3G4ZA

Crystal structure of nisod y9f mutant at 1.9 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of conserved tyrosine residues in NiSOD catalysis: a case of convergent evolution
pubmed doi rcsb
molecule keywords Superoxide dismutase [Ni]
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 50
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 3g4zA00
1Q0DA 3G50A 1Q0FA 1Q0GA 1T6IA 4NCQA 3G4ZA 1Q0KA 3G4XA 1T6UA 1Q0MA 1T6QA
chains in the Genus database with same CATH superfamily
3R2PA 3FVYA 3LEVA 4EIYA 3U2LA 5KYWB 1JRAA 2A1DD 2R03A 3TULA 1FMWA 1T01A 2XLVA 2UUIA 3N24A 3WHNA 5JT4A 3EHMA 4XPYA 3FOPA 3S0XA 5L0DA 1YDIA 3S29A 1MMGA 4BEJA 2NG1A 5BUOA 3NMIA 5DVWA 2BL2A 3K66A 3B0UX 3A11A 1RMVA 1D1AA 2R25A 2GAQA 3CZ6A 1NLXA 3X2QC 1QPUA 3M79A 5EGYA 4JE9A 1Z7Qc 1CGME 4RDAA 2FFHA 1S05A 2OOCA 4J32B 4RBNA 1FFHA 2A6EF 2VCBA 2YL0A 3MYIA 3US6A 1IZMA 1ZHWA 1R4TA 2NUPA 3CAXA 5GPGB 4IGGA 3F46A 1K40A 2PF4E 1JAFA 3KKBA 5T3TA 2J46A 3AJMA 2BC5A 4N06A 1Q0KA 1NFOA 2D4UA 1C17M 4LDRA 2AU5A 2HV7A 4MVZA 2MHRA 1SR2A 1ZYRF 3JCUQ 2ASRA 1M6TA 1ORJA 2XM0A 4H54A 2HSBA 4MVSA 1VOMA 4HFFB 2IXOA 5KYUA 4DBRA 2L7AA 2Q7RA 1G4WR 2EINC 2WVOA 2QY9A 1HY5A 3VRCA 2EPOA 3IHUA 2H7OA 1ORYA 3NKEA 3ZQVA 3LNMB 3NYLA 1LIHA 2HUJA 3IQ5A 3VAYA 2A0BA 2HKVA 2CYDA 3QZCA 4KC9A 3WODF 4CS9C 4E7ZA 4L6RA 2NUTA 5T3WA 1E85A 4JW1A 1NZEA 4GEHA 2I8BA 2J9VA 4E0HA 3J06A 1KU2A 1FFTC 3O39A 3EQLF 1HE9A 5COFA 1N1CA 3JRMO 1IW7F 3EGXA 1NG1A 5L0FA 1ZVZA 3G4XA 4I1MA 4XPXA 3JT1A 3GANA 1KNYA 3GM3A 3T6BA 3E9VA 4JCHA 4EBBA 3OWTA 4YN0B 4NTAA 1JMWA 1DOVA 4XPWA 2Y39A 1LM3B 2KK1A 2XLEA 1O3UA 1LVKA 2DYSC 2Q3TA 4IAOA 3S90A 2Z15A 3TJ5A 3T4RA 4GQHA 2W4BA 2XRHA 3N0TA 4QI0A 5A6KA 4LDQA 4I3MA 2QUPA 2IM8A 3GWNA 3AG1C 4OIRF 4OIQF 1E2XA 1TWGA 5HV9A 4QI2A 2PX0A 4XLNF 3VM6A 2OJED 1H9GA 3E70C 4FWVA 5L0HA 4R32A 2WL8A 4U9EA 5T1DB 5A6BA 2J7PA 4OIOF 1OQCA 3IQTA 3AGTA 3LESA 1XZPA 4JTAB 5CI8A 1PV3A 2Q00A 2WB7A 2XL8A 3HTKC 4X0RA 3TQOA 2OCCC 1RKEA 2EPLX 4OD4A 2HSQA 3ASNC 4XWJA 1RKCA 2LSEA 1M2OA 3H2UA 3UMIA 1MMDA 2R7OA 4PK4A 1YA9A 4Q5SF 1R5ID 4U5EE 5FCLA 4HFKB 2DGJA 4N6CA 3GEEA 3ZIBA 4KI2A 5KYUB 3VYWA 2D5RB 1VLTA 4I1OB 2GDCA 1SMYF 2YL1A 1M2VA 3ABLC 3TOLA 4DVYP 2R7VA 1O5HA 3LUTB 4M63A 2EPKX 3KPHA 4BG0A 3NDBB 2OEXA 4AL0A 3DM5A 4EHPA 3I4UA 5K0IA 3HNKA 1HW2A 1YZCA 4UDVA 4EBKA 1TWAA 2NSGA 1OW6A 2V26A 3FHDA 2WVNA 4E0IA 3SNHA 1HE1A 1YA7O 3JYYA 2VCAA 4CX9A 1PD1A 4BJ6A 2AWYA 1LS4A 1ZHTA 4A4AA 3U8PA 5L3VA 5DQTA 1AEPA 3DE8A 2ZXRA 2YRFA 3EH2A 1Z63A 1ZW2A 2R7TA 2XS1A 1D1CA 4DXWA 3DE9A 2VH3A 4MTFA 4W8PA 2KW3C 3SXMA 2E87A 3B9QA 4IARA 2QTVA 3QVZA 4JVSA 4PFOA 2JD3A 4XEKA 2YHSA 1WTYA 4C7OB 3O10A 4YK5A 1TWCA 4LLCA 1VYKA 2I15A 1OCRC 4D4NA 2YEVA 1OR3A 2LD6A 3Q6NA 3ASOC 4JKVA 3KH2A 1TWHA 1OXKA 1YVIA 2XS8A 3DMDA 3LAYA 2J9UA 4MNDA 4J30B 1V74B 1L3PA 2HS5A 3IQCA 4E17A 2OU6A 4U9DA 1MNEA 4ZLDA 1HMDA 1YAUO 4ER9A 5A69A 5EHHA 2F22A 1WATA 1RJ9A 2YZSA 2GA0A 4P9FA 1OCCC 4XTKA 3AOUA 3S28A 2RD9A 4YJWA 1RKEB 4BJ1A 2Y69C 4RD9A 1RCPA 4C3DA 1OCOC 3GEHA 2VASA 1A41A 4YL1A 2IXMA 5BQHA 3EGDB 3DI5A 5F5FA 2CNWA 256BA 1TFOB 3FMSA 3DWWA 2YLDA 4EUKB 1YYXA 4BJ6C 2PX3A 3DJUB 1LS1A 2Y3HA 4WJ0A 4Z9IA 1J8MF 3M4BA 4OINF 2YKZA 2MWQA 1D0ZA 2C03A 2IYLD 3LNRA 3RF3A 4CIPA 2W45A 3B0VC 4MVMA 3C8GB 1QVXA 4IWBA 1A7EA 2L81A 2L6HA 4EKWA 1QLEC 2NPUA 3EPVA 3Q7LA 4XEFA 4Z9HA 2XLDA 2Y3BA 1WOLA 5AGFA 5E3CA 1LI7A 4P9TA 3SZRA 3TJ6A 3IPMO 3K6BA 1SF8A 3HLZA 3L8IA 1Z23A 3ZVRA 1WN0A 1J8YF 3RW0A 4JCZA 3QMKA 5F28E 3SEOA 2YVKA 1B68A 1H6GA 3RVYA 2GFHA 3W2VA 3UGPA 4FX5A 1UFBA 1D0YA 3QTHA 4NQFA 2A0UA 3AQBA 4YL3A 1APCA 2C04A 4AL1A 2ETSA 5L0IA 1A7DA 3EG9A 3MBGA 4NTFA 2XLHA 4U5GA 2R7SA 4CSAA 2LQGA 2CCYA 4CS8A 4CIHA 4BPMA 2OKUA 3JSZA 5DS4A 1NFNA 3V5YA 1QZXA 1ORSC 1V55C 2G62A 2ZPAA 3OEOA 4NY3A 3SXZA 2PP4A 3LJBA 5DLJA 1V54C 5HSWA 4YWQA 2R7UA 1TR2A 5D92A 2AP3A 2H7BA 1T6IA 3HNIA 2LIGA 3KYJA 2WZGA 3G4ZA 3M4CA 4JC7A 4YT4A 4IJJA 5L0JA 3ZTZA 1JR8A 2KSFA 5A6BD 4PACA 4CDYA 2P6VA 3ZQYA 2OJQA 1RJ9B 2ZD9A 4DOZA 3UMKA 4BJ5A 2XM4A 1NU9C 2QNLA 3IQ6A 1E84A 2H8AA 3FDQA 4YL0A 4JZAA 2EILC 5KYXA 5CIVA 3MYFA 2VCCA 2HJ3A 1F1MA 2RSEB 3JSEO 1I4YA 1LE4A 3MFNA 3HJCA 2X0CA 4O79A 4EBJA 1ZHXA 5JS5A 1ZW3A 2J9WA 3O55A 3RYLA 1GS9A 2KC3A 2NUPB 4DRJB 4O6YA 2OG2A 1SYQA 2EIJC 1I5NA 1D0XA 1OR2A 3LS0A 4U5BE 3C8GD 5E3AA 3TOMA 2XXAA 3V5XA 5DS6A 2LFDA 3V5ZA 3AGUA 1YYJA 4O6MA 3U9MA 2MYSA 3ZSUA 5JLIA 2EIMC 4CS8C 1H7IA 2R05A 4JIOA 4JJGA 3U2MA 4DJ9A 2CGEA 3ITFA 2YL3A 2XSEA 3PCVA 4PJJA 1CGOA 3KYIA 4MQ9F 3W2WA 3ZC4A 4DRIB 2W4MA 3B29A 3DD7A 3GORA 4O7GA 1VYIA 2L6FA 4MW3A 3ZDLA 4LDKA 5KYYA 1RXQA 4B6IA 1ZZPA 4JRZA 4CDAA 5JUAA 5KYWA 1AUEA 1E83A 3BEHA 1JPJA 4PJMA 4CJOA 5B3IA 1Z3IX 2UUHA 4N4WA 2NUTB 1PD0A 1T6UA 4LERA 1Q0MA 3QW0A 2NSFA 5FZTA 3I5QA 2R7RA 4GYTA 1G8XA 2P61A 3L34A 2YWAA 2XLWA 4DBQA 1FNTc 3AG4C 3H2VA 2KJGA 1TFKB 3N2ZB 1LI5A 2HMQA 4A2NB 1EKYA 1BZ4A 2J45A 4JURI 3EGXB 3PMRA 3JTLO 1NBBA 1EQ1A 1Y6DA 3GEIA 1W2WA 4AK9A 3C8ZA 5COMA 1ZU5A 3K33A 4IRUA 1NU7D 4G7HF 3DAFA 3JYHA 2L6GA 2YL7A 2G3KA 2LP4A 1YLMA 2W9YA 4G7OF 1BDJB 2PFDA 3I5PA 4C3EA 1U0BB 1OW8A 1ZHZA 4JEAA 4KNVA 4OIPF 3JZ0A 2AWCA 3NG1A 1KTMA 2JPUA 2KNHA 4DRHB 5KYXB 1DOWA 4AX2A 3S84A 3AG2C 3EZIA 2XL6A 2VC9A 5JVEA 5TJ5E 1FTSA 4FESA 5JRAA 1BR2A 1VLSA 2GWWA 4IAQA 3T6GB 4WABA 1T6QA 3WG7C 5COGA 5EK0A 1G5ZA 5DQZA 4U5DE 3DZAA 1Q0FA 2EPMX 3C7JA 2EIKC 3W8HA 1C02A 3RIPA 1A7VA 1OKKA 1FMVA 4CJGA 3QW1A 3NMKA 1LPEA 1QQ3A 3RKOF 3UGOA 3K7DA 3VF0A 3X1OA 2OEVA 4IB4A 2B0JA 1E86A 4LLEA 4OD5A 2PBEA 3GM1A 1Y4CA 2M4EA 4Q4ZF 5DS5A 2L9JA 1GGQA 1K05A 3DJNB 3POVA 1M2VB 5KYNA 5KYYB 3GWLA 3NRHA 1T9KA 4CS9A 1Q0DA 2DB4A 3EFOA 5JP7A 3RFYA 2R02A 4E18A 3LEOA 4MVUA 2YLIA 2YLGA 2A6HF 3KMIA 2DYRC 4I44A 1I4ZA 1MNDA 1OW7A 5E33A 1A0BA 4NC3A 1CPRA 3CEXA 3FAPB 5D91A 4YT8A 4PFPA 1D1BA 2JX0A 4Z9JA 3CQZA 5JSLA 1VB5A 5B3SC 3UMHA 4FAPB 3M1CB 4QDLA 3K1IA 3LLIA 2WZFA 1TQGA 4MVOA 4ULVA 4U5HA 3KL4A 4CS7A 5BQIA 4MTGA 3U9JA 2Q9AA 4XQ1A 2FAPB 3L1MA 5B1BC 2HMZA 1ST6A 4C3BA 1H9TA 1U6HA 4JTDB 2A69F 3A9CA 3FOOA 4LACB 1FAPB 1VMAA 2XLMA 3FXHA 5L0CA 3RQFA 3AQCA 3LS1A 1UG7A 1WGWA 3L8JA 3OA1A 5A6JA 2Q4FA 2J9BA 2Y3GA 2WZLA 3ECSA 4J7YA 4JJFA 3K1HA 3IEEA 3RQEA 3LLKA 4KNWA 4PJNA 3PDMP 1YJGA 3T6JA 4HE8D 4G0HA 1O87A 2J7PD 3TD7A 4O6NA 5BQGA 3AG3C 4CBEA 4J7TA 2IBFA 3GM2A 3MX3A 4WGYA 2Y3DA 3C63A 3SXYA 4PR9A 1JOGA 3EH1A 2YQYA 2B0HA 1XZQA 4MVRA 3QVYA 1MMNA 2LK4A 3U0CA 4K0DA 1Z5ZA 5F5HA 5B1AC 1NSGB 3RVZA 2Q9CA 2A68F 1MQVA 4AE4A 4U5CE 3DM9B 1PCXA 4XEVA 3W4YA 4JTCB 1OXBA 4CDVA 2R7XA 3BRJA 3B71A 1U89A 5L0GA 5IY5C 3CSKA 3T9OA 2EPNA 4E7SA 4MVQA 4ANJA 3O6XA 4MW8A 2KGOA 4ULWA 5A6AA 3ATPA 3R7CA 3K1IC 1XWJA 3SP1A 3EFOB 2P7VA 3U5SA 4CSAC 3NYJA 3DAGA 4C7OA 1G4US 2CW0F 1LKXA 2J8WA 4NTBA 4N6HA 2DI3A 1EI7A 2O9XA 1QKRA 2Q9BA 2R7QA 3NMJA 4KBLA 4U5FE 3SXKA 3MLGA 4JEBA 1VTMP 3ZTMA 3EZHA 3EJNA 2QLAA 4WGZA 3HNJA 3RH3A 2OQMA 1ZU4A 4DVZA 3FAJA 2IXNA 1BBHA 1HW1A 1YZAA 3ABMC 3EHNA 4F4BA 4EWCA 1WASA 1GQAA 3EG9B 1GM5A 3UR3C 3PHF2 4MTOA 3GODA 1WWPA 2XL4A 3V7OA 4BJ5C 4K7BA 5AC4A 1AVOB 4BEMJ 2X51A 1Z6AA 3EGDA 1VK5A 1BR1A 1SZIA 1T5OA 1OCZC 3W8IA 3DXJF 3UNGC 2P1AA 3RQGA 2ZXWC 1L7CA 3TK0A 4BJTA 2J0XA 4W8KA 3HNLA 4Q7CA 3U3FA 1S7ZA 2ZXOA 1V4AA 2M64A 1YARO 3C8GA 1ZHYA 3B0PA 5CI9A 4P6IC 2IOQA 2ICWG 2TMVP 1CPQA 2P0NA 1BR4A 3M15A 2LCHA 4YT5A 1MMAA 1K04A 2R9RB 5L3QA 1Q0GA 2G3VA 2FGYA 4ONSA 2KQ9A 3S9OA 1OKKD 3ZG1A 3HKKA 2H7VC 2WVQA 4YT2A 3NKDA 3C62A 3DKAA 4G7ZF 1M57C 3NYMA 3WAQA 2CDQA 3Q7GA 1FR0A 3ABKC 1C03A 2CNWD 3U8VA 2HV6A 4AE4B 4XLPF 1JPNA 5E2QA 4D4XA 2V3CC 4ZLCA 4G78A 3SYNA 5AC5A 4PJLA 1QSPA 4HEAJ 1LE2A 2PNOA 2ZXPA 3S27A 2XXAB 3Q6MA 3ZWIA 2IXPA 1CGNA 1HMOA 1TKNA 1M56C 3G50A 2XLOA 2LFFA 4K1OA 4H4KC 4NCQA 2QE9A 2BE5F 2KYHA 2HJMA 3L0IA 3H65A 3F47A 4MS2A 2VB6A 2HFIA 3C18A 3JRTA 2AVKA 1EA8A 3U3BA 2HZ8A 2J0WA 2R7WA
chains in the Genus database with same CATH topology
1Q0DA 3G50A 1Q0FA 1Q0GA 1T6IA 4NCQA 3G4ZA 1Q0KA 3G4XA 1T6UA 1Q0MA 1T6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0D A;  3G50 A;  1Q0F A;  1Q0G A;  1T6I A;  4NCQ A;  3G4Z A;  1Q0K A;  3G4X A;  1T6U A;  1Q0M A;  1T6Q A; 
#chains in the Genus database with same CATH topology
 3R2P A;  3FVY A;  3LEV A;  4EIY A;  3U2L A;  5KYW B;  1JRA A;  2A1D D;  2R03 A;  3TUL A;  1FMW A;  1T01 A;  2XLV A;  2UUI A;  3N24 A;  3WHN A;  5JT4 A;  3EHM A;  4XPY A;  3FOP A;  3S0X A;  5L0D A;  1YDI A;  3S29 A;  1MMG A;  4BEJ A;  2NG1 A;  5BUO A;  3NMI A;  5DVW A;  2BL2 A;  3K66 A;  3B0U X;  3A11 A;  1RMV A;  1D1A A;  2R25 A;  2GAQ A;  3CZ6 A;  1NLX A;  3X2Q C;  1QPU A;  3M79 A;  5EGY A;  4JE9 A;  1Z7Q c;  1CGM E;  4RDA A;  2FFH A;  1S05 A;  2OOC A;  4J32 B;  4RBN A;  1FFH A;  2A6E F;  2VCB A;  2YL0 A;  3MYI A;  3US6 A;  1IZM A;  1ZHW A;  1R4T A;  2NUP A;  3CAX A;  5GPG B;  4IGG A;  3F46 A;  1K40 A;  2PF4 E;  1JAF A;  3KKB A;  5T3T A;  2J46 A;  3AJM A;  2BC5 A;  4N06 A;  1Q0K A;  1NFO A;  2D4U A;  1C17 M;  4LDR A;  2AU5 A;  2HV7 A;  4MVZ A;  2MHR A;  1SR2 A;  1ZYR F;  3JCU Q;  2ASR A;  1M6T A;  1ORJ A;  2XM0 A;  4H54 A;  2HSB A;  4MVS A;  1VOM A;  4HFF B;  2IXO A;  5KYU A;  4DBR A;  2L7A A;  2Q7R A;  1G4W R;  2EIN C;  2WVO A;  2QY9 A;  1HY5 A;  3VRC A;  2EPO A;  3IHU A;  2H7O A;  1ORY A;  3NKE A;  3ZQV A;  3LNM B;  3NYL A;  1LIH A;  2HUJ A;  3IQ5 A;  3VAY A;  2A0B A;  2HKV A;  2CYD A;  3QZC A;  4KC9 A;  3WOD F;  4CS9 C;  4E7Z A;  4L6R A;  2NUT A;  5T3W A;  1E85 A;  4JW1 A;  1NZE A;  4GEH A;  2I8B A;  2J9V A;  4E0H A;  3J06 A;  1KU2 A;  1FFT C;  3O39 A;  3EQL F;  1HE9 A;  5COF A;  1N1C A;  3JRM O;  1IW7 F;  3EGX A;  1NG1 A;  5L0F A;  1ZVZ A;  3G4X A;  4I1M A;  4XPX A;  3JT1 A;  3GAN A;  1KNY A;  3GM3 A;  3T6B A;  3E9V A;  4JCH A;  4EBB A;  3OWT A;  4YN0 B;  4NTA A;  1JMW A;  1DOV A;  4XPW A;  2Y39 A;  1LM3 B;  2KK1 A;  2XLE A;  1O3U A;  1LVK A;  2DYS C;  2Q3T A;  4IAO A;  3S90 A;  2Z15 A;  3TJ5 A;  3T4R A;  4GQH A;  2W4B A;  2XRH A;  3N0T A;  4QI0 A;  5A6K A;  4LDQ A;  4I3M A;  2QUP A;  2IM8 A;  3GWN A;  3AG1 C;  4OIR F;  4OIQ F;  1E2X A;  1TWG A;  5HV9 A;  4QI2 A;  2PX0 A;  4XLN F;  3VM6 A;  2OJE D;  1H9G A;  3E70 C;  4FWV A;  5L0H A;  4R32 A;  2WL8 A;  4U9E A;  5T1D B;  5A6B A;  2J7P A;  4OIO F;  1OQC A;  3IQT A;  3AGT A;  3LES A;  1XZP A;  4JTA B;  5CI8 A;  1PV3 A;  2Q00 A;  2WB7 A;  2XL8 A;  3HTK C;  4X0R A;  3TQO A;  2OCC C;  1RKE A;  2EPL X;  4OD4 A;  2HSQ A;  3ASN C;  4XWJ A;  1RKC A;  2LSE A;  1M2O A;  3H2U A;  3UMI A;  1MMD A;  2R7O A;  4PK4 A;  1YA9 A;  4Q5S F;  1R5I D;  4U5E E;  5FCL A;  4HFK B;  2DGJ A;  4N6C A;  3GEE A;  3ZIB A;  4KI2 A;  5KYU B;  3VYW A;  2D5R B;  1VLT A;  4I1O B;  2GDC A;  1SMY F;  2YL1 A;  1M2V A;  3ABL C;  3TOL A;  4DVY P;  2R7V A;  1O5H A;  3LUT B;  4M63 A;  2EPK X;  3KPH A;  4BG0 A;  3NDB B;  2OEX A;  4AL0 A;  3DM5 A;  4EHP A;  3I4U A;  5K0I A;  3HNK A;  1HW2 A;  1YZC A;  4UDV A;  4EBK A;  1TWA A;  2NSG A;  1OW6 A;  2V26 A;  3FHD A;  2WVN A;  4E0I A;  3SNH A;  1HE1 A;  1YA7 O;  3JYY A;  2VCA A;  4CX9 A;  1PD1 A;  4BJ6 A;  2AWY A;  1LS4 A;  1ZHT A;  4A4A A;  3U8P A;  5L3V A;  5DQT A;  1AEP A;  3DE8 A;  2ZXR A;  2YRF A;  3EH2 A;  1Z63 A;  1ZW2 A;  2R7T A;  2XS1 A;  1D1C A;  4DXW A;  3DE9 A;  2VH3 A;  4MTF A;  4W8P A;  2KW3 C;  3SXM A;  2E87 A;  3B9Q A;  4IAR A;  2QTV A;  3QVZ A;  4JVS A;  4PFO A;  2JD3 A;  4XEK A;  2YHS A;  1WTY A;  4C7O B;  3O10 A;  4YK5 A;  1TWC A;  4LLC A;  1VYK A;  2I15 A;  1OCR C;  4D4N A;  2YEV A;  1OR3 A;  2LD6 A;  3Q6N A;  3ASO C;  4JKV A;  3KH2 A;  1TWH A;  1OXK A;  1YVI A;  2XS8 A;  3DMD A;  3LAY A;  2J9U A;  4MND A;  4J30 B;  1V74 B;  1L3P A;  2HS5 A;  3IQC A;  4E17 A;  2OU6 A;  4U9D A;  1MNE A;  4ZLD A;  1HMD A;  1YAU O;  4ER9 A;  5A69 A;  5EHH A;  2F22 A;  1WAT A;  1RJ9 A;  2YZS A;  2GA0 A;  4P9F A;  1OCC C;  4XTK A;  3AOU A;  3S28 A;  2RD9 A;  4YJW A;  1RKE B;  4BJ1 A;  2Y69 C;  4RD9 A;  1RCP A;  4C3D A;  1OCO C;  3GEH A;  2VAS A;  1A41 A;  4YL1 A;  2IXM A;  5BQH A;  3EGD B;  3DI5 A;  5F5F A;  2CNW A;  256B A;  1TFO B;  3FMS A;  3DWW A;  2YLD A;  4EUK B;  1YYX A;  4BJ6 C;  2PX3 A;  3DJU B;  1LS1 A;  2Y3H A;  4WJ0 A;  4Z9I A;  1J8M F;  3M4B A;  4OIN F;  2YKZ A;  2MWQ A;  1D0Z A;  2C03 A;  2IYL D;  3LNR A;  3RF3 A;  4CIP A;  2W45 A;  3B0V C;  4MVM A;  3C8G B;  1QVX A;  4IWB A;  1A7E A;  2L81 A;  2L6H A;  4EKW A;  1QLE C;  2NPU A;  3EPV A;  3Q7L A;  4XEF A;  4Z9H A;  2XLD A;  2Y3B A;  1WOL A;  5AGF A;  5E3C A;  1LI7 A;  4P9T A;  3SZR A;  3TJ6 A;  3IPM O;  3K6B A;  1SF8 A;  3HLZ A;  3L8I A;  1Z23 A;  3ZVR A;  1WN0 A;  1J8Y F;  3RW0 A;  4JCZ A;  3QMK A;  5F28 E;  3SEO A;  2YVK A;  1B68 A;  1H6G A;  3RVY A;  2GFH A;  3W2V A;  3UGP A;  4FX5 A;  1UFB A;  1D0Y A;  3QTH A;  4NQF A;  2A0U A;  3AQB A;  4YL3 A;  1APC A;  2C04 A;  4AL1 A;  2ETS A;  5L0I A;  1A7D A;  3EG9 A;  3MBG A;  4NTF A;  2XLH A;  4U5G A;  2R7S A;  4CSA A;  2LQG A;  2CCY A;  4CS8 A;  4CIH A;  4BPM A;  2OKU A;  3JSZ A;  5DS4 A;  1NFN A;  3V5Y A;  1QZX A;  1ORS C;  1V55 C;  2G62 A;  2ZPA A;  3OEO A;  4NY3 A;  3SXZ A;  2PP4 A;  3LJB A;  5DLJ A;  1V54 C;  5HSW A;  4YWQ A;  2R7U A;  1TR2 A;  5D92 A;  2AP3 A;  2H7B A;  1T6I A;  3HNI A;  2LIG A;  3KYJ A;  2WZG A;  3G4Z A;  3M4C A;  4JC7 A;  4YT4 A;  4IJJ A;  5L0J A;  3ZTZ A;  1JR8 A;  2KSF A;  5A6B D;  4PAC A;  4CDY A;  2P6V A;  3ZQY A;  2OJQ A;  1RJ9 B;  2ZD9 A;  4DOZ A;  3UMK A;  4BJ5 A;  2XM4 A;  1NU9 C;  2QNL A;  3IQ6 A;  1E84 A;  2H8A A;  3FDQ A;  4YL0 A;  4JZA A;  2EIL C;  5KYX A;  5CIV A;  3MYF A;  2VCC A;  2HJ3 A;  1F1M A;  2RSE B;  3JSE O;  1I4Y A;  1LE4 A;  3MFN A;  3HJC A;  2X0C A;  4O79 A;  4EBJ A;  1ZHX A;  5JS5 A;  1ZW3 A;  2J9W A;  3O55 A;  3RYL A;  1GS9 A;  2KC3 A;  2NUP B;  4DRJ B;  4O6Y A;  2OG2 A;  1SYQ A;  2EIJ C;  1I5N A;  1D0X A;  1OR2 A;  3LS0 A;  4U5B E;  3C8G D;  5E3A A;  3TOM A;  2XXA A;  3V5X A;  5DS6 A;  2LFD A;  3V5Z A;  3AGU A;  1YYJ A;  4O6M A;  3U9M A;  2MYS A;  3ZSU A;  5JLI A;  2EIM C;  4CS8 C;  1H7I A;  2R05 A;  4JIO A;  4JJG A;  3U2M A;  4DJ9 A;  2CGE A;  3ITF A;  2YL3 A;  2XSE A;  3PCV A;  4PJJ A;  1CGO A;  3KYI A;  4MQ9 F;  3W2W A;  3ZC4 A;  4DRI B;  2W4M A;  3B29 A;  3DD7 A;  3GOR A;  4O7G A;  1VYI A;  2L6F A;  4MW3 A;  3ZDL A;  4LDK A;  5KYY A;  1RXQ A;  4B6I A;  1ZZP A;  4JRZ A;  4CDA A;  5JUA A;  5KYW A;  1AUE A;  1E83 A;  3BEH A;  1JPJ A;  4PJM A;  4CJO A;  5B3I A;  1Z3I X;  2UUH A;  4N4W A;  2NUT B;  1PD0 A;  1T6U A;  4LER A;  1Q0M A;  3QW0 A;  2NSF A;  5FZT A;  3I5Q A;  2R7R A;  4GYT A;  1G8X A;  2P61 A;  3L34 A;  2YWA A;  2XLW A;  4DBQ A;  1FNT c;  3AG4 C;  3H2V A;  2KJG A;  1TFK B;  3N2Z B;  1LI5 A;  2HMQ A;  4A2N B;  1EKY A;  1BZ4 A;  2J45 A;  4JUR I;  3EGX B;  3PMR A;  3JTL O;  1NBB A;  1EQ1 A;  1Y6D A;  3GEI A;  1W2W A;  4AK9 A;  3C8Z A;  5COM A;  1ZU5 A;  3K33 A;  4IRU A;  1NU7 D;  4G7H F;  3DAF A;  3JYH A;  2L6G A;  2YL7 A;  2G3K A;  2LP4 A;  1YLM A;  2W9Y A;  4G7O F;  1BDJ B;  2PFD A;  3I5P A;  4C3E A;  1U0B B;  1OW8 A;  1ZHZ A;  4JEA A;  4KNV A;  4OIP F;  3JZ0 A;  2AWC A;  3NG1 A;  1KTM A;  2JPU A;  2KNH A;  4DRH B;  5KYX B;  1DOW A;  4AX2 A;  3S84 A;  3AG2 C;  3EZI A;  2XL6 A;  2VC9 A;  5JVE A;  5TJ5 E;  1FTS A;  4FES A;  5JRA A;  1BR2 A;  1VLS A;  2GWW A;  4IAQ A;  3T6G B;  4WAB A;  1T6Q A;  3WG7 C;  5COG A;  5EK0 A;  1G5Z A;  5DQZ A;  4U5D E;  3DZA A;  1Q0F A;  2EPM X;  3C7J A;  2EIK C;  3W8H A;  1C02 A;  3RIP A;  1A7V A;  1OKK A;  1FMV A;  4CJG A;  3QW1 A;  3NMK A;  1LPE A;  1QQ3 A;  3RKO F;  3UGO A;  3K7D A;  3VF0 A;  3X1O A;  2OEV A;  4IB4 A;  2B0J A;  1E86 A;  4LLE A;  4OD5 A;  2PBE A;  3GM1 A;  1Y4C A;  2M4E A;  4Q4Z F;  5DS5 A;  2L9J A;  1GGQ A;  1K05 A;  3DJN B;  3POV A;  1M2V B;  5KYN A;  5KYY B;  3GWL A;  3NRH A;  1T9K A;  4CS9 A;  1Q0D A;  2DB4 A;  3EFO A;  5JP7 A;  3RFY A;  2R02 A;  4E18 A;  3LEO A;  4MVU A;  2YLI A;  2YLG A;  2A6H F;  3KMI A;  2DYR C;  4I44 A;  1I4Z A;  1MND A;  1OW7 A;  5E33 A;  1A0B A;  4NC3 A;  1CPR A;  3CEX A;  3FAP B;  5D91 A;  4YT8 A;  4PFP A;  1D1B A;  2JX0 A;  4Z9J A;  3CQZ A;  5JSL A;  1VB5 A;  5B3S C;  3UMH A;  4FAP B;  3M1C B;  4QDL A;  3K1I A;  3LLI A;  2WZF A;  1TQG A;  4MVO A;  4ULV A;  4U5H A;  3KL4 A;  4CS7 A;  5BQI A;  4MTG A;  3U9J A;  2Q9A A;  4XQ1 A;  2FAP B;  3L1M A;  5B1B C;  2HMZ A;  1ST6 A;  4C3B A;  1H9T A;  1U6H A;  4JTD B;  2A69 F;  3A9C A;  3FOO A;  4LAC B;  1FAP B;  1VMA A;  2XLM A;  3FXH A;  5L0C A;  3RQF A;  3AQC A;  3LS1 A;  1UG7 A;  1WGW A;  3L8J A;  3OA1 A;  5A6J A;  2Q4F A;  2J9B A;  2Y3G A;  2WZL A;  3ECS A;  4J7Y A;  4JJF A;  3K1H A;  3IEE A;  3RQE A;  3LLK A;  4KNW A;  4PJN A;  3PDM P;  1YJG A;  3T6J A;  4HE8 D;  4G0H A;  1O87 A;  2J7P D;  3TD7 A;  4O6N A;  5BQG A;  3AG3 C;  4CBE A;  4J7T A;  2IBF A;  3GM2 A;  3MX3 A;  4WGY A;  2Y3D A;  3C63 A;  3SXY A;  4PR9 A;  1JOG A;  3EH1 A;  2YQY A;  2B0H A;  1XZQ A;  4MVR A;  3QVY A;  1MMN A;  2LK4 A;  3U0C A;  4K0D A;  1Z5Z A;  5F5H A;  5B1A C;  1NSG B;  3RVZ A;  2Q9C A;  2A68 F;  1MQV A;  4AE4 A;  4U5C E;  3DM9 B;  1PCX A;  4XEV A;  3W4Y A;  4JTC B;  1OXB A;  4CDV A;  2R7X A;  3BRJ A;  3B71 A;  1U89 A;  5L0G A;  5IY5 C;  3CSK A;  3T9O A;  2EPN A;  4E7S A;  4MVQ A;  4ANJ A;  3O6X A;  4MW8 A;  2KGO A;  4ULW A;  5A6A A;  3ATP A;  3R7C A;  3K1I C;  1XWJ A;  3SP1 A;  3EFO B;  2P7V A;  3U5S A;  4CSA C;  3NYJ A;  3DAG A;  4C7O A;  1G4U S;  2CW0 F;  1LKX A;  2J8W A;  4NTB A;  4N6H A;  2DI3 A;  1EI7 A;  2O9X A;  1QKR A;  2Q9B A;  2R7Q A;  3NMJ A;  4KBL A;  4U5F E;  3SXK A;  3MLG A;  4JEB A;  1VTM P;  3ZTM A;  3EZH A;  3EJN A;  2QLA A;  4WGZ A;  3HNJ A;  3RH3 A;  2OQM A;  1ZU4 A;  4DVZ A;  3FAJ A;  2IXN A;  1BBH A;  1HW1 A;  1YZA A;  3ABM C;  3EHN A;  4F4B A;  4EWC A;  1WAS A;  1GQA A;  3EG9 B;  1GM5 A;  3UR3 C;  3PHF 2;  4MTO A;  3GOD A;  1WWP A;  2XL4 A;  3V7O A;  4BJ5 C;  4K7B A;  5AC4 A;  1AVO B;  4BEM J;  2X51 A;  1Z6A A;  3EGD A;  1VK5 A;  1BR1 A;  1SZI A;  1T5O A;  1OCZ C;  3W8I A;  3DXJ F;  3UNG C;  2P1A A;  3RQG A;  2ZXW C;  1L7C A;  3TK0 A;  4BJT A;  2J0X A;  4W8K A;  3HNL A;  4Q7C A;  3U3F A;  1S7Z A;  2ZXO A;  1V4A A;  2M64 A;  1YAR O;  3C8G A;  1ZHY A;  3B0P A;  5CI9 A;  4P6I C;  2IOQ A;  2ICW G;  2TMV P;  1CPQ A;  2P0N A;  1BR4 A;  3M15 A;  2LCH A;  4YT5 A;  1MMA A;  1K04 A;  2R9R B;  5L3Q A;  1Q0G A;  2G3V A;  2FGY A;  4ONS A;  2KQ9 A;  3S9O A;  1OKK D;  3ZG1 A;  3HKK A;  2H7V C;  2WVQ A;  4YT2 A;  3NKD A;  3C62 A;  3DKA A;  4G7Z F;  1M57 C;  3NYM A;  3WAQ A;  2CDQ A;  3Q7G A;  1FR0 A;  3ABK C;  1C03 A;  2CNW D;  3U8V A;  2HV6 A;  4AE4 B;  4XLP F;  1JPN A;  5E2Q A;  4D4X A;  2V3C C;  4ZLC A;  4G78 A;  3SYN A;  5AC5 A;  4PJL A;  1QSP A;  4HEA J;  1LE2 A;  2PNO A;  2ZXP A;  3S27 A;  2XXA B;  3Q6M A;  3ZWI A;  2IXP A;  1CGN A;  1HMO A;  1TKN A;  1M56 C;  3G50 A;  2XLO A;  2LFF A;  4K1O A;  4H4K C;  4NCQ A;  2QE9 A;  2BE5 F;  2KYH A;  2HJM A;  3L0I A;  3H65 A;  3F47 A;  4MS2 A;  2VB6 A;  2HFI A;  3C18 A;  3JRT A;  2AVK A;  1EA8 A;  3U3B A;  2HZ8 A;  2J0W A;  2R7W A; 
#chains in the Genus database with same CATH homology
 1Q0D A;  3G50 A;  1Q0F A;  1Q0G A;  1T6I A;  4NCQ A;  3G4Z A;  1Q0K A;  3G4X A;  1T6U A;  1Q0M A;  1T6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...