3G4ZA

Crystal structure of nisod y9f mutant at 1.9 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Role of conserved tyrosine residues in NiSOD catalysis: a case of convergent evolution
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 50
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 3g4zA00
3G4XA 1Q0KA 3G50A 1Q0DA 1Q0FA 1T6IA 4NCQA 1T6UA 3G4ZA 1Q0GA 1Q0MA 1T6QA
chains in the Genus database with same CATH superfamily
1FFHA 5KYWA 4MVMA 2KC3A 3NYMA 4ULVA 3N0TA 1GQAA 1EA8A 1CPQA 1OCRC 1T6UA 3HNJA 2P61A 2Y3HA 1O3UA 4DRIB 3GM3A 3HJCA 2IBFA 2LSEA 4XLPF 4M63A 3B71A 4QDLA 2LQGA 3KYIA 5KYYA 1IZMA 4U5EE 2OQMA 1L3PA 2UUIA 3Q6NA 5TJ5E 1UG7A 2DB4A 1YA9A 2KYHA 4PJNA 2WZLA 4IJJA 4BEJA 2CYDA 1HE9A 1D1BA 3IQTA 1HE1A 2D4UA 2J9VA 4XPXA 3EFOB 3L34A 3UNGC 2HJMA 2XLEA 1ZVZA 3DM9B 3GEIA 2R7UA 5EHHA 5B3IA 5K0IA 4CJGA 1EI7A 5JUAA 1QZXA 3EGDA 3RVYA 4BJ1A 2J0WA 3M4BA 5E3CA 4U5CE 3AQBA 2X51A 1U89A 3EJNA 3ABKC 2XRHA 3UMKA 3Q7GA 5BQIA 5KYUB 3N2ZB 2LP4A 256BA 4GYTA 5T3WA 4Z9HA 2OKUA 4W8PA 5BQHA 4B6IA 4FWVA 3SYNA 3IQ6A 2MYSA 3SXYA 3T6JA 4AK9A 2PP4A 3X1OA 3MYIA 3B0UX 4BJ5A 4Z9JA 4AE4A 2PFDA 2YKZA 3EHMA 1Q0FA 3JZ0A 1V74B 3RH3A 2VH3A 4KNWA 1DOWA 3NDBB 3CZ6A 1T9KA 4MTOA 3CQZA 4U9DA 3C8ZA 4PJJA 4D4XA 2JD3A 3JYYA 4BJ5C 1ZHXA 5JP7A 1G5ZA 3EZIA 1FMWA 3O55A 4K0DA 4MW8A 2ZPAA 4PFOA 4WABA 4MS2A 5L0IA 3ITFA 1U0BB 1TWHA 2I15A 2KGOA 2MWQA 2J7PD 4ER9A 5AC4A 2OEVA 1RCPA 2HZ8A 2Q3TA 1YJGA 4HEAJ 4MTGA 2MHRA 2O9XA 1D0XA 1UFBA 2R05A 4N4WA 3QW0A 5B1BC 2R7QA 3QVZA 4J7YA 5L0GA 3V5YA 4CDVA 1K04A 4JTDB 3DJNB 3NYLA 1FTSA 1RJ9B 3C8GA 4PACA 1MMGA 4A4AA 1HW2A 4E18A 5KYWB 2HMZA 2VCCA 2AU5A 3G50A 3ZQVA 1JOGA 3OA1A 3JRTA 4MW3A 5KYYB 5CI9A 3HLZA 1Q0GA 4JVSA 2XM0A 3CEXA 4CS9A 2J46A 1G8XA 1ORSC 3IEEA 1T5OA 1XWJA 1HW1A 3EH1A 2ZD9A 2W9YA 4GQHA 3C8GD 2A0BA 3JT1A 2PNOA 3I4UA 1ORYA 4CS9C 1SR2A 2CCYA 2VCBA 4XWJA 3AJMA 4PJMA 1HY5A 1H6GA 1NZEA 1M56C 3QW1A 4LDKA 3S28A 3U9JA 4NTAA 2Q7RA 3NMKA 4MTFA 1B68A 1FFTC 3KH2A 3DXJF 3L0IA 4GEHA 3U2LA 1RMVA 1WWPA 2HMQA 4K7BA 4FESA 1D1CA 3JSEO 1FNTc 2YHSA 2CW0F 2HUJA 2R7OA 3EGDB 3GANA 3JSZA 4JURI 3RVZA 4AL1A 1E84A 1CGME 4EBKA 4G78A 5DS5A 1MNEA 1TFKB 1T6IA 3A11A 4IAQA 2R02A 3DD7A 4BPMA 3FXHA 4JW1A 4D4NA 1YAUO 2JX0A 1BR2A 2L6GA 2A1DD 1PD1A 3IPMO 4MVOA 3ZWIA 3SNHA 4EUKB 2X0CA 2EIKC 1QVXA 1WTYA 4EIYA 3T4RA 2QNLA 2J8WA 1SYQA 4AE4B 3SXMA 1A7VA 1YLMA 1NFNA 1M2VA 1YDIA 2CNWA 2J0XA 2EPNA 3GORA 2ZXOA 1HMDA 2Q9AA 3AQCA 4YT5A 5DQZA 4YL3A 1D0YA 2EILC 5BQGA 4Q4ZF 1XZQA 5DS6A 3LS0A 4YT8A 4YWQA 2D5RB 3R2PA 3X2QC 1K40A 2ZXWC 3K7DA 4BJTA 5A69A 3Q6MA 2HSQA 1YZAA 1APCA 4O6MA 1K05A 2H7OA 3JCUQ 2BE5F 4G0HA 5KYXA 2GDCA 2J45A 5T3TA 4Q7CA 3JTLO 4RBNA 4CS8C 3TJ6A 1LI7A 4CX9A 1M2OA 3FAPB 4CBEA 1ZHZA 2Y3DA 3M79A 1YARO 3BRJA 1O87A 5AGFA 3RF3A 4Q5SF 1D0ZA 2ZXRA 2OCCC 2KQ9A 3K66A 1ZU5A 2G3KA 3C18A 4I1MA 4P9FA 3C8GB 4JIOA 4CDAA 1VOMA 2WL8A 1CPRA 4JEBA 2IXPA 4N06A 4O79A 3S0XA 3VYWA 1BDJB 3HKKA 1JPNA 2IXNA 5CIVA 4XQ1A 4YN0B 4JEAA 4BJ6A 1KTMA 3T6GB 2W45A 2YEVA 4WJ0A 2VCAA 3VRCA 5L0FA 2HJ3A 1R4TA 1A7DA 2EPLX 2LCHA 3VAYA 3E9VA 4CIHA 4BJ6C 1YZCA 2GA0A 3NKDA 3K1IA 5DLJA 1F1MA 3PCVA 3LJBA 3LLKA 3T6BA 2J9WA 1D1AA 1ZHWA 1ZZPA 2NUTA 3O10A 4C7OB 2P1AA 1LVKA 2TMVP 5DQTA 1YYJA 3K1IC 3U5SA 4O6YA 5A6JA 4QI2A 5L0CA 3U8PA 4WGYA 4CS7A 1GS9A 1Z7Qc 2OU6A 3MBGA 3M15A 4JJGA 4R32A 1RKEA 2QY9A 3KPHA 2GWWA 3B29A 2GFHA 4KBLA 3PHF2 2R7TA 3NRHA 2H7BA 2LK4A 3C63A 3DI5A 1ZYRF 3QTHA 4MVZA 3UR3C 5FCLA 3TJ5A 4OIQF 2NPUA 1Q0KA 1VMAA 5F5HA 2HV6A 4C3DA 2I8BA 3NKEA 1FMVA 3AG1C 1ZHYA 3S29A 1E85A 3ASNC 4DVZA 2AWYA 4EKWA 1I4ZA 2YLGA 4KI2A 4MVSA 1Y4CA 1ZW3A 2R25A 4J7TA 1MMAA 3EG9A 2HSBA 1WOLA 4I1OB 2KJGA 4F4BA 1ZHTA 2EPMX 4MVRA 4ONSA 4X0RA 3K33A 1W2WA 3RQEA 3C7JA 4HE8D 1Z63A 1WGWA 1QSPA 5CI8A 1FR0A 1T01A 4CJOA 5JT4A 5KYXB 3MLGA 4OINF 4DBQA 4HFFB 1MMNA 3MX3A 4G7OF 4ZLDA 2WZFA 1SF8A 2LFFA 1SMYF 2XL8A 4U5BE 3LAYA 4JE9A 4IGGA 2C04A 4NC3A 3W2VA 5DVWA 4MQ9F 4O6NA 4AL0A 5FZTA 5IY5C 1R5ID 3LS1A 1Y6DA 4JKVA 2EPOA 2CGEA 2H7VC 2M64A 2BC5A 4NY3A 4XLNF 2R7WA 4DBRA 1LE4A 4A2NB 1LPEA 4OD4A 1DOVA 2HV7A 2IXMA 3EHNA 1LKXA 3W8HA 4G7HF 3KYJA 1LI5A 2A6EF 2KSFA 2EIJC 3LNMB 3AG3C 3CSKA 2IOQA 4O7GA 4XEFA 2XXAA 2NSGA 3A9CA 5DS4A 4E0HA 3GWLA 1H7IA 3LLIA 4XEVA 2PF4E 1OR3A 2DYRC 4FX5A 1VB5A 2DYSC 4JJFA 3UMHA 3I5PA 3WODF 4EBJA 3Q7LA 3U9MA 2XSEA 5JSLA 5KYNA 2L81A 2Y3BA 1VLSA 2GAQA 3HNKA 4NCQA 2Y69C 3BEHA 4K1OA 4LLCA 2YWAA 1VYKA 3C62A 2NUTB 3LEOA 2NUPA 4J32B 3WAQA 4EHPA 5L3VA 3W4YA 4JTCB 4U5DE 3EQLF 2YRFA 4JCZA 3SEOA 4IWBA 1OW6A 2A6HF 3W2WA 5COMA 3RQGA 5T1DB 3EZHA 2L7AA 2XLMA 3G4XA 4C3BA 2QE9A 5A6AA 3UGPA 4DRJB 1FAPB 3GEHA 4HFKB 2OJQA 4L6RA 3SP1A 4G7ZF 1WASA 1OKKA 1RKEB 1CGOA 1JMWA 3AOUA 3SXKA 4DXWA 2C03A 1WATA 1BR1A 5F28E 3DM5A 1OW8A 3TD7A 2YL0A 3H65A 3ZSUA 4DOZA 4PJLA 3PDMP 4EWCA 4OIPF 2PX0A 2QUPA 2EINC 4P9TA 3LESA 2XS1A 3QZCA 3F46A 5JS5A 1HMOA 2V3CC 2LFDA 2R7RA 5D91A 3U3BA 3EH2A 2F22A 1TFOB 2CNWD 2YVKA 3JYHA 2HKVA 3EG9B 5L0JA 4CSAA 2HS5A 1LIHA 1OQCA 2VASA 5EGYA 4W8KA 4MVQA 3U8VA 3GODA 1EKYA 1NU7D 2R03A 3US6A 4E0IA 1ORJA 1VK5A 4LDQA 1NSGB 3B0PA 2W4BA 3DMDA 5E33A 2WVOA 5COGA 2ICWG 3DE9A 1LS4A 1U6HA 2Q9CA 1C03A 4N6CA 4XPWA 4IRUA 3U3FA 5L3QA 3FHDA 1OCCC 2YL3A 1NU9C 3LEVA 3RYLA 3V7OA 4MNDA 5JRAA 2G62A 2Y39A 1N1CA 2L6FA 2PX3A 2YZSA 5F5FA 3LNRA 4RDAA 1AVOB 4ANJA 1AUEA 3FOPA 2YLDA 2AVKA 3TQOA 3RIPA 1A7EA 1VLTA 3HTKC 1JPJA 4U5FE 3QVYA 1J8YF 4OD5A 1LE2A 4JCHA 2OOCA 3EGXA 1ST6A 2ASRA 1S05A 1QQ3A 1WN0A 2H8AA 3H2UA 4LDRA 4U5HA 1H9GA 2LIGA 3G4ZA 4NTFA 1MNDA 3V5XA 3WG7C 1QKRA 1E83A 2FAPB 4UDVA 3I5QA 3TOMA 1OXBA 3ZIBA 1OXKA 3VM6A 2AWCA 3NMJA 2XXAB 3MFNA 2EPKX 1ZW2A 2Z15A 1C17M 3ZC4A 2XLOA 3KMIA 3M4CA 5L0DA 4BG0A 5HSWA 2KK1A 2ETSA 3O39A 1RKCA 1M6TA 4I3MA 4U9EA 3V5ZA 2XLDA 2L6HA 1G4US 2NUPB 2RD9A 3AGTA 2R7XA 2L9JA 1YA7O 2G3VA 4AX2A 2J9UA 1O5HA 3FVYA 1Z3IX 4H4KC 3DKAA 2KW3C 4KNVA 1I4YA 4C3EA 2EIMC 1LM3B 4DRHB 2AP3A 4NTBA 5A6KA 2OG2A 2E87A 1V4AA 3F47A 1C02A 4P6IC 3ABMC 1M2VB 1Q0MA 2WVNA 3ABLC 4YJWA 3ATPA 2FFHA 4YL0A 1JR8A 1Q0DA 1Z5ZA 2P6VA 3B0VC 1VYIA 3B9QA 3UGOA 4LACB 1OW7A 1NLXA 3DE8A 4MVUA 4PK4A 4XTKA 4YT4A 2J7PA 1E2XA 2W4MA 3GM1A 3FMSA 3OWTA 1L7CA 5A6BA 4YT2A 1MQVA 3FOOA 1VTMP 2XM4A 3IHUA 1BBHA 2QLAA 3CAXA 1GGQA 1YVIA 3ECSA 2M4EA 1OCOC 1E86A 4OIRF 4FAPB 1JRAA 5JVEA 3GEEA 4J30B 3W8IA 3IQ5A 4NQFA 1A41A 4ULWA 2P7VA 2JPUA 2XLHA 3ZVRA 2Q00A 1AEPA 2WZGA 2YQYA 4IAOA 4Z9IA 3RFYA 3U0CA 1PCXA 1TQGA 3SZRA 3O6XA 3S27A 5A6BD 4JZAA 5B1AC 2VB6A 5BUOA 1KU2A 2YL1A 2OEXA 3K1HA 2YL7A 4H54A 2A69F 3S90A 1GM5A 3GM2A 2P0NA 1EQ1A 1CGNA 1NG1A 2A68F 4PR9A 4E7ZA 2Y3GA 2DI3A 2FGYA 2RSEB 3FAJA 4EBBA 4IB4A 1TR2A 1QPUA 3DAGA 5GPGB 3T9OA 3VF0A 3ZTZA 1NBBA 2XL6A 5L0HA 4XPYA 1I5NA 2IXOA 1IW7F 4JC7A 4JTAB 2R7VA 1TKNA 1H9TA 1TWGA 3EPVA 3N24A 1JAFA 2WVQA 2YLIA 3EGXB 4I44A 1XZPA 4PFPA 3H2VA 3ZTMA 3R7CA 2HFIA 1OR2A 2OJED 3EFOA 2J9BA 4N6HA 5E2QA 3QMKA 1Z23A 1BZ4A 1KNYA 3RW0A 5AC5A 3NYJA 5D92A 3L1MA 4DVYP 1M57C 1V54C 2LD6A 3SXZA 3POVA 3NMIA 2KNHA 3L8JA 1A0BA 3ZG1A 3KL4A 3HNLA 4JRZA 4DJ9A 1MMDA 1OCZC 5KYUA 3NG1A 4YK5A 3TK0A 3J06A 4BEMJ 4C7OA 3AG4C 3RQFA 2BL2A 2UUHA 2CDQA 3ASOC 5B3SC 5HV9A 3FDQA 2A0UA 1SZIA 1V55C 3K6BA 3AGUA 5EK0A 1G4WR 1NFOA 4YL1A 3OEOA 3RKOF 2XLVA 4WGZA 3UMIA 1LS1A 3DZAA 3S9OA 3PMRA 1BR4A 3L8IA 3TOLA 2VC9A 3E70C 4CIPA 3S84A 2Q9BA 2R9RB 1T6QA 2B0HA 4CDYA 1PV3A 3DAFA 4RD9A 4OIOF 2XL4A 3MYFA 2ZXPA 1OKKD 3DJUB 3ZDLA 1TWCA 2XLWA 4LERA 3IQCA 1YYXA 4U5GA 3JRMO 3HNIA 5E3AA 5JLIA 3LUTB 3ZQYA 5COFA 3GWNA 4LLEA 1PD0A 2B0JA 2IM8A 2WB7A 3DWWA 2NG1A 4ZLCA 4CSAC 3M1CB 1TWAA 1QLEC 2PBEA 2DGJA 4E7SA 4KC9A 2NSFA 4XEKA 2V26A 4CS8A 1J8MF 4IARA 4QI0A 1Z6AA 2Q4FA 1ZU4A 3TULA 3AG2C 2IYLD 2QTVA 3WHNA 1RXQA 3KKBA 1S7ZA 3U2MA 2XS8A 4E17A 2R7SA 1RJ9A
chains in the Genus database with same CATH topology
3G4XA 1Q0KA 3G50A 1Q0DA 1Q0FA 1T6IA 4NCQA 1T6UA 3G4ZA 1Q0GA 1Q0MA 1T6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4X A;  1Q0K A;  3G50 A;  1Q0D A;  1Q0F A;  1T6I A;  4NCQ A;  1T6U A;  3G4Z A;  1Q0G A;  1Q0M A;  1T6Q A; 
#chains in the Genus database with same CATH topology
 1FFH A;  5KYW A;  4MVM A;  2KC3 A;  3NYM A;  4ULV A;  3N0T A;  1GQA A;  1EA8 A;  1CPQ A;  1OCR C;  1T6U A;  3HNJ A;  2P61 A;  2Y3H A;  1O3U A;  4DRI B;  3GM3 A;  3HJC A;  2IBF A;  2LSE A;  4XLP F;  4M63 A;  3B71 A;  4QDL A;  2LQG A;  3KYI A;  5KYY A;  1IZM A;  4U5E E;  2OQM A;  1L3P A;  2UUI A;  3Q6N A;  5TJ5 E;  1UG7 A;  2DB4 A;  1YA9 A;  2KYH A;  4PJN A;  2WZL A;  4IJJ A;  4BEJ A;  2CYD A;  1HE9 A;  1D1B A;  3IQT A;  1HE1 A;  2D4U A;  2J9V A;  4XPX A;  3EFO B;  3L34 A;  3UNG C;  2HJM A;  2XLE A;  1ZVZ A;  3DM9 B;  3GEI A;  2R7U A;  5EHH A;  5B3I A;  5K0I A;  4CJG A;  1EI7 A;  5JUA A;  1QZX A;  3EGD A;  3RVY A;  4BJ1 A;  2J0W A;  3M4B A;  5E3C A;  4U5C E;  3AQB A;  2X51 A;  1U89 A;  3EJN A;  3ABK C;  2XRH A;  3UMK A;  3Q7G A;  5BQI A;  5KYU B;  3N2Z B;  2LP4 A;  256B A;  4GYT A;  5T3W A;  4Z9H A;  2OKU A;  4W8P A;  5BQH A;  4B6I A;  4FWV A;  3SYN A;  3IQ6 A;  2MYS A;  3SXY A;  3T6J A;  4AK9 A;  2PP4 A;  3X1O A;  3MYI A;  3B0U X;  4BJ5 A;  4Z9J A;  4AE4 A;  2PFD A;  2YKZ A;  3EHM A;  1Q0F A;  3JZ0 A;  1V74 B;  3RH3 A;  2VH3 A;  4KNW A;  1DOW A;  3NDB B;  3CZ6 A;  1T9K A;  4MTO A;  3CQZ A;  4U9D A;  3C8Z A;  4PJJ A;  4D4X A;  2JD3 A;  3JYY A;  4BJ5 C;  1ZHX A;  5JP7 A;  1G5Z A;  3EZI A;  1FMW A;  3O55 A;  4K0D A;  4MW8 A;  2ZPA A;  4PFO A;  4WAB A;  4MS2 A;  5L0I A;  3ITF A;  1U0B B;  1TWH A;  2I15 A;  2KGO A;  2MWQ A;  2J7P D;  4ER9 A;  5AC4 A;  2OEV A;  1RCP A;  2HZ8 A;  2Q3T A;  1YJG A;  4HEA J;  4MTG A;  2MHR A;  2O9X A;  1D0X A;  1UFB A;  2R05 A;  4N4W A;  3QW0 A;  5B1B C;  2R7Q A;  3QVZ A;  4J7Y A;  5L0G A;  3V5Y A;  4CDV A;  1K04 A;  4JTD B;  3DJN B;  3NYL A;  1FTS A;  1RJ9 B;  3C8G A;  4PAC A;  1MMG A;  4A4A A;  1HW2 A;  4E18 A;  5KYW B;  2HMZ A;  2VCC A;  2AU5 A;  3G50 A;  3ZQV A;  1JOG A;  3OA1 A;  3JRT A;  4MW3 A;  5KYY B;  5CI9 A;  3HLZ A;  1Q0G A;  4JVS A;  2XM0 A;  3CEX A;  4CS9 A;  2J46 A;  1G8X A;  1ORS C;  3IEE A;  1T5O A;  1XWJ A;  1HW1 A;  3EH1 A;  2ZD9 A;  2W9Y A;  4GQH A;  3C8G D;  2A0B A;  3JT1 A;  2PNO A;  3I4U A;  1ORY A;  4CS9 C;  1SR2 A;  2CCY A;  2VCB A;  4XWJ A;  3AJM A;  4PJM A;  1HY5 A;  1H6G A;  1NZE A;  1M56 C;  3QW1 A;  4LDK A;  3S28 A;  3U9J A;  4NTA A;  2Q7R A;  3NMK A;  4MTF A;  1B68 A;  1FFT C;  3KH2 A;  3DXJ F;  3L0I A;  4GEH A;  3U2L A;  1RMV A;  1WWP A;  2HMQ A;  4K7B A;  4FES A;  1D1C A;  3JSE O;  1FNT c;  2YHS A;  2CW0 F;  2HUJ A;  2R7O A;  3EGD B;  3GAN A;  3JSZ A;  4JUR I;  3RVZ A;  4AL1 A;  1E84 A;  1CGM E;  4EBK A;  4G78 A;  5DS5 A;  1MNE A;  1TFK B;  1T6I A;  3A11 A;  4IAQ A;  2R02 A;  3DD7 A;  4BPM A;  3FXH A;  4JW1 A;  4D4N A;  1YAU O;  2JX0 A;  1BR2 A;  2L6G A;  2A1D D;  1PD1 A;  3IPM O;  4MVO A;  3ZWI A;  3SNH A;  4EUK B;  2X0C A;  2EIK C;  1QVX A;  1WTY A;  4EIY A;  3T4R A;  2QNL A;  2J8W A;  1SYQ A;  4AE4 B;  3SXM A;  1A7V A;  1YLM A;  1NFN A;  1M2V A;  1YDI A;  2CNW A;  2J0X A;  2EPN A;  3GOR A;  2ZXO A;  1HMD A;  2Q9A A;  3AQC A;  4YT5 A;  5DQZ A;  4YL3 A;  1D0Y A;  2EIL C;  5BQG A;  4Q4Z F;  1XZQ A;  5DS6 A;  3LS0 A;  4YT8 A;  4YWQ A;  2D5R B;  3R2P A;  3X2Q C;  1K40 A;  2ZXW C;  3K7D A;  4BJT A;  5A69 A;  3Q6M A;  2HSQ A;  1YZA A;  1APC A;  4O6M A;  1K05 A;  2H7O A;  3JCU Q;  2BE5 F;  4G0H A;  5KYX A;  2GDC A;  2J45 A;  5T3T A;  4Q7C A;  3JTL O;  4RBN A;  4CS8 C;  3TJ6 A;  1LI7 A;  4CX9 A;  1M2O A;  3FAP B;  4CBE A;  1ZHZ A;  2Y3D A;  3M79 A;  1YAR O;  3BRJ A;  1O87 A;  5AGF A;  3RF3 A;  4Q5S F;  1D0Z A;  2ZXR A;  2OCC C;  2KQ9 A;  3K66 A;  1ZU5 A;  2G3K A;  3C18 A;  4I1M A;  4P9F A;  3C8G B;  4JIO A;  4CDA A;  1VOM A;  2WL8 A;  1CPR A;  4JEB A;  2IXP A;  4N06 A;  4O79 A;  3S0X A;  3VYW A;  1BDJ B;  3HKK A;  1JPN A;  2IXN A;  5CIV A;  4XQ1 A;  4YN0 B;  4JEA A;  4BJ6 A;  1KTM A;  3T6G B;  2W45 A;  2YEV A;  4WJ0 A;  2VCA A;  3VRC A;  5L0F A;  2HJ3 A;  1R4T A;  1A7D A;  2EPL X;  2LCH A;  3VAY A;  3E9V A;  4CIH A;  4BJ6 C;  1YZC A;  2GA0 A;  3NKD A;  3K1I A;  5DLJ A;  1F1M A;  3PCV A;  3LJB A;  3LLK A;  3T6B A;  2J9W A;  1D1A A;  1ZHW A;  1ZZP A;  2NUT A;  3O10 A;  4C7O B;  2P1A A;  1LVK A;  2TMV P;  5DQT A;  1YYJ A;  3K1I C;  3U5S A;  4O6Y A;  5A6J A;  4QI2 A;  5L0C A;  3U8P A;  4WGY A;  4CS7 A;  1GS9 A;  1Z7Q c;  2OU6 A;  3MBG A;  3M15 A;  4JJG A;  4R32 A;  1RKE A;  2QY9 A;  3KPH A;  2GWW A;  3B29 A;  2GFH A;  4KBL A;  3PHF 2;  2R7T A;  3NRH A;  2H7B A;  2LK4 A;  3C63 A;  3DI5 A;  1ZYR F;  3QTH A;  4MVZ A;  3UR3 C;  5FCL A;  3TJ5 A;  4OIQ F;  2NPU A;  1Q0K A;  1VMA A;  5F5H A;  2HV6 A;  4C3D A;  2I8B A;  3NKE A;  1FMV A;  3AG1 C;  1ZHY A;  3S29 A;  1E85 A;  3ASN C;  4DVZ A;  2AWY A;  4EKW A;  1I4Z A;  2YLG A;  4KI2 A;  4MVS A;  1Y4C A;  1ZW3 A;  2R25 A;  4J7T A;  1MMA A;  3EG9 A;  2HSB A;  1WOL A;  4I1O B;  2KJG A;  4F4B A;  1ZHT A;  2EPM X;  4MVR A;  4ONS A;  4X0R A;  3K33 A;  1W2W A;  3RQE A;  3C7J A;  4HE8 D;  1Z63 A;  1WGW A;  1QSP A;  5CI8 A;  1FR0 A;  1T01 A;  4CJO A;  5JT4 A;  5KYX B;  3MLG A;  4OIN F;  4DBQ A;  4HFF B;  1MMN A;  3MX3 A;  4G7O F;  4ZLD A;  2WZF A;  1SF8 A;  2LFF A;  1SMY F;  2XL8 A;  4U5B E;  3LAY A;  4JE9 A;  4IGG A;  2C04 A;  4NC3 A;  3W2V A;  5DVW A;  4MQ9 F;  4O6N A;  4AL0 A;  5FZT A;  5IY5 C;  1R5I D;  3LS1 A;  1Y6D A;  4JKV A;  2EPO A;  2CGE A;  2H7V C;  2M64 A;  2BC5 A;  4NY3 A;  4XLN F;  2R7W A;  4DBR A;  1LE4 A;  4A2N B;  1LPE A;  4OD4 A;  1DOV A;  2HV7 A;  2IXM A;  3EHN A;  1LKX A;  3W8H A;  4G7H F;  3KYJ A;  1LI5 A;  2A6E F;  2KSF A;  2EIJ C;  3LNM B;  3AG3 C;  3CSK A;  2IOQ A;  4O7G A;  4XEF A;  2XXA A;  2NSG A;  3A9C A;  5DS4 A;  4E0H A;  3GWL A;  1H7I A;  3LLI A;  4XEV A;  2PF4 E;  1OR3 A;  2DYR C;  4FX5 A;  1VB5 A;  2DYS C;  4JJF A;  3UMH A;  3I5P A;  3WOD F;  4EBJ A;  3Q7L A;  3U9M A;  2XSE A;  5JSL A;  5KYN A;  2L81 A;  2Y3B A;  1VLS A;  2GAQ A;  3HNK A;  4NCQ A;  2Y69 C;  3BEH A;  4K1O A;  4LLC A;  2YWA A;  1VYK A;  3C62 A;  2NUT B;  3LEO A;  2NUP A;  4J32 B;  3WAQ A;  4EHP A;  5L3V A;  3W4Y A;  4JTC B;  4U5D E;  3EQL F;  2YRF A;  4JCZ A;  3SEO A;  4IWB A;  1OW6 A;  2A6H F;  3W2W A;  5COM A;  3RQG A;  5T1D B;  3EZH A;  2L7A A;  2XLM A;  3G4X A;  4C3B A;  2QE9 A;  5A6A A;  3UGP A;  4DRJ B;  1FAP B;  3GEH A;  4HFK B;  2OJQ A;  4L6R A;  3SP1 A;  4G7Z F;  1WAS A;  1OKK A;  1RKE B;  1CGO A;  1JMW A;  3AOU A;  3SXK A;  4DXW A;  2C03 A;  1WAT A;  1BR1 A;  5F28 E;  3DM5 A;  1OW8 A;  3TD7 A;  2YL0 A;  3H65 A;  3ZSU A;  4DOZ A;  4PJL A;  3PDM P;  4EWC A;  4OIP F;  2PX0 A;  2QUP A;  2EIN C;  4P9T A;  3LES A;  2XS1 A;  3QZC A;  3F46 A;  5JS5 A;  1HMO A;  2V3C C;  2LFD A;  2R7R A;  5D91 A;  3U3B A;  3EH2 A;  2F22 A;  1TFO B;  2CNW D;  2YVK A;  3JYH A;  2HKV A;  3EG9 B;  5L0J A;  4CSA A;  2HS5 A;  1LIH A;  1OQC A;  2VAS A;  5EGY A;  4W8K A;  4MVQ A;  3U8V A;  3GOD A;  1EKY A;  1NU7 D;  2R03 A;  3US6 A;  4E0I A;  1ORJ A;  1VK5 A;  4LDQ A;  1NSG B;  3B0P A;  2W4B A;  3DMD A;  5E33 A;  2WVO A;  5COG A;  2ICW G;  3DE9 A;  1LS4 A;  1U6H A;  2Q9C A;  1C03 A;  4N6C A;  4XPW A;  4IRU A;  3U3F A;  5L3Q A;  3FHD A;  1OCC C;  2YL3 A;  1NU9 C;  3LEV A;  3RYL A;  3V7O A;  4MND A;  5JRA A;  2G62 A;  2Y39 A;  1N1C A;  2L6F A;  2PX3 A;  2YZS A;  5F5F A;  3LNR A;  4RDA A;  1AVO B;  4ANJ A;  1AUE A;  3FOP A;  2YLD A;  2AVK A;  3TQO A;  3RIP A;  1A7E A;  1VLT A;  3HTK C;  1JPJ A;  4U5F E;  3QVY A;  1J8Y F;  4OD5 A;  1LE2 A;  4JCH A;  2OOC A;  3EGX A;  1ST6 A;  2ASR A;  1S05 A;  1QQ3 A;  1WN0 A;  2H8A A;  3H2U A;  4LDR A;  4U5H A;  1H9G A;  2LIG A;  3G4Z A;  4NTF A;  1MND A;  3V5X A;  3WG7 C;  1QKR A;  1E83 A;  2FAP B;  4UDV A;  3I5Q A;  3TOM A;  1OXB A;  3ZIB A;  1OXK A;  3VM6 A;  2AWC A;  3NMJ A;  2XXA B;  3MFN A;  2EPK X;  1ZW2 A;  2Z15 A;  1C17 M;  3ZC4 A;  2XLO A;  3KMI A;  3M4C A;  5L0D A;  4BG0 A;  5HSW A;  2KK1 A;  2ETS A;  3O39 A;  1RKC A;  1M6T A;  4I3M A;  4U9E A;  3V5Z A;  2XLD A;  2L6H A;  1G4U S;  2NUP B;  2RD9 A;  3AGT A;  2R7X A;  2L9J A;  1YA7 O;  2G3V A;  4AX2 A;  2J9U A;  1O5H A;  3FVY A;  1Z3I X;  4H4K C;  3DKA A;  2KW3 C;  4KNV A;  1I4Y A;  4C3E A;  2EIM C;  1LM3 B;  4DRH B;  2AP3 A;  4NTB A;  5A6K A;  2OG2 A;  2E87 A;  1V4A A;  3F47 A;  1C02 A;  4P6I C;  3ABM C;  1M2V B;  1Q0M A;  2WVN A;  3ABL C;  4YJW A;  3ATP A;  2FFH A;  4YL0 A;  1JR8 A;  1Q0D A;  1Z5Z A;  2P6V A;  3B0V C;  1VYI A;  3B9Q A;  3UGO A;  4LAC B;  1OW7 A;  1NLX A;  3DE8 A;  4MVU A;  4PK4 A;  4XTK A;  4YT4 A;  2J7P A;  1E2X A;  2W4M A;  3GM1 A;  3FMS A;  3OWT A;  1L7C A;  5A6B A;  4YT2 A;  1MQV A;  3FOO A;  1VTM P;  2XM4 A;  3IHU A;  1BBH A;  2QLA A;  3CAX A;  1GGQ A;  1YVI A;  3ECS A;  2M4E A;  1OCO C;  1E86 A;  4OIR F;  4FAP B;  1JRA A;  5JVE A;  3GEE A;  4J30 B;  3W8I A;  3IQ5 A;  4NQF A;  1A41 A;  4ULW A;  2P7V A;  2JPU A;  2XLH A;  3ZVR A;  2Q00 A;  1AEP A;  2WZG A;  2YQY A;  4IAO A;  4Z9I A;  3RFY A;  3U0C A;  1PCX A;  1TQG A;  3SZR A;  3O6X A;  3S27 A;  5A6B D;  4JZA A;  5B1A C;  2VB6 A;  5BUO A;  1KU2 A;  2YL1 A;  2OEX A;  3K1H A;  2YL7 A;  4H54 A;  2A69 F;  3S90 A;  1GM5 A;  3GM2 A;  2P0N A;  1EQ1 A;  1CGN A;  1NG1 A;  2A68 F;  4PR9 A;  4E7Z A;  2Y3G A;  2DI3 A;  2FGY A;  2RSE B;  3FAJ A;  4EBB A;  4IB4 A;  1TR2 A;  1QPU A;  3DAG A;  5GPG B;  3T9O A;  3VF0 A;  3ZTZ A;  1NBB A;  2XL6 A;  5L0H A;  4XPY A;  1I5N A;  2IXO A;  1IW7 F;  4JC7 A;  4JTA B;  2R7V A;  1TKN A;  1H9T A;  1TWG A;  3EPV A;  3N24 A;  1JAF A;  2WVQ A;  2YLI A;  3EGX B;  4I44 A;  1XZP A;  4PFP A;  3H2V A;  3ZTM A;  3R7C A;  2HFI A;  1OR2 A;  2OJE D;  3EFO A;  2J9B A;  4N6H A;  5E2Q A;  3QMK A;  1Z23 A;  1BZ4 A;  1KNY A;  3RW0 A;  5AC5 A;  3NYJ A;  5D92 A;  3L1M A;  4DVY P;  1M57 C;  1V54 C;  2LD6 A;  3SXZ A;  3POV A;  3NMI A;  2KNH A;  3L8J A;  1A0B A;  3ZG1 A;  3KL4 A;  3HNL A;  4JRZ A;  4DJ9 A;  1MMD A;  1OCZ C;  5KYU A;  3NG1 A;  4YK5 A;  3TK0 A;  3J06 A;  4BEM J;  4C7O A;  3AG4 C;  3RQF A;  2BL2 A;  2UUH A;  2CDQ A;  3ASO C;  5B3S C;  5HV9 A;  3FDQ A;  2A0U A;  1SZI A;  1V55 C;  3K6B A;  3AGU A;  5EK0 A;  1G4W R;  1NFO A;  4YL1 A;  3OEO A;  3RKO F;  2XLV A;  4WGZ A;  3UMI A;  1LS1 A;  3DZA A;  3S9O A;  3PMR A;  1BR4 A;  3L8I A;  3TOL A;  2VC9 A;  3E70 C;  4CIP A;  3S84 A;  2Q9B A;  2R9R B;  1T6Q A;  2B0H A;  4CDY A;  1PV3 A;  3DAF A;  4RD9 A;  4OIO F;  2XL4 A;  3MYF A;  2ZXP A;  1OKK D;  3DJU B;  3ZDL A;  1TWC A;  2XLW A;  4LER A;  3IQC A;  1YYX A;  4U5G A;  3JRM O;  3HNI A;  5E3A A;  5JLI A;  3LUT B;  3ZQY A;  5COF A;  3GWN A;  4LLE A;  1PD0 A;  2B0J A;  2IM8 A;  2WB7 A;  3DWW A;  2NG1 A;  4ZLC A;  4CSA C;  3M1C B;  1TWA A;  1QLE C;  2PBE A;  2DGJ A;  4E7S A;  4KC9 A;  2NSF A;  4XEK A;  2V26 A;  4CS8 A;  1J8M F;  4IAR A;  4QI0 A;  1Z6A A;  2Q4F A;  1ZU4 A;  3TUL A;  3AG2 C;  2IYL D;  2QTV A;  3WHN A;  1RXQ A;  3KKB A;  1S7Z A;  3U2M A;  2XS8 A;  4E17 A;  2R7S A;  1RJ9 A; 
#chains in the Genus database with same CATH homology
 3G4X A;  1Q0K A;  3G50 A;  1Q0D A;  1Q0F A;  1T6I A;  4NCQ A;  1T6U A;  3G4Z A;  1Q0G A;  1Q0M A;  1T6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...