 4X1KA 1WPXA 1GRJA 3LSSA 1OCOC 1SRYA 4DR1B 2A9HA 2B1IA 1Q86W 1Q6IA 1R3LC 1AR5A 3AK1A 3D36A 2BSKA 2DJVA 3HKEB 4LP8A 1R6NA 1FXHA 2XAFA 1OCCC 5CB4B 4LNUA 2EZOA 4J7KA 4ZKIA
chains in the Genus database with same CATH topology
3UKMA 1V55C 5HFLA 4CZZA 3CC7V 4P2ZA 3I56V 2DYSB 2JJ1G 3FKSG 4BW5A 3D3IA 2DQ0A 3CCUV 2XAJA 3CCLV 1H8EG 5LBQA 3LUTB 4QIWF 2H8PC 3K3WA 1Q82W 1QBZA 5CA3A 1VQLV 2WLIA 3H01A 1VQ7V 1JQ0A 1S76D 2HJFC 2W6IG 3JYCA 4BIUA 1YJNV 2P90A 4PDMA 5IYCO 4R50A 1K5SA 3QO7A 2LFSA 3P32A 2JJ2G 4PA9A 1AI4A 1G4YB 4PA7A 3AG1C 3E8HA 3GWOA 5H9CA 1H2GA 3ETEA 1AROP 4KUMA 1PNLA 3ABTA 4MW8A 3SPIA 4F4LA 3T4ZA 1K5QA 5LHGA 4ASUG 1M9NA 1COWG 3SYPA 4JTCB 3G4SV 3FB8C 4JTAB 5IY5C 3ASOC 3LNMB 2AHYA 3ZN1A 2IW5A 5J9PC 3CMAV 1KD1W 1BL8A 4XDLA 2XAGA 2OCCB 5B3SB 2QKSA 5B1NA 1V54C 3CCQV 2EBOA 1Y66A 4JAVA 1JOYA 1MG1A 3K79A 3FB6C 2GHYA 1KP2A 1AJQA 1GTOA 3RVYA 1F4NA 2IJHA 1VQ4V 4WFFA 4JTDB 2EJRA 4HZ3A 3ZCCA 3OW2U 5L3DA 1OCOB 2M7WA 4X88A 4QNHB 2EIJB 2IJKA 5KUKA 2EIKB 2WLLA 4RUEA 5E1AC 3OMAB 1FXVA 1ROPA 3HB3B 2WLJA 4LCUC 1OCZB 3ZMUA 2ZXWB 2X0LA 4DO2A 3TETA 1Q7YW 5L3BA 3MHHC 2W0FC 3ZRSA 5KA5A 4MTOA 4WFEA 1OCCB 1ZWIC 4FJCC 2Y48A 3UM7A 1MOFA 3K0DA 4UV8A 4Q20A 3E2EA 3B8NA 1Y4MA 3ABLC 2ZDIA 3ZRWB 4WFHA 2K1EA 1ORQC 4JGSA 1NH2B 4RAIA 4ZBMA 2WLMA 5EC2C 1L1FA 1JX9A 4G2KA 2Q68A 1RM1B 4R7CA 4FK5C 2Q69A 3E8FA 3X2QB 1QCEA 3G6EV 4QPKA 3F5WC 2HVKC 3WG7C 4CBCA 4X89A 3B8MA 3OMNB 2B5UA 3DTUB 4PA6A 4R8CA 3QNEA 1N8RW 4BAYA 5B1OA 3T1CA 1J95A 3JD2A 1DLBA 4MVSA 5LHIA 3OUFA 1VQMV 2R9IA 4MVQA 2X7RB 1THZA 1HWYA 3AG1B 2P6JA 3AG2B 3CCVV 1DF4A 2H94A 4I9WA 1FXKC 5LGNA 1F4MA 1NR7A 3CCJV 1YI2V 4N23A 1W0KG 2W6JG 4X8AA 4TSFG 2B1GA 1RPRA 3K9AA 4JAUA 4GX0A 1S5HC 1K8AW 3K04A 3K08A 5C93A 1BMFG 5IY5B 3ASOB 1QVFU 4KP4A 1KC8W 1PNMA 2Q67A 2ZR2A 2Y69C 4LBEC 1YSCA 1K73W 1PNKA 2PI5A 3OAAG 1NKDA 2IH1C 1YHQV 1QR8A 2MK3A 5H6QA 1H8HG 5CN0A 1AJNA 4RO2A 1AI6A 3K0GA 3CCEV 3OFNG 2HLDG 4U7OA 3NXSA 2DWEC 2BOBC 5CMUA 2LP7A 1NH2D 1NJIW 4E2LA 5B1BC 5CBFA 2EINC 3W7XA 3BY6A 3ASNC 1S72V 2EILC 5DN6G 3ZMSA 1OCRC 3TCUA 4UV9A 1K97A 1KECA 2X6BA 4PDRA 1G8MA 4MVRA 5LGTA 5HFMA 3LDDA 1M57C 4H37A 3CP1A 5B1AB 1SESA 2YSUB 2A79B 4PDLA 2LFRA 3E8BA 5EBLC 1CEZA 1K4DC 4GT1A 2QEXV 3OEEG 3B77A 1VQOV 2QM8A 3ZMZA 1AR1B 3MD0A 1NR1A 1W0JG 3FYIB 4RUFA 3ZMTA 2JDIG 5L3EA 5LHHA 2OTJV 4QPJA 4JYCA 1M1KW 2ITCC 3ABLB 5CBGA 2DYRC 2KB1A 1K34A 3G71V 2QE7G 3OGCC 3QO8A 3DGEA 4YXWG 4MTGA 1S77D 1R3IC 5KUMA 1AI5A 3MHSC 1YIJV 5H6RA 4DXWA 3IGAC 1CPYA 3SPHA 1GM9A 4MSWC 3CCSV 2UXNA 3AG3C 2WLNA 1K4CC 2UXXA 1DF5A 4P9PA 2EIMC 2OTLV 4PA3A 4MT8A 2PI4A 3SJQC 2XAQA 3OR6C 3OR7C 1QR9A 3GB7C 2ZQMA 1M56B 4UXNA 4PDVA 3ZJZA 4WF9V 1V55B 2WLHA 3EHBB 3SPGA 3HPLC 1FXKB 1QLEC 1P7BA 2WPDG 4MS2A 1ENVA 4TWKA 3OM3B 3OE7G 1AJPA 5BZBA 1K92A 1VQPV 1NVPD 3W7UA 1QLNA 4QE7A 3IC7A 2YEVB 4BIZA 5DM6V 4MVMA 3ZIAG 4LC1A 1SERA 3ETGA 5B3SC 3KG2A 3QO5A 1WLEA 2IJIA 5L3FA 3PJSK 1B6QA 2WWWA 3FB7C 2NNUA 2Z3YA 2IU3A 4WFGA 2ZDIC 4FMTA 2R9RB 4G28B 3SPCA 2A0LA 1VQ9V 2CK3G 3STZC 2HR3A 3ABMC 4PELA 1CP9A 1R6KA 1EFRG 5B1BB 4XDJA 2EINB 2EIJC 2OT5A 2HKOA 1GO3F 1MABG 1S3JA 2WLIB 3ASNB 1VQ8V 1DTOA 1NBMG 4WFAV 4I5SA 3STLC 3RW0A 3ZRWA 2JEXA 4H33A 3AEIA 4JYBA 3VOUA 3CCMV 1MSWD 3LDEA 3I55V 1R3KC 3W7SA 3ZRVA 1KQSU 1PKXA 1R73A 4MTFA 4KFMA 1KKDA 5EBWC 4G27B 2YEVA 4JPRA 1GMGA 2IH3C 3ABKC 3FB5C 3R65A 3AG4C 4R6ZA 3CXCU 1K9MW 2JIZG 1V54B 2Q6AA 2WSSG 1H38A 1E1RG 3EFFK 3SPJA 3F7VC 3CYOA 1JVMA 2DYRB 3M99B 2ZR3A 2F43G 2ATKC 4EKWA 4Z1MG 3CMEV 4GX2A 1RM1C 1GM8A 2GSMB 3OMIB 3X2QC 1K7DA 4JASA 1OZ0A 1XL4A 2JK5C 1VQKV 1YTFB 3ML0A 4WFBV 1BHBA 3JD1A 3AG3B 2HG5C 5EBMC 3F7YC 1VQ6V 4UVAA 4PA4A 2EIMB 1NVPB 3SYQA 1E79G 4GCZA 1YJWV 2P7TC 2QA4V 2JEUA 1YJ9V 4XDKA 5EC1C 1PL0A 3JCZA 5LGUA 5IDJA 4MW3A 4UVCA 2BOCC 3AG2C 3SYAA 1S0VA 5GW7A 4FIPC 1FFTB 3E8GA 1PD3A 1I5XA 2WLLB 3ZN0A 3E83A 3VBBA 2DYSC 2C2AA 1QLEB 4J9ZB 3ZMVA 1VQ5V 4GX1A 1GM7A 1E1QG 3ETDA 3CC4V 4OXSA 3IFXA 3JD4A 4FPPA 4GX5A 3W7WA 3E86A 4QE9A 1JJ2U 3T2MA 1OHHG 3WG7B 3ABUA 2AHZA 3OUSA 2HVJC 2DWDC 3CCRV 1P4RA 3A0RA 3WFVA 2P67A 2XNDG 3LDCA 4XBFA 3BEHA 4UUJC 5CBHA 2X6CA 1BHAA 3ABMB 4QJFB 1FS0G 1F51A 2QM7A 2V7QG 3ZRXA 4P9OA 1EBOA 2ZD9A 1GK9A 3JD3A 4MVUA 4RQEA 2WAMA 3TK1A 4J9YB 1R3JC 1UJWB 1YITV 5B1AC 1M90W 4JF3A 2XOKG 4TT3G 4HYOA 2NLJC 1YTFD 2XAHA 3CPWU 3OEHG 3LSQA 5L3GA 4RQFA 5EK0A 4WCEV 2Z5UA 2X6AA 1TUEB 5KA6A 1KP3A 2OCCC 5IYBO 3SYOA 2Y69B 3K03A 2HFEC 2IJJA 3ABKB 3AG4B 1QVGU 2EZPA 2IU0A 2D3OW 2XASA 5L3CA 4MTXA 3CC2V 1RPOA 3K06A 1JPXA 2DQ3A 1GKFA 2DW4A 4MVZA 4N21A 4HAMA 3FYEB 2FTKA 3RVZA 4MVOA 1SZTA 1WPXA 3LSSA 1OCOC 1SRYA 2A9HA 2B1IA 1Q86W 2EIKC 2EILB 1R3LC 3E35A 5IYDO 1EZJA 1OCRB 3RBZA 3CD6V 3E89A 4U7NA 1FXKA 1LNQA 4L87A 1M57B 3D36A 4UVBA 1AI7A 1F23A 1OCZC 2V1DA 3SYCA 2ZXWC 3W7TA 2QTOA 3JD0A 3P30A 1I5YA 1VQNV 4P30A 2ITDC 2WLKA 5FL7G 1Q81W 4LP8A 1R6NA 1SETA 2XAFA 1FXHA 1K33A 1K3EA 1JCHA 1M56C 1OCCC 1XL6A 2EZOA 1W2BU 1NQTA 1IXMA 4ZKIA 3T4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA V;  1KD1 W;  1VQO V;  3CCV V;  2QA4 V;  3CCS V;  1JJ2 U;  2QEX V;  1YJ9 V;  1Q86 W;  3CPW U;  3CCE V;  3CC7 V;  1VQP V;  1VQ8 V;  3I56 V;  2OTL V;  3CD6 V;  1YI2 V;  4WFA V;  3CCU V;  3CCQ V;  3CCR V;  1Q7Y W;  3G6E V;  4WCE V;  1NJI W;  5DM6 V;  3CCL V;  1S72 V;  3CME V;  2OTJ V;  3CCM V;  1M1K W;  1K8A W;  3I55 V;  1Q82 W;  1QVG U;  1QVF U;  1KQS U;  1VQ4 V;  1VQN V;  1N8R W;  1VQL V;  2D3O W;  1R73 A;  3G71 V;  1KC8 W;  1VQ5 V;  3OW2 U;  1VQK V;  1VQ7 V;  1Q81 W;  1VQ9 V;  3CC2 V;  3G4S V;  4WFB V;  4WF9 V;  3CC4 V;  1VQ6 V;  1YIJ V;  1K73 W;  1VQM V;  1W2B U;  1YIT V;  1YJN V;  1M90 W;  3CCJ V;  1YHQ V;  3CXC U;  1K9M W;  1YJW V; 
#chains in the Genus database with same CATH topology
 2QKA A;  4JZG A;  1WN7 A;  5HFL A;  3JSL A;  4P2Z A;  4CH4 A;  2DYS B;  2XUM A;  4B3M B;  1PM9 A;  3K3W A;  1QBZ A;  3FAV B;  2Q0A A;  4JZ2 A;  3CWB H;  4BIU A;  1YJN V;  2P90 A;  1EN5 A;  4PDM A;  5IYC O;  3P32 A;  1TVK A;  1AI4 A;  5CB4 A;  4PA7 A;  3ETE A;  1BS3 A;  4JYY A;  4NTX A;  4MW8 A;  5ITZ B;  2UUB O;  3G4S V;  1XQ8 A;  2GBO A;  1RFY A;  4J10 A;  5LOV B;  5IWA O;  4HBN A;  2E75 B;  3FAV A;  1Q3E A;  2XAG A;  1V54 C;  2CGN A;  1MG1 A;  3FB6 C;  5J2T B;  2GHY A;  3K9S A;  1F4N A;  2IJH A;  4WFF A;  4NB5 A;  3ZCC A;  2Q0O C;  3OW2 U;  5L3D A;  4X88 A;  3L73 H;  2EIK B;  2WLL A;  4CS2 A;  1X59 A;  2BTQ A;  2UXC B;  5J2U B;  4DV1 B;  3TET A;  4DV6 O;  5L3B A;  1Y74 B;  3ZRS A;  5KA5 A;  5LL6 Y;  4DW1 A;  3UM7 A;  1MOF A;  1EN6 A;  2JRI A;  2A7W A;  1HNZ O;  3ZRW B;  1NI8 A;  1H2K A;  2K1E A;  5IJ0 A;  1ORQ C;  1GAX A;  1NH2 B;  3JCU Z;  1FAF A;  1NS1 A;  2ADQ B;  1SZX A;  4JYA B;  1L1F A;  4G2K A;  2QKC A;  3X2Q B;  1GN6 A;  3F5W C;  3HKB B;  4PV1 B;  2B5U A;  2VS0 A;  1XOU A;  4BAY A;  2JS5 A;  4MVS A;  4O4H A;  3OUF A;  3BFR A;  1Y74 A;  4YY3 O;  1VQM V;  4MVQ A;  2KKW A;  3DXR B;  1XI1 A;  2X7R B;  1HR0 B;  1HWY A;  2P6J A;  4ZHQ B;  2H94 A;  2HHH O;  2KQX A;  3BVO A;  3BAB A;  1YI2 V;  3WB1 A;  2BCC H;  2W6J G;  4NXN O;  1FFX B;  2Y0I A;  5LXT B;  4X64 B;  4JAU A;  3K9A A;  2L35 A;  2Q73 A;  2YXL A;  2YDE A;  1K8A W;  1PL4 A;  2Q67 A;  1XNR B;  4NKG B;  2ZM6 O;  2AZ0 A;  3JAR B;  3J81 N;  4LBE C;  4K0K B;  2OIG A;  1PNK A;  4BWA A;  3OAA G;  1H8H G;  3CCE V;  1RSO B;  5E79 Z;  5LP6 B;  4JI7 B;  2LP7 A;  3UQ8 A;  4E2L A;  2ZE6 A;  1S72 V;  5FPR A;  1OCR C;  1K97 A;  1KEC A;  4MVR A;  5LGT A;  2A3Q A;  1M57 C;  1NU1 H;  2A79 B;  1B3Q A;  4PDL A;  1MZE A;  2UU9 B;  5LXT A;  3JAL B;  3JAW B;  4C7U A;  1ZUQ A;  3FX7 A;  2QM8 A;  3JAT A;  3CHX A;  1U96 A;  3FYI B;  1MZF A;  2IM9 A;  1HDJ A;  3ABL B;  5EYP A;  2DYR C;  4FLU A;  3G71 V;  4X66 O;  1IBM B;  3QO8 A;  5LYJ A;  1AIL A;  4DUZ O;  4MTG A;  5KUM A;  3JAS B;  2KG7 B;  5H6R A;  4DYL A;  4X62 B;  4UCU A;  3S3W A;  4MSW C;  4UCT A;  1FYJ A;  4LFB O;  2UXX A;  4MT8 A;  2JGD B;  1YCI A;  1H2N A;  3K5O A;  3G80 A;  3VQX A;  3OR7 C;  3GB7 C;  4OGQ B;  4IYI A;  1BSM A;  2Q5Z A;  4WF9 V;  4JV5 O;  1YEW A;  2WLH A;  3L70 H;  3SPG A;  1FXK B;  1QLE C;  2UXD O;  1NTK H;  4FFB B;  2WPD G;  4MS2 A;  3B40 A;  4TWK A;  2HP8 A;  1AJP A;  5BZB A;  1K92 A;  2A06 H;  2KG7 A;  3W7U A;  2YEV B;  1NT2 B;  4LC1 A;  5B3S C;  1MSD A;  4FLW A;  4B7K A;  2YI9 A;  3FB7 C;  2IU3 A;  2ZDI C;  3SPC A;  2F1M A;  5BMV A;  2N04 A;  4DR6 O;  1J5E B;  1NZ6 A;  5IWA B;  1Z2G A;  1CP9 A;  1AVM A;  1O9H A;  2OT5 A;  2E3C A;  2EIJ C;  3ASN B;  1GO3 F;  1S3J A;  3TJT A;  1XMQ B;  2QWN B;  1DTO A;  1NBM G;  3STL C;  3G6B A;  3W7S A;  2RMK B;  4KFM A;  1KKD A;  1IXB A;  5EBW C;  2YEV A;  2IBZ H;  4JPR A;  3M8A A;  3ABK C;  2CTR A;  4W4K A;  2BTO A;  1K9M W;  2OIE A;  1H38 A;  4B3T O;  3CYO A;  1SA0 B;  1XHZ A;  2ZR3 A;  3THO A;  4EKW A;  1QU7 A;  3CME V;  1RM1 C;  1M5I A;  3C90 A;  3OMI B;  5JVD B;  4E4E A;  1VQK V;  4NYK A;  3ML0 A;  5EBM C;  1VQ6 V;  4DV7 O;  1HNZ B;  4JI8 B;  1L0L H;  1U97 A;  3ZHS A;  2ZIM A;  1NTM H;  1E79 G;  4GCZ A;  1XMO O;  1YJW V;  3AG7 A;  1YJ9 V;  4DR1 O;  5LGU A;  1SKV A;  2CUG A;  3SYA A;  1S0V A;  2QDO A;  3E83 A;  5KLV H;  2C2A A;  4J9Z B;  3ZMV A;  3CRA A;  1VQ5 V;  2KSD A;  3BA8 A;  4A5U B;  1E1Q G;  3ETD A;  4OXS A;  4O2A B;  4FPP A;  1JJ2 U;  2HHH B;  4FM1 A;  4ABM A;  4NXN B;  4FM0 A;  4I4T A;  4B3M O;  3JAM N;  4CS4 A;  1H2L A;  2GTA A;  4KXR A;  2QM7 A;  2ZM6 B;  1N0N A;  3ZRX A;  5A2Q N;  1EBO A;  2ZD9 A;  4QGP A;  3NR7 A;  2RJZ A;  4J9Y B;  1R3J C;  4KHP B;  1UJW B;  4JF3 A;  2XOK G;  3LSQ A;  4RQF A;  4LF8 B;  4H13 B;  4O2A A;  4WCE V;  1Z5V A;  5EZY A;  3K03 A;  5D5Q A;  2HFE C;  2EZP A;  2D3O W;  3PN1 A;  1RPO A;  1JPX A;  4MVZ A;  1EN4 A;  4HAM A;  4W4L A;  4NR1 A;  5KHH A;  1Y76 A;  2FTK A;  3RVZ A;  4AI8 A;  3CRM A;  3HKC A;  1M93 A;  5LMN O;  2EIL B;  3CD6 V;  3C3S A;  3CB2 A;  4U7N A;  4PJ0 Z;  1LNQ A;  4L87 A;  1EM1 A;  4UVB A;  1AI7 A;  5EIB C;  2V1D A;  1OCZ C;  2ITD C;  1WB8 A;  1TAE A;  4U3F H;  1M56 C;  2XTA A;  1W2B U;  3DC6 A;  4F6R B;  3T4D A;  1V55 C;  4LFB B;  4PI2 A;  3I56 V;  2JJ1 G;  4BW5 A;  3CCU V;  2XAJ A;  1WJZ A;  2UXC O;  1H8E G;  2Q7H A;  3LUT B;  3HKD A;  4QIW F;  2H8P C;  2VWK A;  4K8X A;  1XUQ A;  1Q82 W;  1VQL V;  1CXZ B;  3H01 A;  1VQ7 V;  1A32 A;  3A8T A;  2UXD B;  1AP5 A;  4R50 A;  2CE4 A;  1K5S A;  4X1Y A;  4LF9 O;  4PA9 A;  4JYA O;  3AG1 C;  3E8H A;  1SQB H;  1UPG A;  5H9C A;  3KKY A;  1ARO P;  4KUM A;  3H1K H;  3AK3 A;  4F4L A;  2YID A;  2PF4 E;  1K5Q A;  3RGB A;  4ASU G;  4IYH A;  1KKC A;  4O4L B;  3FB8 C;  5JQG A;  3ASO C;  3ZN1 A;  4DRX B;  5H2F Z;  4D6T H;  2RCV A;  1HR0 O;  4OPH A;  1BL8 A;  4O4I B;  5B1N A;  4JAV A;  1JOY A;  4DK0 A;  3WU2 Z;  1KP2 A;  1AJQ A;  4X64 O;  1B04 A;  4UCV A;  1VF6 C;  4JTD B;  1OCO B;  4UB8 Z;  2CH7 A;  4AIL C;  4K0K O;  3OMA B;  3MAQ A;  3LNN A;  3HB3 B;  4B3T B;  4O4L A;  4EFE A;  4DV0 O;  4J7J A;  3L75 H;  4DRX A;  3MHH C;  3HR0 A;  4LF4 B;  1OCC B;  2OWO A;  3K0D A;  4UV8 A;  4O4I A;  2EUL A;  4U3J B;  3B8N A;  4DV7 B;  1VMG A;  4NXM O;  1Y4M A;  2UU9 O;  1RP3 B;  4D7S A;  4X20 B;  4JI2 B;  4RAI A;  4B3S O;  2WLM A;  3RYI B;  1JX9 A;  4FK5 C;  3E8F A;  2HVK C;  4CBC A;  4X89 A;  3B8M A;  3DTU B;  2HJD A;  1ZAU A;  5B1O A;  3T1C A;  4TV9 B;  4K8Z A;  1DLB A;  1IBM O;  3B09 A;  3VQV A;  1I0H A;  2Z0A A;  4X62 O;  3CCV V;  4LFA B;  2EJ7 A;  4F6E A;  1H2S B;  1JFF B;  3N2G A;  3I5D A;  4U3J A;  5LGN A;  1KU9 A;  3D36 C;  2ADP A;  1JJO A;  1W0K G;  4X20 A;  4YJ3 A;  2B1G A;  1RPR A;  2UUC O;  4GX0 A;  1S5H C;  4TV8 B;  3RYI A;  1PNM A;  4DV4 B;  2PGG A;  2Y4T A;  4FLV A;  1SF9 A;  1YSC A;  1K73 W;  1N34 O;  1YHQ V;  1NKD A;  2IH1 C;  1QR8 A;  4Z1V A;  1N0J A;  3P3P A;  4CH3 A;  3HKE A;  4NTW A;  1EZV H;  3SDL A;  4H0L B;  3U0Z A;  4EB6 B;  5CMU A;  3RN4 A;  1NH2 D;  2EIN C;  4IIJ B;  2ZIO A;  4OPA A;  3TCU A;  4FLX A;  1B06 A;  1SES A;  3E8B A;  2H3O A;  2WA3 A;  3N2K B;  3TXS A;  2P5O A;  1TGO A;  1CEZ A;  1J5E O;  4PHZ A;  5KAI Z;  3OEE G;  3B77 A;  1VQO V;  5LMN B;  1NR1 A;  3QF7 A;  1XMQ O;  1W0J G;  4EEQ A;  4RUF A;  5DEC A;  3ZMT A;  4J41 A;  1IVS A;  4I55 B;  5L3E A;  5LHH A;  3SGI A;  4JYC A;  1M1K W;  2KB1 A;  1K34 A;  3GVM A;  3OGC C;  4EB6 A;  1S77 D;  1R3I C;  1AI5 A;  5GTH Z;  5A9G A;  1YIJ V;  2ILM A;  1GM9 A;  3AG3 C;  5ITZ A;  2EIM C;  2PI4 A;  3APO A;  3SJQ C;  3TXQ A;  3T1Y B;  3OR6 C;  1QR9 A;  1XRE A;  5LOV A;  3D8C A;  5B66 Z;  5KHJ A;  4AQY O;  4X1I B;  2ZQM A;  2ZE8 A;  4DR7 O;  4D7T A;  2PY5 A;  5J2T A;  4JI8 O;  3OM3 B;  3CEI A;  5JJJ B;  1PPJ H;  4LF9 B;  1AR4 A;  4QE7 A;  5DM6 V;  4I9Q A;  1SER A;  3ETG A;  1BQZ A;  3KG2 A;  3PJS K;  1B6Q A;  2NNU A;  2CAZ C;  2R9R B;  4NVP A;  5KX5 B;  2CK3 G;  3STZ C;  5J2U A;  3ABM C;  2FB5 A;  4PEL A;  1WNS A;  2BE3 A;  2CGO A;  1EFR G;  4XDJ A;  1YVW A;  2WLI B;  4X65 O;  1PV0 A;  4JI5 B;  3ZRW A;  1BCC H;  4JYB A;  3VOU A;  3ZX6 A;  1R3K C;  3F5T A;  1KQS U;  1PKX A;  5LA6 B;  4G27 B;  4RWU A;  1LR1 A;  1WPB A;  1ZLZ A;  1GMG A;  3GWK C;  2P06 A;  4KL1 A;  1QNM A;  2LQT A;  3HKB A;  1YF2 A;  4KHP O;  3CXC U;  1Z5W A;  2JIZ G;  3U10 A;  2Q6A A;  1BZK A;  1Q5O A;  1IUR A;  1KMI Z;  3EFF K;  3F7V C;  5KX5 A;  4DV0 B;  2EX3 A;  2DYR B;  3DXR A;  4LF8 O;  4GX2 A;  4BW9 A;  4ZHQ A;  5KHG A;  4UB6 Z;  3X2Q C;  1BGY H;  1SQX H;  4JAS A;  1OZ0 A;  1XL4 A;  4NXM B;  1BHB A;  2HG5 C;  3F7Y C;  1FFX A;  3SYQ A;  2P7T C;  4B3S B;  3CXH F;  2GTS A;  2PTM A;  1PL0 A;  4LR3 A;  2UUA O;  3JAR A;  5GW7 A;  1Q6H A;  1I5X A;  1QLE B;  3OTO B;  1RSO A;  4GX1 A;  5LP6 A;  3UCS C;  3AK2 A;  1US6 A;  2QJ1 A;  4GX5 A;  3E86 A;  4QE9 A;  4GYC B;  3WG7 B;  1R1B A;  2R70 A;  4UCS A;  3JAL A;  2P67 A;  2XND G;  3JAW A;  2UUC B;  4I0X B;  3LDC A;  3K5N A;  3BEH A;  3EXA A;  4UUJ C;  2X6C A;  1BHA A;  4QJF B;  3RYH B;  1FS0 G;  2V7Q G;  3JD3 A;  1MMM A;  1GK9 A;  3ZS8 C;  4BR6 A;  2ZNI A;  3TK1 A;  1N34 B;  3EVK A;  2NLJ C;  2LW7 A;  2QWQ B;  2JGU A;  5L3G A;  3JAS A;  5EK0 A;  2OCC C;  4GZR B;  3SJB C;  3SYO A;  2Y69 B;  5IYB O;  2IJJ A;  1LUW A;  3ABK B;  1D5A A;  1QVG U;  2IU0 A;  5KAF Z;  5FLX N;  2GUZ B;  1GKF A;  2JGD A;  4I0X A;  4N21 A;  1YZB A;  1HNW B;  4MVO A;  1SZT A;  3JAK B;  3N27 A;  2R72 A;  4GKK B;  5IYD O;  3E35 A;  3RBZ A;  1FXK A;  4DV2 B;  3H9V A;  4FFB A;  3ETQ A;  3SYC A;  2ZXW C;  3W7T A;  3P30 A;  1I5Y A;  2ODM A;  4P30 A;  5FL7 G;  4DK1 A;  3KCX A;  1Q81 W;  4DR2 O;  1K33 A;  1K3E A;  1ZL8 B;  5LMU B;  1XL6 A;  2GDS A;  1T5E A;  1NQT A;  1IXM A;  3VQW A;  2CTQ A;  3UKM A;  1ZSP A;  1L8D A;  1NTZ H;  2LW1 A;  3FKS G;  4IHJ B;  3H1I H;  5LBQ A;  4AQY B;  1IBL O;  3H1L H;  4OX9 O;  4I50 B;  4LF4 O;  5CA1 B;  4BIO A;  4DR7 B;  1JQ0 A;  1VEW A;  3JYC A;  2HEP A;  1V9P A;  3CJH B;  3BRC A;  4ZI7 B;  4FZ1 A;  2P22 C;  3WB0 A;  4JI2 O;  4DV5 B;  2P4K A;  2YC0 A;  4YHH B;  1PNL A;  3ABT A;  3SPI A;  3T4Z A;  4CC5 A;  1MNG A;  1IX9 A;  1COW G;  1SA0 A;  3SYP A;  4JTA B;  5IY5 C;  3LNM B;  2AHY A;  5J9P C;  2N05 A;  3CMA V;  1KD1 W;  5JVD A;  4X65 B;  4LFA O;  3CCQ V;  2EBO A;  4YJ2 B;  1F7Y A;  3CJH A;  1KUQ A;  5K1X A;  4DW0 A;  1GTO A;  2QWP B;  1VQ4 V;  3H1J H;  2ZKO A;  4HZ3 A;  1URF A;  2M7W A;  4DV4 O;  4CS3 A;  2IJK A;  5KUK A;  4JI4 B;  1ROP A;  1WB7 A;  2WLJ A;  4DUY B;  1OCZ B;  2YUA A;  3LSU A;  3ZMU A;  3RYF B;  4FLY A;  1WP7 A;  2X0L A;  1Q7Y W;  3CX5 F;  2W0F C;  4LH6 A;  2DOS A;  1ZWI C;  2Y48 A;  1Q90 D;  4FLZ A;  5JWP A;  4IT5 A;  1D2D A;  3IJ4 A;  3RFR A;  3RT3 C;  3E2E A;  1Q43 A;  4DV3 B;  4YJ2 A;  5IE9 A;  2FL4 A;  4WFH A;  4JGS A;  1XIL A;  4ZBM A;  5EC2 C;  1GN4 A;  2UUA B;  2DMX A;  4LWS B;  4Z2W A;  2YI8 A;  3Q4H B;  3A2F A;  3OTF A;  4R7C A;  4PD4 F;  2Q69 A;  3G6E V;  1QCE A;  4UFZ A;  2Q4P A;  1S5J A;  3OMN B;  2RQ6 A;  4L8J A;  4PA6 A;  1HNX B;  3ZBH A;  4R8C A;  3QNE A;  1N8R W;  2XT9 A;  3KCY A;  4TOI A;  4WBN B;  1N33 B;  5BY1 A;  2PYL A;  1THZ A;  3AG1 B;  3AG2 B;  4K3A A;  4I9W A;  1FJG B;  3T1Y O;  2YIB D;  3K08 A;  3ASO B;  1QVF U;  4KP4 A;  4LWS A;  2QR4 A;  3Q4H A;  3BCC H;  2PI5 A;  3KZI Z;  3SJA C;  2MK3 A;  3OD4 A;  4PI0 A;  4LFC B;  2PZS A;  4LF5 O;  3OFN G;  2HLD G;  4WBN A;  2BOB C;  2QTS A;  5B1B C;  5CBF A;  1VF7 A;  3BY6 A;  4F6R A;  1IDS A;  2EIL C;  5DN6 G;  3ZMS A;  4CH5 A;  4PDR A;  1WA8 B;  1GN2 A;  5B1A B;  2AGA A;  1IZ3 A;  5EBL C;  1KBH A;  1K4D C;  2QEX V;  3ZMZ A;  5B5E Z;  1AR1 B;  3MD0 A;  5IJ9 B;  5KMG B;  2JDI G;  4TUY B;  2OTJ V;  4JI5 O;  1VIB A;  4QPJ A;  2Y0P A;  2ITC C;  5GON B;  5FNV B;  2YXH A;  2QE7 G;  4DR2 B;  4YXW G;  3DGE A;  2B9Z A;  4CC6 A;  3MHS C;  4DXW A;  3IGA C;  1CPY A;  5BR8 B;  3SPH A;  3OT7 A;  1WA8 A;  1WP8 A;  1JR9 A;  2UXN A;  4J42 A;  2WLN A;  1DF5 A;  4P9P A;  2OTL V;  4PA3 A;  1Y67 A;  1IBL B;  1I7F A;  2R9A A;  4OX9 B;  1I94 O;  4PDV A;  3ZJZ A;  1JMK C;  5JCO A;  5GON A;  1OV9 A;  2BSK B;  1TA8 A;  2ETN A;  4LH7 A;  3U11 A;  2Y4U A;  3IC7 A;  4LNU B;  4BIZ A;  4MVM A;  3ZIA G;  3P3N A;  3QO5 A;  1WLE A;  5L3F A;  1SC5 B;  2Z3Y A;  4ICG A;  1SQV H;  2YIB A;  4FMT A;  4G28 B;  3OTO O;  2A0L A;  2YIC A;  4JI6 B;  2HR3 A;  2F4V B;  3ZED A;  2K9P A;  2YS8 A;  3T1H O;  2EIN B;  2HKO A;  1P84 F;  2DN9 A;  1VQ8 V;  4GKJ O;  4I5S A;  1JA8 A;  3RW0 A;  2JEX A;  4JI0 B;  1P7G A;  1MSW D;  3CCM V;  3I55 V;  5KHK A;  4FM2 A;  3ZHQ A;  1N36 O;  1GH6 A;  1VF5 B;  1TVK B;  3FB5 C;  3R65 A;  3AG4 C;  2VQE B;  2CDY A;  5FPO A;  1V54 B;  1H2M A;  2Q8V A;  1XBL A;  4O2B B;  1E1R G;  1W59 A;  3SPJ A;  4TV9 A;  2PUS A;  2F43 G;  2UXB B;  4J11 A;  4Z1M G;  1KYO F;  1GM8 A;  2GSM B;  3SJC C;  1TUB B;  1AP6 A;  4JI1 B;  1JFF A;  1K7D A;  2JK5 C;  1YTF B;  3JD1 A;  4FLT A;  3AG3 B;  2O57 A;  4UVA A;  3K5M A;  4PA4 A;  1FPO A;  2EIM B;  4EFB A;  2VQF B;  4TV8 A;  1HNW O;  2QA4 V;  4XDK A;  4DR5 B;  3JCZ A;  5IDJ A;  4UVC A;  4GUN A;  4LF7 B;  4GKK O;  1O9G A;  1FFT B;  4FIP C;  4GLX A;  3WB2 A;  2WLL B;  4DV2 O;  3ICX A;  3VBB A;  4O2B A;  2DYS C;  4O4J B;  4FZ0 A;  3TGU H;  2ZIN A;  2BTQ B;  1XHX A;  3CC4 V;  3IFX A;  4IIJ A;  5LMU O;  1TUB A;  3W7W A;  5K1P A;  4JI3 B;  2AHZ A;  1P4R A;  1XDC A;  3N2K A;  1YXB A;  1VAR A;  4XBF A;  3J80 N;  5IJ0 B;  3ABM B;  1F51 A;  2E74 B;  3C3T A;  4P9O A;  4MVU A;  2FML A;  1YIT V;  4I55 A;  4HYO A;  4ZIB A;  4H44 B;  4O4J A;  4LF5 B;  2P4V A;  3CPW U;  2CTW A;  4NTY A;  4IL6 Z;  2ZNJ A;  4DV5 O;  5TIS Z;  4O4H B;  2E5L B;  3K58 A;  4YHH O;  4HNA B;  5KA6 A;  1KP3 A;  2AW9 A;  2F95 B;  2FKX A;  1ZTE A;  1DGS A;  4MTX A;  2CTP A;  2OYQ A;  2ZT9 B;  3K06 A;  2DQ3 A;  2M6Y A;  2DW4 A;  3A0H Z;  3L71 H;  4Q6G A;  3BPZ A;  1WAZ A;  4DR3 B;  4X1I A;  3A0B Z;  2EIK C;  1EZJ A;  1OCR B;  1ZX3 A;  3E89 A;  1M57 B;  1SS3 A;  2QM4 A;  1F23 A;  2QTO A;  3JD0 A;  1IBK B;  1VQN V;  2WLK A;  4K35 A;  3K5L A;  1SET A;  1JCH A;  4HNA A;  2QWR B;  3CCJ V;  4JI4 O;  3CSX A;  4IGG A;  4CZZ A;  3CC7 V;  4DUY O;  3D3I A;  2DQ0 A;  2F23 A;  4TQD A;  3CCL V;  1S5L Z;  1UFI A;  2Q7G A;  1I94 B;  3E22 B;  2Q9L A;  2Q7E A;  5CA3 A;  1BQ0 A;  3JAT B;  2WLI A;  2GV9 A;  3B2E E;  1S76 D;  1BT8 A;  2HJF C;  2W6I G;  4DV3 O;  1XNQ O;  4X9Q A;  5EYP B;  1LUV A;  5LA6 A;  3QO7 A;  2LFS A;  2JJ2 G;  5LYJ B;  1G4Y B;  4YIO A;  3GWO A;  1H2G A;  3OGI B;  3RYC B;  2MW2 B;  4DR4 O;  5LHG A;  1M9N A;  1HNX O;  4JTC B;  3T1H B;  2JS3 A;  3E22 A;  2IW5 A;  1N33 O;  1BE3 H;  3D3Q A;  4XDL A;  2OCC B;  5B3S B;  2QKS A;  4GKJ B;  1FJG O;  1Y66 A;  3K79 A;  1VP7 A;  1N36 B;  3RVY A;  5LP6 C;  2EJR A;  3CRC A;  5BXZ A;  4QNH B;  2EIJ B;  2QWO B;  4RUE A;  5E1A C;  3RYC A;  1FXV A;  1I08 A;  4B3R O;  4LCU C;  4LFC O;  5BMV B;  2ZXW B;  4DO2 A;  4LF6 O;  3CE2 A;  4MTO A;  4WFE A;  4FJC C;  3JSN A;  4Q20 A;  3APQ A;  1PP9 H;  3ABL C;  1FD9 A;  2ZDI A;  1OJH A;  2YIA A;  3ZHV A;  5JJN B;  4FFK A;  3RYH A;  2LGQ A;  2Q68 A;  1RM1 B;  3CCR V;  4QPK A;  3WG7 C;  2OCH A;  1GN3 A;  2UUB B;  1X4T A;  3O9O A;  4JAA A;  1J95 A;  3JD2 A;  1KB9 F;  5LHI A;  2W0X A;  2RDC A;  2R9I A;  2L6L A;  1AB3 A;  3BHP A;  1DF4 A;  5C8Y B;  5BR8 O;  1FXK C;  1F4M A;  1NR7 A;  2GUZ A;  4N23 A;  1YDX A;  2D2C B;  4X8A A;  4TSF G;  2E76 B;  2WA4 A;  5EIB D;  2LJ2 A;  3JAK A;  3K04 A;  3QG5 A;  5C93 A;  1BMF G;  5IY5 B;  1KC8 W;  1SQG A;  1D5N A;  2ZR2 A;  2Y69 C;  4J80 A;  1P49 A;  4B08 A;  1MA1 A;  2ZE5 A;  5H6Q A;  5CN0 A;  1AJN A;  4RO2 A;  1AI6 A;  3K0G A;  3DC5 A;  1HP8 A;  4U7O A;  3CRR A;  3NXS A;  5JH7 B;  2DWE C;  4DV6 B;  2AZ2 A;  1ZL8 A;  2AXT Z;  1NJI W;  2F66 C;  3W7X A;  3ASN C;  5IT9 N;  5C8Y A;  4UV9 A;  2X6B A;  1G8M A;  5HFM A;  3LDD A;  4H37 A;  3CP1 A;  2YSU B;  1N32 O;  2LFR A;  2XHB A;  1QHT A;  2QSA A;  4IHJ A;  2ZE7 A;  4JI6 O;  4I4T B;  2F4V O;  3ZHT A;  2NN4 A;  4GT1 A;  4I50 A;  5CA1 A;  3QTC A;  1Y6X A;  4J7Z A;  3BA9 A;  3ZHR A;  2YXY A;  3SR2 C;  4ZI7 A;  5CBG A;  4JI0 O;  2F93 B;  5JH7 A;  3S3X A;  4YY3 B;  3O65 A;  1Q8I A;  3DSQ A;  5JJE B;  3FD9 A;  5EZY B;  3K59 A;  2VRZ A;  3VQY A;  2VQE O;  3CCS V;  1K4C C;  3CRQ A;  4FVM A;  2XAQ A;  1G6U A;  3QVN A;  2UXB O;  1Y76 B;  3UO2 A;  1M56 B;  4UXN A;  3HKC B;  3UO3 A;  5H5N A;  2LO1 A;  4I7Z B;  4CH6 A;  3L72 H;  1N4C A;  4JI1 O;  1V55 B;  3EHB B;  1HW7 A;  3HPL C;  1P7B A;  1ENV A;  1XNQ B;  3L74 H;  3OE7 G;  2VQF O;  2NR5 A;  1VQP V;  1NVP D;  4DR5 O;  1QLN A;  3B4S A;  4LF7 O;  3ZHU A;  4DR4 B;  2IJI A;  2WWW A;  4WFG A;  3K57 A;  3RYF A;  1VQ9 V;  1G1X B;  2N74 A;  5F2V O;  2RN9 A;  3HKD B;  1FKA O;  1R6K A;  1DK1 A;  5B1B B;  3IAY A;  1MAB G;  1SQP H;  4JI3 O;  1R6T A;  4WFA V;  2FYU H;  4H33 A;  3AEI A;  1SQQ H;  1Q6U A;  3LDE A;  4ZOL B;  4X66 B;  3ZRV A;  4DUZ B;  1R73 A;  4MTF A;  4X1Y B;  4UCO A;  2IH3 C;  3RWR D;  4R6Z A;  4B7E A;  3FFQ A;  4B3R B;  3IC9 A;  2WSS G;  5GTI Z;  1SQF A;  1JVM A;  3M99 B;  1QQC A;  2ATK C;  5JQG B;  4LF6 B;  4DV1 O;  2E5L O;  5IYZ B;  5KHI A;  5AG2 A;  4JV5 B;  4UCR A;  4WFB V;  3H1H H;  1NVP B;  4ZOL A;  4DR3 O;  2JEU A;  5EC1 C;  3J7A U;  2QGN A;  4MW3 A;  4YIP A;  2BOC C;  3AG2 C;  3BAA A;  3UT5 B;  4TQF A;  3E8G A;  2CH7 B;  1PD3 A;  5DED A;  3CS5 A;  2G38 A;  3ZN0 A;  3G67 A;  5D5P A;  3MDS A;  4DR6 B;  1XEQ A;  1IBK O;  1GM7 A;  1VF6 A;  1L0N H;  5IYZ A;  3JD4 A;  5CA0 B;  1M4U A;  4AHC A;  3T2M A;  1OHH G;  3ABU A;  3OUS A;  2HVJ C;  2DWD C;  3WFV A;  3A0R A;  2PYJ A;  5CBH A;  2VWJ A;  4X1K B;  3M7M X;  2ARH A;  5IJ9 A;  2JVD A;  1XNR O;  3UT5 A;  2DE0 X;  4RQE A;  2WAM A;  5KMG A;  4TUY A;  5B1A C;  1M90 W;  2LGW A;  4TT3 G;  1YTF D;  2XAH A;  5FNV A;  3OEH G;  4JI7 O;  5CA0 A;  2RNB A;  2ZCE A;  2Z5U A;  2X6A A;  1TUE B;  3AG4 B;  3L9D A;  3N2G B;  2XAS A;  5L3C A;  1N32 B;  3CC2 V;  3R66 A;  5JCO C;  2V4D A;  1XMO B;  4YJ3 B;  3FYE B;  4X1K A;  1WPX A;  1GRJ A;  3LSS A;  1OCO C;  1SRY A;  4DR1 B;  2A9H A;  2B1I A;  1Q86 W;  1Q6I A;  1R3L C;  1AR5 A;  3AK1 A;  3D36 A;  2BSK A;  2DJV A;  3HKE B;  4LP8 A;  1R6N A;  1FXH A;  2XAF A;  1OCC C;  5CB4 B;  4LNU A;  2EZO A;  4J7K A;  4ZKI A; 
#chains in the Genus database with same CATH homology
 3UKM A;  1V55 C;  5HFL A;  4CZZ A;  3CC7 V;  4P2Z A;  3I56 V;  2DYS B;  2JJ1 G;  3FKS G;  4BW5 A;  3D3I A;  2DQ0 A;  3CCU V;  2XAJ A;  3CCL V;  1H8E G;  5LBQ A;  3LUT B;  4QIW F;  2H8P C;  3K3W A;  1Q82 W;  1QBZ A;  5CA3 A;  1VQL V;  2WLI A;  3H01 A;  1VQ7 V;  1JQ0 A;  1S76 D;  2HJF C;  2W6I G;  3JYC A;  4BIU A;  1YJN V;  2P90 A;  4PDM A;  5IYC O;  4R50 A;  1K5S A;  3QO7 A;  2LFS A;  3P32 A;  2JJ2 G;  4PA9 A;  1AI4 A;  1G4Y B;  4PA7 A;  3AG1 C;  3E8H A;  3GWO A;  5H9C A;  1H2G A;  3ETE A;  1ARO P;  4KUM A;  1PNL A;  3ABT A;  4MW8 A;  3SPI A;  4F4L A;  3T4Z A;  1K5Q A;  5LHG A;  4ASU G;  1M9N A;  1COW G;  3SYP A;  4JTC B;  3G4S V;  3FB8 C;  4JTA B;  5IY5 C;  3ASO C;  3LNM B;  2AHY A;  3ZN1 A;  2IW5 A;  5J9P C;  3CMA V;  1KD1 W;  1BL8 A;  4XDL A;  2XAG A;  2OCC B;  5B3S B;  2QKS A;  5B1N A;  1V54 C;  3CCQ V;  2EBO A;  1Y66 A;  4JAV A;  1JOY A;  1MG1 A;  3K79 A;  3FB6 C;  2GHY A;  1KP2 A;  1AJQ A;  1GTO A;  3RVY A;  1F4N A;  2IJH A;  1VQ4 V;  4WFF A;  4JTD B;  2EJR A;  4HZ3 A;  3ZCC A;  3OW2 U;  5L3D A;  1OCO B;  2M7W A;  4X88 A;  4QNH B;  2EIJ B;  2IJK A;  5KUK A;  2EIK B;  2WLL A;  4RUE A;  5E1A C;  3OMA B;  1FXV A;  1ROP A;  3HB3 B;  2WLJ A;  4LCU C;  1OCZ B;  3ZMU A;  2ZXW B;  2X0L A;  4DO2 A;  3TET A;  1Q7Y W;  5L3B A;  3MHH C;  2W0F C;  3ZRS A;  5KA5 A;  4MTO A;  4WFE A;  1OCC B;  1ZWI C;  4FJC C;  2Y48 A;  3UM7 A;  1MOF A;  3K0D A;  4UV8 A;  4Q20 A;  3E2E A;  3B8N A;  1Y4M A;  3ABL C;  2ZDI A;  3ZRW B;  4WFH A;  2K1E A;  1ORQ C;  4JGS A;  1NH2 B;  4RAI A;  4ZBM A;  2WLM A;  5EC2 C;  1L1F A;  1JX9 A;  4G2K A;  2Q68 A;  1RM1 B;  4R7C A;  4FK5 C;  2Q69 A;  3E8F A;  3X2Q B;  1QCE A;  3G6E V;  4QPK A;  3F5W C;  2HVK C;  3WG7 C;  4CBC A;  4X89 A;  3B8M A;  3OMN B;  2B5U A;  3DTU B;  4PA6 A;  4R8C A;  3QNE A;  1N8R W;  4BAY A;  5B1O A;  3T1C A;  1J95 A;  3JD2 A;  1DLB A;  4MVS A;  5LHI A;  3OUF A;  1VQM V;  2R9I A;  4MVQ A;  2X7R B;  1THZ A;  1HWY A;  3AG1 B;  2P6J A;  3AG2 B;  3CCV V;  1DF4 A;  2H94 A;  4I9W A;  1FXK C;  5LGN A;  1F4M A;  1NR7 A;  3CCJ V;  1YI2 V;  4N23 A;  1W0K G;  2W6J G;  4X8A A;  4TSF G;  2B1G A;  1RPR A;  3K9A A;  4JAU A;  4GX0 A;  1S5H C;  1K8A W;  3K04 A;  3K08 A;  5C93 A;  1BMF G;  5IY5 B;  3ASO B;  1QVF U;  4KP4 A;  1KC8 W;  1PNM A;  2Q67 A;  2ZR2 A;  2Y69 C;  4LBE C;  1YSC A;  1K73 W;  1PNK A;  2PI5 A;  3OAA G;  1NKD A;  2IH1 C;  1YHQ V;  1QR8 A;  2MK3 A;  5H6Q A;  1H8H G;  5CN0 A;  1AJN A;  4RO2 A;  1AI6 A;  3K0G A;  3CCE V;  3OFN G;  2HLD G;  4U7O A;  3NXS A;  2DWE C;  2BOB C;  5CMU A;  2LP7 A;  1NH2 D;  1NJI W;  4E2L A;  5B1B C;  5CBF A;  2EIN C;  3W7X A;  3BY6 A;  3ASN C;  1S72 V;  2EIL C;  5DN6 G;  3ZMS A;  1OCR C;  3TCU A;  4UV9 A;  1K97 A;  1KEC A;  2X6B A;  4PDR A;  1G8M A;  4MVR A;  5LGT A;  5HFM A;  3LDD A;  1M57 C;  4H37 A;  3CP1 A;  5B1A B;  1SES A;  2YSU B;  2A79 B;  4PDL A;  2LFR A;  3E8B A;  5EBL C;  1CEZ A;  1K4D C;  4GT1 A;  2QEX V;  3OEE G;  3B77 A;  1VQO V;  2QM8 A;  3ZMZ A;  1AR1 B;  3MD0 A;  1NR1 A;  1W0J G;  3FYI B;  4RUF A;  3ZMT A;  2JDI G;  5L3E A;  5LHH A;  2OTJ V;  4QPJ A;  4JYC A;  1M1K W;  2ITC C;  3ABL B;  5CBG A;  2DYR C;  2KB1 A;  1K34 A;  3G71 V;  2QE7 G;  3OGC C;  3QO8 A;  3DGE A;  4YXW G;  4MTG A;  1S77 D;  1R3I C;  5KUM A;  1AI5 A;  3MHS C;  1YIJ V;  5H6R A;  4DXW A;  3IGA C;  1CPY A;  3SPH A;  1GM9 A;  4MSW C;  3CCS V;  2UXN A;  3AG3 C;  2WLN A;  1K4C C;  2UXX A;  1DF5 A;  4P9P A;  2EIM C;  2OTL V;  4PA3 A;  4MT8 A;  2PI4 A;  3SJQ C;  2XAQ A;  3OR6 C;  3OR7 C;  1QR9 A;  3GB7 C;  2ZQM A;  1M56 B;  4UXN A;  4PDV A;  3ZJZ A;  4WF9 V;  1V55 B;  2WLH A;  3EHB B;  3SPG A;  3HPL C;  1FXK B;  1QLE C;  1P7B A;  2WPD G;  4MS2 A;  1ENV A;  4TWK A;  3OM3 B;  3OE7 G;  1AJP A;  5BZB A;  1K92 A;  1VQP V;  1NVP D;  3W7U A;  1QLN A;  4QE7 A;  3IC7 A;  2YEV B;  4BIZ A;  5DM6 V;  4MVM A;  3ZIA G;  4LC1 A;  1SER A;  3ETG A;  5B3S C;  3KG2 A;  3QO5 A;  1WLE A;  2IJI A;  5L3F A;  3PJS K;  1B6Q A;  2WWW A;  3FB7 C;  2NNU A;  2Z3Y A;  2IU3 A;  4WFG A;  2ZDI C;  4FMT A;  2R9R B;  4G28 B;  3SPC A;  2A0L A;  1VQ9 V;  2CK3 G;  3STZ C;  2HR3 A;  3ABM C;  4PEL A;  1CP9 A;  1R6K A;  1EFR G;  5B1B B;  4XDJ A;  2EIN B;  2EIJ C;  2OT5 A;  2HKO A;  1GO3 F;  1MAB G;  1S3J A;  2WLI B;  3ASN B;  1VQ8 V;  1DTO A;  1NBM G;  4WFA V;  4I5S A;  3STL C;  3RW0 A;  3ZRW A;  2JEX A;  4H33 A;  3AEI A;  4JYB A;  3VOU A;  3CCM V;  1MSW D;  3LDE A;  3I55 V;  1R3K C;  3W7S A;  3ZRV A;  1KQS U;  1PKX A;  1R73 A;  4MTF A;  4KFM A;  1KKD A;  5EBW C;  4G27 B;  2YEV A;  4JPR A;  1GMG A;  2IH3 C;  3ABK C;  3FB5 C;  3R65 A;  3AG4 C;  4R6Z A;  3CXC U;  1K9M W;  2JIZ G;  1V54 B;  2Q6A A;  2WSS G;  1H38 A;  1E1R G;  3EFF K;  3SPJ A;  3F7V C;  3CYO A;  1JVM A;  2DYR B;  3M99 B;  2ZR3 A;  2F43 G;  2ATK C;  4EKW A;  4Z1M G;  3CME V;  4GX2 A;  1RM1 C;  1GM8 A;  2GSM B;  3OMI B;  3X2Q C;  1K7D A;  4JAS A;  1OZ0 A;  1XL4 A;  2JK5 C;  1VQK V;  1YTF B;  3ML0 A;  4WFB V;  1BHB A;  3JD1 A;  3AG3 B;  2HG5 C;  5EBM C;  3F7Y C;  1VQ6 V;  4UVA A;  4PA4 A;  2EIM B;  1NVP B;  3SYQ A;  1E79 G;  4GCZ A;  1YJW V;  2P7T C;  2QA4 V;  2JEU A;  1YJ9 V;  4XDK A;  5EC1 C;  1PL0 A;  3JCZ A;  5LGU A;  5IDJ A;  4MW3 A;  4UVC A;  2BOC C;  3AG2 C;  3SYA A;  1S0V A;  5GW7 A;  4FIP C;  1FFT B;  3E8G A;  1PD3 A;  1I5X A;  2WLL B;  3ZN0 A;  3E83 A;  3VBB A;  2DYS C;  2C2A A;  1QLE B;  4J9Z B;  3ZMV A;  1VQ5 V;  4GX1 A;  1GM7 A;  1E1Q G;  3ETD A;  3CC4 V;  4OXS A;  3IFX A;  3JD4 A;  4FPP A;  4GX5 A;  3W7W A;  3E86 A;  4QE9 A;  1JJ2 U;  3T2M A;  1OHH G;  3WG7 B;  3ABU A;  2AHZ A;  3OUS A;  2HVJ C;  2DWD C;  3CCR V;  1P4R A;  3A0R A;  3WFV A;  2P67 A;  2XND G;  3LDC A;  4XBF A;  3BEH A;  4UUJ C;  5CBH A;  2X6C A;  1BHA A;  3ABM B;  4QJF B;  1FS0 G;  1F51 A;  2QM7 A;  2V7Q G;  3ZRX A;  4P9O A;  1EBO A;  2ZD9 A;  1GK9 A;  3JD3 A;  4MVU A;  4RQE A;  2WAM A;  3TK1 A;  4J9Y B;  1R3J C;  1UJW B;  1YIT V;  5B1A C;  1M90 W;  4JF3 A;  2XOK G;  4TT3 G;  4HYO A;  2NLJ C;  1YTF D;  2XAH A;  3CPW U;  3OEH G;  3LSQ A;  5L3G A;  4RQF A;  5EK0 A;  4WCE V;  2Z5U A;  2X6A A;  1TUE B;  5KA6 A;  1KP3 A;  2OCC C;  5IYB O;  3SYO A;  2Y69 B;  3K03 A;  2HFE C;  2IJJ A;  3ABK B;  3AG4 B;  1QVG U;  2EZP A;  2IU0 A;  2D3O W;  2XAS A;  5L3C A;  4MTX A;  3CC2 V;  1RPO A;  3K06 A;  1JPX A;  2DQ3 A;  1GKF A;  2DW4 A;  4MVZ A;  4N21 A;  4HAM A;  3FYE B;  2FTK A;  3RVZ A;  4MVO A;  1SZT A;  1WPX A;  3LSS A;  1OCO C;  1SRY A;  2A9H A;  2B1I A;  1Q86 W;  2EIK C;  2EIL B;  1R3L C;  3E35 A;  5IYD O;  1EZJ A;  1OCR B;  3RBZ A;  3CD6 V;  3E89 A;  4U7N A;  1FXK A;  1LNQ A;  4L87 A;  1M57 B;  3D36 A;  4UVB A;  1AI7 A;  1F23 A;  1OCZ C;  2V1D A;  3SYC A;  2ZXW C;  3W7T A;  2QTO A;  3JD0 A;  3P30 A;  1I5Y A;  1VQN V;  4P30 A;  2ITD C;  2WLK A;  5FL7 G;  1Q81 W;  4LP8 A;  1R6N A;  1SET A;  2XAF A;  1FXH A;  1K33 A;  1K3E A;  1JCH A;  1M56 C;  1OCC C;  1XL6 A;  2EZO A;  1W2B U;  1NQT A;  1IXM A;  4ZKI A;  3T4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...