3G4ZA

Crystal structure of nisod y9f mutant at 1.9 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
117
structure length
117
Chain Sequence
b'HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Role of conserved tyrosine residues in NiSOD catalysis: a case of convergent evolution
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 50
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 3g4zA00
1Q0KA 3G4XA 1Q0DA 1Q0GA 4NCQA 3G50A 1Q0MA 1Q0FA 1T6IA 1T6QA 3G4ZA 1T6UA
chains in the Genus database with same CATH superfamily
5DVWA 3W8IA 4C3BA 2XM4A 3ZIBA 5DS4A 1E85A 2CGEA 5JSLA 5BUOA 2QY9A 1MMDA 2Q00A 2L81A 1JPJA 2HKVA 2VC9A 2WZLA 5L0GA 5A69A 2YKZA 1D1AA 1MMNA 2IBFA 2OEXA 2OJQA 3Q7LA 4NC3A 2HSQA 4LDKA 5T3TA 2RSEB 1NZEA 3SP1A 2YL3A 1YZCA 1ZHZA 2GFHA 5JT4A 4JJFA 3O39A 4CS8C 2VCBA 2W45A 4M63A 2L6GA 4CDAA 1RXQA 2A68F 3H2UA 4JZAA 2DYRC 2KJGA 3B0VC 4XLPF 1TWCA 3JTLO 4EBJA 3S27A 3C62A 5KYNA 2HMQA 1D1CA 2XLOA 1MNDA 4JW1A 2GDCA 3DD7A 3UGPA 4J32B 2C03A 3DKAA 2R7XA 1R4TA 1XWJA 1G4US 4KNWA 3W2VA 2IXNA 3SXKA 4KC9A 4X0RA 3TQOA 2DYSC 3W4YA 3F46A 4RDAA 2YL1A 3SNHA 3LEVA 4W8PA 4GYTA 4P9TA 4DXWA 4I3MA 5F5HA 4Q5SF 3GEHA 4JCZA 1FFHA 3CZ6A 1JAFA 1XZQA 1Q0MA 1UG7A 4JTAB 1E84A 1YYXA 3A11A 3ASOC 4I1OB 3JYYA 3OA1A 4D4NA 1CPQA 4BJTA 2J9UA 3QVZA 2B0HA 1FFTC 1OXBA 1QLEC 1U89A 2YWAA 2BE5F 1VYIA 4CJOA 1JR8A 3FDQA 3QZCA 2YLGA 3QVYA 1D0YA 1YJGA 4PJLA 2Y69C 2NUPB 2O9XA 3HJCA 4JKVA 3U3BA 3ZQVA 1TKNA 3TD7A 4W8KA 3LS1A 1NU7D 2BL2A 2CDQA 4LLEA 3SEOA 3MX3A 4MVQA 2VCCA 3FOOA 4E18A 2PF4E 1FMVA 1AEPA 1HY5A 5L0JA 3NYJA 2XLDA 2RD9A 4OD4A 5DLJA 3KKBA 5IY5C 4PFPA 2DGJA 1QPUA 2IXMA 2KNHA 1Z7Qc 3T6BA 2QNLA 5KYXA 1FNTc 3ZVRA 1PD0A 1ZW3A 1SYQA 2R7QA 3DAGA 5EK0A 1B68A 3GWNA 4FX5A 3KYJA 5KYYA 4YT4A 4MVMA 2R7TA 2AP3A 3QMKA 3EQLF 3KH2A 2DB4A 2W9YA 3AGTA 4O79A 4LLCA 2R7UA 1NU9C 4BG0A 1RKEA 3RVZA 1OKKD 4IGGA 4MVOA 4YT2A 4Q4ZF 4U5EE 2IYLD 4PJJA 4CIPA 3NKDA 2Q7RA 3Q6MA 3B9QA 5A6BD 3J06A 4JRZA 4B6IA 2R05A 4Z9IA 1C02A 1ST6A 2WVNA 3ABKC 3HKKA 4PK4A 3GANA 5B1BC 3ABLC 1ORJA 3OEOA 2CNWA 4LERA 4QDLA 3GEIA 4IB4A 4U5CE 5KYYB 256BA 1T6UA 4JEAA 4N06A 4U5BE 5A6BA 3IQ5A 1TWAA 4E7ZA 1APCA 1GQAA 2LD6A 3DJNB 3ITFA 3M4CA 4BJ1A 3IQCA 3LLKA 4HEAJ 2AWCA 1RKEB 3W2WA 2BC5A 4KBLA 1RJ9B 4O7GA 3L34A 1LIHA 2HMZA 4PFOA 4E7SA 5JS5A 5AGFA 2LK4A 4OD5A 3CSKA 3K33A 3TJ5A 1FAPB 1LI7A 3KMIA 1JMWA 3MFNA 4XEFA 1SMYF 4NTFA 1ORSC 4EIYA 5FCLA 4H4KC 3RYLA 5L0HA 1HE9A 2M4EA 4JIOA 4O6MA 2HV7A 2CCYA 2L9JA 3RH3A 2ZPAA 3DZAA 2V26A 3UMKA 1HW1A 5L0CA 3UGOA 5BQGA 3FAJA 3G4ZA 3U5SA 1E2XA 1S7ZA 4EUKB 2EPNA 3C7JA 4HFKB 3VYWA 2WZGA 4H54A 4CX9A 4Z9JA 1N1CA 1YARO 5B3SC 2UUHA 4C7OA 2XS1A 3EJNA 3BRJA 1K40A 3UNGC 4RD9A 4U9EA 1VMAA 3PHF2 2H7VC 1FTSA 1ZU4A 2LSEA 2JPUA 2NSGA 3GM1A 4JTDB 4P9FA 5CI9A 3U2MA 3ZQYA 1ZHXA 1YVIA 2R25A 1H6GA 2PP4A 2Y3GA 3ECSA 4YL0A 5CIVA 4XWJA 3S0XA 1MNEA 3EH1A 2LP4A 1V55C 3RF3A 3EHNA 4BEJA 3MYIA 3C8GD 2VB6A 1A41A 1Q0FA 1T6QA 1A7VA 3AGUA 1ZHYA 4IWBA 5COFA 3U8PA 3ZC4A 5JRAA 4QI2A 1K05A 3KL4A 3SYNA 4MW8A 3T6JA 2WZFA 1RCPA 1TWHA 2ASRA 2IOQA 1Z23A 2Y3DA 3C8GA 3G50A 2KQ9A 1NLXA 2ZXRA 4MS2A 2B0JA 2R7VA 3L0IA 3POVA 4PJMA 5JLIA 2L7AA 2XRHA 3DWWA 4XEKA 1VLTA 1NBBA 4KNVA 1NFOA 4HE8D 5EGYA 5E2QA 2XLHA 1WTYA 3R2PA 3RQFA 4EHPA 2R7OA 4ZLCA 3B71A 2X0CA 2YHSA 4U5FE 4EWCA 2FFHA 3S9OA 2ZXWC 1YDIA 2PNOA 1AVOB 2YQYA 3C8GB 1OXKA 2ZXOA 2Y39A 5DS5A 2PX0A 1C17M 1YLMA 1UFBA 5EHHA 2Y3BA 2QLAA 2R7RA 2R7SA 1QZXA 5E33A 3X2QC 1OW6A 3IEEA 4P6IC 2LFFA 3QW0A 1LM3B 2I15A 4MQ9F 1NFNA 2HS5A 2Z15A 1IW7F 4E0HA 2KSFA 4G7OF 3NRHA 1I4ZA 1Q0KA 1SR2A 1VOMA 2PX3A 2TMVP 2E87A 2J7PD 1ZHWA 3GWLA 3JRTA 1TFOB 2WVQA 1QSPA 2XLEA 4ZLDA 3ZSUA 1Z5ZA 2YVKA 3U0CA 3MBGA 3NKEA 3S29A 4XLNF 4J7YA 3RVYA 2YEVA 3TOMA 1ZVZA 2R7WA 2J7PA 2YZSA 3C8ZA 1OR2A 2J46A 2MYSA 3HNLA 4IRUA 4XQ1A 3RKOF 3WODF 3B0PA 3AG3C 1R5ID 1F1MA 1AUEA 1ZU5A 1BR4A 3E9VA 3FHDA 2EIMC 3VRCA 3WHNA 4BEMJ 4CS7A 5BQHA 2XS8A 4R32A 1O5HA 2FAPB 4LDQA 4ULVA 4EBBA 4JTCB 2Q9AA 3G4XA 3M79A 3FAPB 5F5FA 3O6XA 3LESA 5KYWA 1M56C 1VB5A 3RW0A 4BJ6A 4N6HA 1LVKA 1LS1A 3N0TA 2YLIA 3T4RA 1OR3A 5DS6A 2CNWD 3AG1C 4NTAA 2F22A 1E83A 3HNKA 1H9GA 1FMWA 1TFKB 1I4YA 4CS9A 4YL3A 3F47A 3SXYA 5KYXB 3AG2C 4WJ0A 3ZTZA 1MMAA 2Q9BA 1T5OA 1JOGA 2OG2A 3LNMB 3H2VA 5KYWB 2HZ8A 2D4UA 1KTMA 5TJ5E 3JCUQ 4CIHA 3EGDA 1YAUO 1C03A 4CJGA 4ULWA 2P61A 4PJNA 4DRJB 5A6KA 2G62A 2W4BA 1ZHTA 3UMHA 4XPWA 4MTFA 2NUTA 1G5ZA 1H7IA 2OU6A 1HMDA 3EFOA 2LFDA 1BR1A 2XLVA 3MLGA 3HTKC 2ETSA 2A0UA 2EPKX 3NMIA 4NQFA 3I5QA 4U9DA 1Z6AA 1ZYRF 4XEVA 3V5YA 3WAQA 3NMKA 4E0IA 5L0FA 2XLWA 4OIQF 1VK5A 1I5NA 2H8AA 3Q6NA 3QW1A 2IXPA 3EGDB 2NPUA 3TK0A 1SF8A 2CW0F 1CGME 2LQGA 3L1MA 1LI5A 4YJWA 2PBEA 4D4XA 2L6HA 3ZWIA 1M2VA 2HV6A 3QTHA 1OW7A 4RBNA 4JEBA 2OQMA 3EH2A 4BJ6C 4F4BA 1O87A 3X1OA 2EPLX 3JSZA 4DVYP 1GGQA 4OIOF 2Q3TA 4BPMA 4DOZA 5HV9A 2V3CC 1D0ZA 1M57C 2LCHA 3Q7GA 2QUPA 2VASA 2ZD9A 1L7CA 2J9BA 3C63A 4PR9A 5F28E 5T3WA 3U2LA 4CS9C 4CSAC 1CPRA 2QE9A 1TR2A 3FMSA 2A0BA 2OOCA 1J8MF 1L3PA 4JE9A 5CI8A 3UMIA 1QVXA 2JX0A 4ANJA 4PACA 3LUTB 5COGA 2GA0A 2R03A 2ZXPA 4G7HF 4KI2A 3JSEO 3K6BA 2MHRA 1JPNA 4L6RA 4E17A 3N2ZB 2ICWG 2KYHA 2Y3HA 3DXJF 4DVZA 1CGOA 2D5RB 1OCOC 4ONSA 2HFIA 3U9MA 3O10A 4GQHA 4C7OB 1V74B 3KYIA 5L3VA 3KPHA 1PV3A 2P0NA 2AVKA 2R9RB 5JUAA 4MVUA 3ZG1A 1PCXA 3LJBA 5D92A 5B1AC 3ZDLA 4NY3A 1Z63A 4MNDA 4JCHA 1YYJA 1BZ4A 3EZIA 4G0HA 2J9WA 4AX2A 4AK9A 2EIKC 3S90A 3LS0A 1LE4A 2Q9CA 1WGWA 4JJGA 2KC3A 2YRFA 3V5XA 4DJ9A 2L6FA 4YL1A 1Y6DA 3ATPA 4J30B 1NSGB 1D1BA 1V4AA 1ZZPA 3SXMA 1Z3IX 3AOUA 3VF0A 3AG4C 3GM2A 3ABMC 1E86A 1O3UA 1HE1A 4MVSA 3EG9A 2M64A 3JZ0A 4O6NA 3PDMP 2A69F 1GS9A 3U3FA 3GEEA 1S05A 2J0WA 3DM5A 4OINF 4G7ZF 1YA7O 2HJ3A 2VCAA 5AC5A 3CEXA 1RKCA 2W4MA 1LPEA 3K7DA 1A0BA 1NG1A 1BDJB 2Q4FA 3AQBA 3ASNC 4WGYA 3RQGA 4AL0A 2FGYA 2J8WA 4CBEA 2AU5A 3JT1A 4CDVA 3JRMO 4A4AA 3HLZA 4A2NB 4YT8A 2IM8A 3LEOA 4MVRA 3S28A 2YLDA 3US6A 3EG9B 3RQEA 2NUPA 1H9TA 3HNIA 4G78A 1IZMA 1Y4CA 2A6EF 1QKRA 2XLMA 4BJ5C 1VYKA 1W2WA 4MTOA 3CAXA 4JC7A 3A9CA 2H7OA 3NYMA 4DBQA 4C3EA 4IARA 3UR3C 3FXHA 4YWQA 3M4BA 4O6YA 2PFDA 4QI0A 4U5HA 2VH3A 1OQCA 4OIRF 3LAYA 3I5PA 1SZIA 3LLIA 2OKUA 2QTVA 1LKXA 3L8JA 4IJJA 5L0IA 2NSFA 3S84A 3R7CA 3FOPA 1HW2A 3B29A 3DE8A 5D91A 5A6JA 1YA9A 1VTMP 2P6VA 4I44A 4IAQA 4N6CA 1Q0DA 5JVEA 4CDYA 4MTGA 2WVOA 5E3AA 2LIGA 5L3QA 2WL8A 3O55A 1XZPA 1J8YF 2WB7A 3PCVA 4AL1A 1A7EA 1TWGA 1Q0GA 3EZHA 4MW3A 3DMDA 1T01A 4C3DA 2H7BA 3K66A 2G3VA 4WGZA 3T6GB 4CSAA 3K1IA 5B3IA 1PD1A 4YT5A 3C18A 4WABA 1HMOA 1LE2A 5FZTA 3VM6A 2XL6A 1WWPA 2XSEA 3NYLA 5GPGB 2GWWA 5DQTA 1ORYA 4FAPB 4YN0B 4FWVA 1A7DA 1G4WR 3PMRA 1G8XA 4UDVA 4J7TA 1BR2A 3LNRA 4Q7CA 1KU2A 1BBHA 1LS4A 1T6IA 4MVZA 1EA8A 5E3CA 4IAOA 2HUJA 1RJ9A 1M2OA 3U9JA 2IXOA 1OCCC 2P1AA 3MYFA 2J0XA 3DAFA 2OJED 4DRIB 1GM5A 3CQZA 3VAYA 1DOWA 2KW3C 2YL0A 4EKWA 3IPMO 1K04A 1OKKA 2EPOA 3BEHA 2C04A 4AE4A 1OCRC 1M6TA 2A6HF 2EILC 3DJUB 4K7BA 4N4WA 2XXAA 1TQGA 2GAQA 5BQIA 1CGNA 2KK1A 1MQVA 2G3KA 2JD3A 2R02A 3GM3A 3JYHA 4U5DE 4YK5A 5JP7A 3U8VA 1OCZC 2CYDA 4LDRA 2XM0A 1FR0A 2HSBA 4K0DA 3EHMA 1YZAA 3ZTMA 4ER9A 3I4UA 1QQ3A 1WASA 2NUTB 2UUIA 3FVYA 3EFOB 4LACB 1D0XA 3IQ6A 4I1MA 1EKYA 2XL4A 4Z9HA 3WG7C 4FESA 4CS8A 3N24A 2P7VA 3NMJA 3GORA 2YL7A 5K0IA 3OWTA 4AE4B 2OCCC 1JRAA 3AJMA 1WATA 3EPVA 4XPYA 3NDBB 2XXAB 4DBRA 3K1IC 4OIPF 3EGXA 1EI7A 3IHUA 3M1CB 4XTKA 3DM9B 3TJ6A 3NG1A 3V5ZA 2AWYA 1U0BB 1VLSA 2KGOA 3W8HA 5A6AA 1V54C 5AC4A 2HJMA 4XPXA 3SXZA 3B0UX 3K1HA 5KYUA 1M2VB 1MMGA 2EINC 5L0DA 1U6HA 5T1DB 3IQTA 2I8BA 3DI5A 3RIPA 4DRHB 5HSWA 2A1DD 4BJ5A 2NG1A 2X51A 4JVSA 4K1OA 1EQ1A 4EBKA 3AQCA 2EPMX 3SZRA 3E70C 2XL8A 3GODA 2DI3A 3DE9A 1ZW2A 1DOVA 1WOLA 4U5GA 3EGXB 3RFYA 2OEVA 5DQZA 3H65A 1WN0A 4NCQA 4NTBA 1OW8A 4GEHA 1T9KA 3T9OA 2MWQA 5COMA 3V7OA 1KNYA 3HNJA 5KYUB 3M15A 4HFFB 4JURI 3TOLA 2J9VA 1RMVA 3L8IA 2J45A 3TULA 2EIJC
chains in the Genus database with same CATH topology
1Q0KA 3G4XA 1Q0DA 1Q0GA 4NCQA 3G50A 1Q0MA 1Q0FA 1T6IA 1T6QA 3G4ZA 1T6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0K A;  3G4X A;  1Q0D A;  1Q0G A;  4NCQ A;  3G50 A;  1Q0M A;  1Q0F A;  1T6I A;  1T6Q A;  3G4Z A;  1T6U A; 
#chains in the Genus database with same CATH topology
 5DVW A;  3W8I A;  4C3B A;  2XM4 A;  3ZIB A;  5DS4 A;  1E85 A;  2CGE A;  5JSL A;  5BUO A;  2QY9 A;  1MMD A;  2Q00 A;  2L81 A;  1JPJ A;  2HKV A;  2VC9 A;  2WZL A;  5L0G A;  5A69 A;  2YKZ A;  1D1A A;  1MMN A;  2IBF A;  2OEX A;  2OJQ A;  3Q7L A;  4NC3 A;  2HSQ A;  4LDK A;  5T3T A;  2RSE B;  1NZE A;  3SP1 A;  2YL3 A;  1YZC A;  1ZHZ A;  2GFH A;  5JT4 A;  4JJF A;  3O39 A;  4CS8 C;  2VCB A;  2W45 A;  4M63 A;  2L6G A;  4CDA A;  1RXQ A;  2A68 F;  3H2U A;  4JZA A;  2DYR C;  2KJG A;  3B0V C;  4XLP F;  1TWC A;  3JTL O;  4EBJ A;  3S27 A;  3C62 A;  5KYN A;  2HMQ A;  1D1C A;  2XLO A;  1MND A;  4JW1 A;  2GDC A;  3DD7 A;  3UGP A;  4J32 B;  2C03 A;  3DKA A;  2R7X A;  1R4T A;  1XWJ A;  1G4U S;  4KNW A;  3W2V A;  2IXN A;  3SXK A;  4KC9 A;  4X0R A;  3TQO A;  2DYS C;  3W4Y A;  3F46 A;  4RDA A;  2YL1 A;  3SNH A;  3LEV A;  4W8P A;  4GYT A;  4P9T A;  4DXW A;  4I3M A;  5F5H A;  4Q5S F;  3GEH A;  4JCZ A;  1FFH A;  3CZ6 A;  1JAF A;  1XZQ A;  1Q0M A;  1UG7 A;  4JTA B;  1E84 A;  1YYX A;  3A11 A;  3ASO C;  4I1O B;  3JYY A;  3OA1 A;  4D4N A;  1CPQ A;  4BJT A;  2J9U A;  3QVZ A;  2B0H A;  1FFT C;  1OXB A;  1QLE C;  1U89 A;  2YWA A;  2BE5 F;  1VYI A;  4CJO A;  1JR8 A;  3FDQ A;  3QZC A;  2YLG A;  3QVY A;  1D0Y A;  1YJG A;  4PJL A;  2Y69 C;  2NUP B;  2O9X A;  3HJC A;  4JKV A;  3U3B A;  3ZQV A;  1TKN A;  3TD7 A;  4W8K A;  3LS1 A;  1NU7 D;  2BL2 A;  2CDQ A;  4LLE A;  3SEO A;  3MX3 A;  4MVQ A;  2VCC A;  3FOO A;  4E18 A;  2PF4 E;  1FMV A;  1AEP A;  1HY5 A;  5L0J A;  3NYJ A;  2XLD A;  2RD9 A;  4OD4 A;  5DLJ A;  3KKB A;  5IY5 C;  4PFP A;  2DGJ A;  1QPU A;  2IXM A;  2KNH A;  1Z7Q c;  3T6B A;  2QNL A;  5KYX A;  1FNT c;  3ZVR A;  1PD0 A;  1ZW3 A;  1SYQ A;  2R7Q A;  3DAG A;  5EK0 A;  1B68 A;  3GWN A;  4FX5 A;  3KYJ A;  5KYY A;  4YT4 A;  4MVM A;  2R7T A;  2AP3 A;  3QMK A;  3EQL F;  3KH2 A;  2DB4 A;  2W9Y A;  3AGT A;  4O79 A;  4LLC A;  2R7U A;  1NU9 C;  4BG0 A;  1RKE A;  3RVZ A;  1OKK D;  4IGG A;  4MVO A;  4YT2 A;  4Q4Z F;  4U5E E;  2IYL D;  4PJJ A;  4CIP A;  3NKD A;  2Q7R A;  3Q6M A;  3B9Q A;  5A6B D;  3J06 A;  4JRZ A;  4B6I A;  2R05 A;  4Z9I A;  1C02 A;  1ST6 A;  2WVN A;  3ABK C;  3HKK A;  4PK4 A;  3GAN A;  5B1B C;  3ABL C;  1ORJ A;  3OEO A;  2CNW A;  4LER A;  4QDL A;  3GEI A;  4IB4 A;  4U5C E;  5KYY B;  256B A;  1T6U A;  4JEA A;  4N06 A;  4U5B E;  5A6B A;  3IQ5 A;  1TWA A;  4E7Z A;  1APC A;  1GQA A;  2LD6 A;  3DJN B;  3ITF A;  3M4C A;  4BJ1 A;  3IQC A;  3LLK A;  4HEA J;  2AWC A;  1RKE B;  3W2W A;  2BC5 A;  4KBL A;  1RJ9 B;  4O7G A;  3L34 A;  1LIH A;  2HMZ A;  4PFO A;  4E7S A;  5JS5 A;  5AGF A;  2LK4 A;  4OD5 A;  3CSK A;  3K33 A;  3TJ5 A;  1FAP B;  1LI7 A;  3KMI A;  1JMW A;  3MFN A;  4XEF A;  1SMY F;  4NTF A;  1ORS C;  4EIY A;  5FCL A;  4H4K C;  3RYL A;  5L0H A;  1HE9 A;  2M4E A;  4JIO A;  4O6M A;  2HV7 A;  2CCY A;  2L9J A;  3RH3 A;  2ZPA A;  3DZA A;  2V26 A;  3UMK A;  1HW1 A;  5L0C A;  3UGO A;  5BQG A;  3FAJ A;  3G4Z A;  3U5S A;  1E2X A;  1S7Z A;  4EUK B;  2EPN A;  3C7J A;  4HFK B;  3VYW A;  2WZG A;  4H54 A;  4CX9 A;  4Z9J A;  1N1C A;  1YAR O;  5B3S C;  2UUH A;  4C7O A;  2XS1 A;  3EJN A;  3BRJ A;  1K40 A;  3UNG C;  4RD9 A;  4U9E A;  1VMA A;  3PHF 2;  2H7V C;  1FTS A;  1ZU4 A;  2LSE A;  2JPU A;  2NSG A;  3GM1 A;  4JTD B;  4P9F A;  5CI9 A;  3U2M A;  3ZQY A;  1ZHX A;  1YVI A;  2R25 A;  1H6G A;  2PP4 A;  2Y3G A;  3ECS A;  4YL0 A;  5CIV A;  4XWJ A;  3S0X A;  1MNE A;  3EH1 A;  2LP4 A;  1V55 C;  3RF3 A;  3EHN A;  4BEJ A;  3MYI A;  3C8G D;  2VB6 A;  1A41 A;  1Q0F A;  1T6Q A;  1A7V A;  3AGU A;  1ZHY A;  4IWB A;  5COF A;  3U8P A;  3ZC4 A;  5JRA A;  4QI2 A;  1K05 A;  3KL4 A;  3SYN A;  4MW8 A;  3T6J A;  2WZF A;  1RCP A;  1TWH A;  2ASR A;  2IOQ A;  1Z23 A;  2Y3D A;  3C8G A;  3G50 A;  2KQ9 A;  1NLX A;  2ZXR A;  4MS2 A;  2B0J A;  2R7V A;  3L0I A;  3POV A;  4PJM A;  5JLI A;  2L7A A;  2XRH A;  3DWW A;  4XEK A;  1VLT A;  1NBB A;  4KNV A;  1NFO A;  4HE8 D;  5EGY A;  5E2Q A;  2XLH A;  1WTY A;  3R2P A;  3RQF A;  4EHP A;  2R7O A;  4ZLC A;  3B71 A;  2X0C A;  2YHS A;  4U5F E;  4EWC A;  2FFH A;  3S9O A;  2ZXW C;  1YDI A;  2PNO A;  1AVO B;  2YQY A;  3C8G B;  1OXK A;  2ZXO A;  2Y39 A;  5DS5 A;  2PX0 A;  1C17 M;  1YLM A;  1UFB A;  5EHH A;  2Y3B A;  2QLA A;  2R7R A;  2R7S A;  1QZX A;  5E33 A;  3X2Q C;  1OW6 A;  3IEE A;  4P6I C;  2LFF A;  3QW0 A;  1LM3 B;  2I15 A;  4MQ9 F;  1NFN A;  2HS5 A;  2Z15 A;  1IW7 F;  4E0H A;  2KSF A;  4G7O F;  3NRH A;  1I4Z A;  1Q0K A;  1SR2 A;  1VOM A;  2PX3 A;  2TMV P;  2E87 A;  2J7P D;  1ZHW A;  3GWL A;  3JRT A;  1TFO B;  2WVQ A;  1QSP A;  2XLE A;  4ZLD A;  3ZSU A;  1Z5Z A;  2YVK A;  3U0C A;  3MBG A;  3NKE A;  3S29 A;  4XLN F;  4J7Y A;  3RVY A;  2YEV A;  3TOM A;  1ZVZ A;  2R7W A;  2J7P A;  2YZS A;  3C8Z A;  1OR2 A;  2J46 A;  2MYS A;  3HNL A;  4IRU A;  4XQ1 A;  3RKO F;  3WOD F;  3B0P A;  3AG3 C;  1R5I D;  1F1M A;  1AUE A;  1ZU5 A;  1BR4 A;  3E9V A;  3FHD A;  2EIM C;  3VRC A;  3WHN A;  4BEM J;  4CS7 A;  5BQH A;  2XS8 A;  4R32 A;  1O5H A;  2FAP B;  4LDQ A;  4ULV A;  4EBB A;  4JTC B;  2Q9A A;  3G4X A;  3M79 A;  3FAP B;  5F5F A;  3O6X A;  3LES A;  5KYW A;  1M56 C;  1VB5 A;  3RW0 A;  4BJ6 A;  4N6H A;  1LVK A;  1LS1 A;  3N0T A;  2YLI A;  3T4R A;  1OR3 A;  5DS6 A;  2CNW D;  3AG1 C;  4NTA A;  2F22 A;  1E83 A;  3HNK A;  1H9G A;  1FMW A;  1TFK B;  1I4Y A;  4CS9 A;  4YL3 A;  3F47 A;  3SXY A;  5KYX B;  3AG2 C;  4WJ0 A;  3ZTZ A;  1MMA A;  2Q9B A;  1T5O A;  1JOG A;  2OG2 A;  3LNM B;  3H2V A;  5KYW B;  2HZ8 A;  2D4U A;  1KTM A;  5TJ5 E;  3JCU Q;  4CIH A;  3EGD A;  1YAU O;  1C03 A;  4CJG A;  4ULW A;  2P61 A;  4PJN A;  4DRJ B;  5A6K A;  2G62 A;  2W4B A;  1ZHT A;  3UMH A;  4XPW A;  4MTF A;  2NUT A;  1G5Z A;  1H7I A;  2OU6 A;  1HMD A;  3EFO A;  2LFD A;  1BR1 A;  2XLV A;  3MLG A;  3HTK C;  2ETS A;  2A0U A;  2EPK X;  3NMI A;  4NQF A;  3I5Q A;  4U9D A;  1Z6A A;  1ZYR F;  4XEV A;  3V5Y A;  3WAQ A;  3NMK A;  4E0I A;  5L0F A;  2XLW A;  4OIQ F;  1VK5 A;  1I5N A;  2H8A A;  3Q6N A;  3QW1 A;  2IXP A;  3EGD B;  2NPU A;  3TK0 A;  1SF8 A;  2CW0 F;  1CGM E;  2LQG A;  3L1M A;  1LI5 A;  4YJW A;  2PBE A;  4D4X A;  2L6H A;  3ZWI A;  1M2V A;  2HV6 A;  3QTH A;  1OW7 A;  4RBN A;  4JEB A;  2OQM A;  3EH2 A;  4BJ6 C;  4F4B A;  1O87 A;  3X1O A;  2EPL X;  3JSZ A;  4DVY P;  1GGQ A;  4OIO F;  2Q3T A;  4BPM A;  4DOZ A;  5HV9 A;  2V3C C;  1D0Z A;  1M57 C;  2LCH A;  3Q7G A;  2QUP A;  2VAS A;  2ZD9 A;  1L7C A;  2J9B A;  3C63 A;  4PR9 A;  5F28 E;  5T3W A;  3U2L A;  4CS9 C;  4CSA C;  1CPR A;  2QE9 A;  1TR2 A;  3FMS A;  2A0B A;  2OOC A;  1J8M F;  1L3P A;  4JE9 A;  5CI8 A;  3UMI A;  1QVX A;  2JX0 A;  4ANJ A;  4PAC A;  3LUT B;  5COG A;  2GA0 A;  2R03 A;  2ZXP A;  4G7H F;  4KI2 A;  3JSE O;  3K6B A;  2MHR A;  1JPN A;  4L6R A;  4E17 A;  3N2Z B;  2ICW G;  2KYH A;  2Y3H A;  3DXJ F;  4DVZ A;  1CGO A;  2D5R B;  1OCO C;  4ONS A;  2HFI A;  3U9M A;  3O10 A;  4GQH A;  4C7O B;  1V74 B;  3KYI A;  5L3V A;  3KPH A;  1PV3 A;  2P0N A;  2AVK A;  2R9R B;  5JUA A;  4MVU A;  3ZG1 A;  1PCX A;  3LJB A;  5D92 A;  5B1A C;  3ZDL A;  4NY3 A;  1Z63 A;  4MND A;  4JCH A;  1YYJ A;  1BZ4 A;  3EZI A;  4G0H A;  2J9W A;  4AX2 A;  4AK9 A;  2EIK C;  3S90 A;  3LS0 A;  1LE4 A;  2Q9C A;  1WGW A;  4JJG A;  2KC3 A;  2YRF A;  3V5X A;  4DJ9 A;  2L6F A;  4YL1 A;  1Y6D A;  3ATP A;  4J30 B;  1NSG B;  1D1B A;  1V4A A;  1ZZP A;  3SXM A;  1Z3I X;  3AOU A;  3VF0 A;  3AG4 C;  3GM2 A;  3ABM C;  1E86 A;  1O3U A;  1HE1 A;  4MVS A;  3EG9 A;  2M64 A;  3JZ0 A;  4O6N A;  3PDM P;  2A69 F;  1GS9 A;  3U3F A;  3GEE A;  1S05 A;  2J0W A;  3DM5 A;  4OIN F;  4G7Z F;  1YA7 O;  2HJ3 A;  2VCA A;  5AC5 A;  3CEX A;  1RKC A;  2W4M A;  1LPE A;  3K7D A;  1A0B A;  1NG1 A;  1BDJ B;  2Q4F A;  3AQB A;  3ASN C;  4WGY A;  3RQG A;  4AL0 A;  2FGY A;  2J8W A;  4CBE A;  2AU5 A;  3JT1 A;  4CDV A;  3JRM O;  4A4A A;  3HLZ A;  4A2N B;  4YT8 A;  2IM8 A;  3LEO A;  4MVR A;  3S28 A;  2YLD A;  3US6 A;  3EG9 B;  3RQE A;  2NUP A;  1H9T A;  3HNI A;  4G78 A;  1IZM A;  1Y4C A;  2A6E F;  1QKR A;  2XLM A;  4BJ5 C;  1VYK A;  1W2W A;  4MTO A;  3CAX A;  4JC7 A;  3A9C A;  2H7O A;  3NYM A;  4DBQ A;  4C3E A;  4IAR A;  3UR3 C;  3FXH A;  4YWQ A;  3M4B A;  4O6Y A;  2PFD A;  4QI0 A;  4U5H A;  2VH3 A;  1OQC A;  4OIR F;  3LAY A;  3I5P A;  1SZI A;  3LLI A;  2OKU A;  2QTV A;  1LKX A;  3L8J A;  4IJJ A;  5L0I A;  2NSF A;  3S84 A;  3R7C A;  3FOP A;  1HW2 A;  3B29 A;  3DE8 A;  5D91 A;  5A6J A;  1YA9 A;  1VTM P;  2P6V A;  4I44 A;  4IAQ A;  4N6C A;  1Q0D A;  5JVE A;  4CDY A;  4MTG A;  2WVO A;  5E3A A;  2LIG A;  5L3Q A;  2WL8 A;  3O55 A;  1XZP A;  1J8Y F;  2WB7 A;  3PCV A;  4AL1 A;  1A7E A;  1TWG A;  1Q0G A;  3EZH A;  4MW3 A;  3DMD A;  1T01 A;  4C3D A;  2H7B A;  3K66 A;  2G3V A;  4WGZ A;  3T6G B;  4CSA A;  3K1I A;  5B3I A;  1PD1 A;  4YT5 A;  3C18 A;  4WAB A;  1HMO A;  1LE2 A;  5FZT A;  3VM6 A;  2XL6 A;  1WWP A;  2XSE A;  3NYL A;  5GPG B;  2GWW A;  5DQT A;  1ORY A;  4FAP B;  4YN0 B;  4FWV A;  1A7D A;  1G4W R;  3PMR A;  1G8X A;  4UDV A;  4J7T A;  1BR2 A;  3LNR A;  4Q7C A;  1KU2 A;  1BBH A;  1LS4 A;  1T6I A;  4MVZ A;  1EA8 A;  5E3C A;  4IAO A;  2HUJ A;  1RJ9 A;  1M2O A;  3U9J A;  2IXO A;  1OCC C;  2P1A A;  3MYF A;  2J0X A;  3DAF A;  2OJE D;  4DRI B;  1GM5 A;  3CQZ A;  3VAY A;  1DOW A;  2KW3 C;  2YL0 A;  4EKW A;  3IPM O;  1K04 A;  1OKK A;  2EPO A;  3BEH A;  2C04 A;  4AE4 A;  1OCR C;  1M6T A;  2A6H F;  2EIL C;  3DJU B;  4K7B A;  4N4W A;  2XXA A;  1TQG A;  2GAQ A;  5BQI A;  1CGN A;  2KK1 A;  1MQV A;  2G3K A;  2JD3 A;  2R02 A;  3GM3 A;  3JYH A;  4U5D E;  4YK5 A;  5JP7 A;  3U8V A;  1OCZ C;  2CYD A;  4LDR A;  2XM0 A;  1FR0 A;  2HSB A;  4K0D A;  3EHM A;  1YZA A;  3ZTM A;  4ER9 A;  3I4U A;  1QQ3 A;  1WAS A;  2NUT B;  2UUI A;  3FVY A;  3EFO B;  4LAC B;  1D0X A;  3IQ6 A;  4I1M A;  1EKY A;  2XL4 A;  4Z9H A;  3WG7 C;  4FES A;  4CS8 A;  3N24 A;  2P7V A;  3NMJ A;  3GOR A;  2YL7 A;  5K0I A;  3OWT A;  4AE4 B;  2OCC C;  1JRA A;  3AJM A;  1WAT A;  3EPV A;  4XPY A;  3NDB B;  2XXA B;  4DBR A;  3K1I C;  4OIP F;  3EGX A;  1EI7 A;  3IHU A;  3M1C B;  4XTK A;  3DM9 B;  3TJ6 A;  3NG1 A;  3V5Z A;  2AWY A;  1U0B B;  1VLS A;  2KGO A;  3W8H A;  5A6A A;  1V54 C;  5AC4 A;  2HJM A;  4XPX A;  3SXZ A;  3B0U X;  3K1H A;  5KYU A;  1M2V B;  1MMG A;  2EIN C;  5L0D A;  1U6H A;  5T1D B;  3IQT A;  2I8B A;  3DI5 A;  3RIP A;  4DRH B;  5HSW A;  2A1D D;  4BJ5 A;  2NG1 A;  2X51 A;  4JVS A;  4K1O A;  1EQ1 A;  4EBK A;  3AQC A;  2EPM X;  3SZR A;  3E70 C;  2XL8 A;  3GOD A;  2DI3 A;  3DE9 A;  1ZW2 A;  1DOV A;  1WOL A;  4U5G A;  3EGX B;  3RFY A;  2OEV A;  5DQZ A;  3H65 A;  1WN0 A;  4NCQ A;  4NTB A;  1OW8 A;  4GEH A;  1T9K A;  3T9O A;  2MWQ A;  5COM A;  3V7O A;  1KNY A;  3HNJ A;  5KYU B;  3M15 A;  4HFF B;  4JUR I;  3TOL A;  2J9V A;  1RMV A;  3L8I A;  2J45 A;  3TUL A;  2EIJ C; 
#chains in the Genus database with same CATH homology
 1Q0K A;  3G4X A;  1Q0D A;  1Q0G A;  4NCQ A;  3G50 A;  1Q0M A;  1Q0F A;  1T6I A;  1T6Q A;  3G4Z A;  1T6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...