3G51A

Structural diversity of the active conformation of the n-terminal kinase domain of p90 ribosomal s6 kinase 2
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
280
Chain Sequence
IKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESITVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity of the active N-terminal kinase domain of p90 ribosomal S6 kinase 2
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Ribosomal protein S6 kinase alpha-3
total genus 82
structure length 280
sequence length 300
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3g51A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3g51A01
5EG3A 3MSSA 4U45A 2BZHB 2RFDA 3MH2A 2WNTA 3NYXA 3DBQA 4FV0A 5AMNA 4C4HA 3D15A 2PMNX 2Y9QA 3SA0A 2VWYA 4ZSJA 3WF6A 3PG3A 3ORLA 1CDKA 4HPUE 3R83A 5FXRA 3IO7A 4OAVB 3H9FA 4QP7A 1OITA 3NYNA 1YXVA 4O21A 3QD3A 4EHEA 1R0PA 3V8WA 3ENMA 1SVHA 2RFNA 4BI0A 5L3AA 1QPEA 2H6DA 3VIDA 2BKZA 3G9NA 5FRIA 4CYJA 5AA8A 4DFNA 1PXJA 3EQBA 3DLZA 4KIOA 4FG9A 1OL2A 3VUKA 3ZBFA 4BTJA 5IA5A 4USEA 1ZMUA 4TWPA 2IZTA 4KUJA 4ZTLA 3GCPA 3F2NA 3TWJA 3UNJA 2PMOX 3PWDA 5M44A 4KIKB 1UU8A 4TNDA 1YW2A 1O9UA 4AGDA 3C0GA 4NUSA 2FGIA 4LYNA 3Q9YA 4OTRA 4FIJA 4EHVA 3NMUF 5EW3A 2WHBA 2QOHA 3F2AA 4DHFA 2X9FA 4F6SA 3R1YA 2R3HA 4NKAA 4F63A 4JIAA 5IG1A 1XBCA 4FV7A 1KE7A 4MNEA 5BYLA 2C6MA 4R7BA 2I0HA 4G6LA 4IXPA 5ANJA 2C4GA 2LGCA 4WSYA 1LEZA 2VTAA 4Y46A 3LHJA 3TUDA 3AXWA 1MP8A 2BZJA 3DAEA 3RPYA 3L9NA 2PMLX 3QUEA 3R71A 4LG4A 4DFUA 4M69B 5H8BA 3FLZA 3KB7A 3OF0A 2VGPA 2BTSA 3R7IA 3PJ3A 5AP4A 3HNGA 3CQWA 3WF8A 3KRLA 3H3CA 2F2UA 5H3QA 4C4GA 4D1ZA 2W1EA 4UEUA 4HGEA 5CENA 3G33A 1QCFA 2XIRA 3PSCA 4Y73A 4ALUA 3BGQA 4F64A 3PJCA 4F6UA 1J7UA 3O7LB 4JG7A 3TNPC 2ETRA 2GHGA 3RINA 5IQIA 3P79A 5BYZA 3TXOA 4ANMA 3UYSA 1YDRE 4IVCA 3OCTA 4OBQA 4AP7A 4EH3A 3R1SA 4FTKA 4ANNA 2RSVA 1OUYA 4AGWA 5A4LA 3ETAA 4L43A 1OBDA 4BDBA 3HRCA 3SXRA 4GYGA 3IDBA 4FICA 4NTTA 4ASDA 5HKMA 2UW4A 2OO8X 4O38A 4MQ1A 1OUKA 2XNBA 5IA1A 2C3LA 3FL5A 4CCUA 5FQDC 1FOTA 4V0GA 3CEKA 5EHYA 4X2KA 4WUNA 2ZMDA 3PVGA 3PA4A 2DQ7X 2UW7A 2VTIA 2OJJA 2W99B 3EKNA 3QQKA 5C26A 1Q3DA 4JBQA 4MTAA 2CGUA 3OTUA 4O1OA 5EQYA 1H01A 4KBKA 3THBA 3MPMA 2JAVA 4YHJA 3DK6A 2Y4IC 4GIHA 1DI8A 1E1VA 1YOMA 2X6DA 2YIRA 3TKUA 4FT9A 1X8BA 3PSBA 4Y72A 3MH1A 4A9YA 4G3FA 4MNFA 5FM2A 3S2PA 3S3IA 3DZQA 4CVAA 3DFAA 5L2WA 3ROCA 4CRSA 2YM3A 4LV5A 1YDTE 3E63A 5M51A 3ORIA 5IQAA 3O23A 5EM8A 4EBWA 3UQCA 1Y6AA 5EKNA 3OWPA 2Q0BA 4FF8A 4KB8A 3DXQA 4OGRA 5HCXA 1KV1A 3C0HA 3DKFA 4RJ6A 3OW3A 1ZY4A 3F7ZA 3MA6A 3DKGA 4JT3A 3Q53A 4LQMA 4ANOA 4FKQA 2IZUA 1GY3A 5GZ9A 2VGOA 1REJA 4YHTA 5HBJA 4DTAA 4C61A 2ZV9A 5D7AA 4DGMA 1Y8YA 3G6GA 3ZLSA 4CZUA 2HXLA 3KVWA 1YI4A 3MFTA 5CI6A 2RIOA 4FZAB 1CKJA 2J0KA 5G6VA 4ZP5A 3RNYA 3D9VA 1I09A 3Q96A 5HGIA 3HV3A 3B8QA 5CAVA 5DMZA 1LPUA 1NT2A 3UP2A 1H00A 4CG8A 2XNMA 4UMUA 3DJ5A 1PY5A 5E90A 3SRVA 5IA3A 1TKIA 4ORKA 4Z55A 3HAVA 2CKPA 5I3OA 5DT4A 3PA3A 2R2PA 4G3GA 4DH8A 4E6CA 3PVWA 4BZDA 5M07A 2WOUA 1Q8WA 3BLRA 3Q60A 4I0SA 4XCUA 3VUGA 4FV4A 5J5SA 5LMKA 4EJ7A 3QD2B 2IVVA 2HOGA 4C59A 3O50A 1ATPE 3UPXA 1NA7A 4R5SA 4XS2A 2Z7QA 4RX5A 4I20A 4U43A 4YJPA 4O7RA 4FV8A 5I9YA 2YCFA 3DQWA 3ZTXA 4H58A 4EEVA 4HGSA 3KN6A 5IEVA 3EL7A 4C3FA 4FL1A 3FJQE 3F69A 4ACGA 3QQFA 4FSZA 1Q5KA 1UA2A 3BLHA 3DAJA 1Q8YA 5BVKA 3FYKX 5F94A 3OD6X 1H1SA 3A7GA 2GNJA 3R2YA 4O82A 4JR7A 1XH4A 3SXFA 3R04A 5GIOE 1OMWA 4YLLA 4PPBA 3ZSGA 5IUGA 4TNBA 4PTEA 3U51A 5HX6A 1JBPE 5C8MA 2YCQA 1H08A 4ZSLA 1SNUA 3QXOA 4G6OA 2A27A 4WG3A 5AUXA 4UMQA 4NJDA 4X0MA 4F6WA 4YPSA 2CNUA 4KWPA 4IM0A 2JITA 4V0GB 5CYIA 5JFWA 3ZM4A 3I1AA 3VS2A 2B9IA 2BROA 4IE9A 4RX7A 4QP9A 2EXMA 2W4JA 3F5PA 4UV0A 3R9DA 4CRLA 4BTMA 4DGNA 2G2FA 3NRMA 3RHKA 4EC8A 3OP5A 4X3FC 4U5JA 4W8EA 4ZY6A 4GCJA 3R9NA 2IZRA 4BDCA 5IA0A 4FKOA 1OIRA 3EFJA 3GU6A 1IEPA 2YWPA 3QTIA 4ITJA 4FKSA 2B54A 3T9TA 4IM3A 2G1TA 4IVAA 4JBVA 3HZTA 3OWKA 2C6KA 3SW7A 5T68A 2QOFA 5EI2A 5A6OA 4RMZA 3R00A 3PY0A 3WARA 4HVDA 2BZIB 5A6NA 2PSQA 5GHVA 4FTTA 4YZCA 4D9UA 5LVOA 4RGJA 4LM5A 2FO0A 4GYIA 1UNLA 4JBPA 1ZOGA 4BBFA 2R3FA 2XA4A 4TT7A 5K0XA 4GU9A 3QCXA 5CSHA 5JRSA 4CTCA 1R78A 3UZTA 5L2IA 3RCJA 3N4TA 4YGAA 1TQMA 4NKSA 4AAAA 2EXCX 4ZTNA 4FTCA 3O7LD 4H36A 4FGRA 3Q4ZA 5F4NA 1G5SA 1FPUA 1S9JA 2C5VA 3QKKA 4EQMA 3F61A 3UIBA 3H4JA 4XMOA 5JZNA 4NM0A 1IG1A 5CEKA 5EH0A 4N70A 2HWOA 4ZSAA 4R6VA 4FL3A 5HESA 4L3LA 3TNIA 4IAAA 4S30A 4DINA 3R9RA 2VU3A 4KIPA 1TQPA 2NNWB 3WI6A 5HE3A 2G15A 2XCKA 2C6IA 5C4KA 5L2TA 4HVIA 2IVSA 1B39A 4XBUA 1RDQE 4NIFB 2ITNA 4XEYA 4BCMA 4X6QC 5CF6A 4DGLC 5AR4A 2ERZE 2BIYA 2B0QA 4D5HA 3NX8A 3GU5A 4Z3VA 2GU8A 4H3QA 2UZUE 3CBLA 3JR1A 4EK4A 4U44A 2CN8A 3NDMA 5ANEA 2WMTA 3FSKA 3PP1A 4BTKA 4IZAA 4G16A 1ZMWA 3TZMA 5KMJA 4H05A 3VUMA 3N51A 2C3JA 4FKLA 5CANA 2W05A 3L8SA 4EKLA 4KD1A 3HA6A 2A4LA 2BTRA 5HG5A 4LGHA 3FKOA 4O0TA 3NUNA 3OWLA 4IWPA 2IW8A 4FNZA 4AN9A 3N4VA 3EH9A 3P9JA 2AC3A 2GFCA 3NWWA 3HAMA 5E8YA 2GFSA 2FSLX 2X6EA 3CJGA 4BHNA 3IDPA 4BRXA 4EH6A 3OMVA 1XJDA 2CKQA 3KXNA 1XH6A 1I44A 3K3JA 4JLCA 1ZYJA 4FUYA 2YLEA 3ACJA 3V3VA 4QMNA 3FMMA 3GU8A 4FVPA 4QPAA 5EOLA 3IDCA 3QQUA 2ZYBA 4ZLZA 5JK3A 4DGGA 5GZAA 4BKZA 3SHEA 2CKOA 5J8IA 3PTGA 3KU2A 3CP9A 4NW6A 4YC8A 4B8LA 2W4OA 3EWHA 1DAWA 4K77A 3FY2A 2WOTA 2X1NA 3Q9XA 5ACBC 4E8AA 4EK3A 5IQDA 3S1HA 5HX8A 4LOPA 2UW5A 3ZSIA 3HUBA 3ZO4A 4L8MA 4L45A 5DEYA 4I6FA 3R7OA 3FXWA 4I4FA 3RALA 3O8UA 4QMVA 1WAKA 4OR5A 3MVLA 2OSCA 3AC8A 5HOAA 3UG2A 3LCKA 4FKJA 2C69A 3PVBA 2F57A 2QR7A 4ZXTA 4AFEA 3A7FA 3Q3BA 4YU2A 5FXQA 4Y5QA 5H2UA 3MV5A 1ZYDA 3C4FA 4U80A 5HD7A 1PF8A 5HICA 3H0ZA 3FYJX 4PWNA 4O0VA 1AD5A 4CEGA 2HZ4A 3CLYA 4QP4A 4QQ5A 5HG7A 1H1RA 3BQCA 4AZEA 5JT2A 3V5QA 3FZTA 5E8ZA 1YDSE 3F6XA 2PVLA 2BRMA 3A7HA 1TQIA 2P55A 3KMUA 2I7QA 4ALVA 2HIWA 4U41A 5IUHA 2PVFA 4ZTRA 1JSTA 4I22A 3RI1A 2E2BA 1JKKA 3DK7A 1XBBA 3RTPA 2UUEA 3DBFA 3WF5A 3LFQA 3F3TA 1R1WA 4L67A 1M14A 5EW9A 3RAHA 5AAEA 5CF5A 5IQGA 5ETIA 4BCHA 5CAQA 5IQBA 2FVDA 3FHIA 4WD5A 2VTHA 1GAGA 5FEQA 5GZ8A 5BVOA 3PRFA 3A8XA 2IPXA 5E8WA 2W1CA 2ITXA 4RC4A 5ETFA 5DBXA 4EZ7A 5IISA 1UV5A 2O0UA 4IAKA 3W8LA 4BFMA 3TIZA 1UNGA 4DH1A 3FWQA 4ZJIA 4EBVA 2F7EE 4FYOA 1XKKA 2BCJA 3F88A 3QTQA 4HCUA 5DR2A 3EOCA 2W9FB 3TZ9A 1JKLA 3BX5A 1GJOA 5L6PA 2JBPA 3FDNA 3R1NA 4YO4A 4DLIA 1A06A 4MBLA 4KINA 4YTFA 5KHWA 3E3BX 4BY9E 2Z02A 3UTOA 1WMKA 3ZUTA 3LQ8A 3MJ1A 2DYLA 3AT3A 3UVPA 3ZO3A 3BHUA 5JZJA 1NW1A 4O81A 1R0EA 3GCVA 2A1AB 5EM7A 4KS8A 3P23A 2C6TA 3IS5A 2OXDA 3LJ0A 2C47A 4NM7A 3DBEA 4JAIA 1W84A 5KMOA 5LMBA 3E3PA 3LM5A 4GVJA 4FTIA 5AUZA 2W1IA 2J0LA 3EYHA 2VUWA 4FIHA 4GS6A 4L3PA 4U40A 3MPAA 4UXLA 5ETCA 3V5TA 5ANDA 4EHGA 4PMMA 2VWWA 4BR3A 2UZOA 4CMTA 2FSMX 3PIXA 5JRQA 2HY0A 3FE3A 4PL5A 4P7EA 4L46A 3QD0A 5AP5A 3LFCA 4GK4A 3HRBA 3PRIA 4AZSA 2R3PA 5KX8A 5CNOA 2YHVA 3D4QA 2BAJA 3R63A 5CSWA 2IVUA 4QMYA 3OY1A 2P2HA 3R8UA 4EWHA 5IH4A 5EK7A 1Q24A 2PZYA 4MXCA 2QCSA 2X2KA 2VTPA 4JVGA 3F2RA 5JKGA 4C4EA 3HRFA 2JIUA 3IKAA 4AE9A 5A14A 3K5VA 3IOPA 4A06A 4ENXA 3KULA 3QU0A 2WMXA 4MQ2A 4PNIA 4U42A 3FL4A 4V01A 5DR9A 4J53A 4ACHA 4D4SA 4HGTA 2ITVA 5FEDA 3GC8A 4JXFA 4XV9A 1VYWA 3L8XA 3C4WA 4RQVA 4I24A 1UU3A 1HCKA 1K3AA 2QKRA 4S2ZA 3FLSA 4FKWA 4DCAA 3AC4A 3OBGA 4W4WA 3FXZA 3UOLA 3ZFXA 4NYEA 3SD0A 5T6KA 3QWKA 1M7QA 2OZAA 2WMAA 3C4XA 3C1XA 3MIAA 4E5BA 4CKJA 2C5OA 2BZKB 4IVDA 4CV9A 3EN6A 2HELA 4OTWA 4QYHA 4DH7A 3WYYA 3SVVA 5HCZA 4YC3A 3BELA 3PPKA 4ITIA 4QMQA 3WYXA 3I79A 3QQJA 5J1VA 2YM6A 2WFYA 3Q9WA 4Q9SA 4DITA 5IKWA 2V7OA 5M4IA 1UVRA 4O0YA 5AUUA 2X2LA 3FPMA 3EN4A 3HP2A 4IDTA 1PYXA 4PTCA 4WA9A 2JKKA 2PVNA 5AEPA 5KBRA 4E73A 1PHKA 4CZTA 5CAPA 3R8VA 4QNAA 1H24A 4WNPA 3BYUA 1LR4A 1XO2B 4K2RA 2R5TA 5CT0A 4BC6A 4ZLOA 3ZRMA 2Q0NA 2WTVA 3LIJA 3ZO1A 5DN3A 5J7HA 2PULA 2YA9A 3DTWA 4P5ZA 1M7NA 4L7FA 2JDRA 1KWPA 5HO8A 4BI1A 2PUPA 3LMGA 3W2OA 3R1QA 5FP6A 2O8YA 2VO7A 5CAOA 2W17A 3CE3A 4PX6A 5FM3A 2CGWA 3NCGA 4IWDA 5J87A 3W10A 4EJNA 5M56A 3D7TA 3GI3A 2HYYA 3D5WA 3R73A 5CZIA 2XB7A 1RQQA 3F5XA 4C0TA 5KE0A 5ITAA 3MJ2A 3EFWA 3EJ1A 3V5LA 2PZPA 4D1XA 2WXVA 4AN2A 4O2ZA 1JVPP 3RAIA 4CYIA 2BRHA 3TN8A 3OW4A 4JOAA 4ACMA 3OXZA 4QMPA 1O6LA 4QMSA 2R3QA 2ZV8A 3DTCA 3E93A 4L42A 4U3YA 4JL9A 5AP3A 3W55A 4MXOA 4D0XA 4F9CA 4EUTA 5HLWA 5IZFA 3BV2A 3LFNA 2XF0A 5JGDA 3VW6A 5KBQA 5CVGA 1M17A 4ANSA 4CMOA 3ZC5A 4X2JA 5H9BA 4AZVA 2BFYA 4FV3A 2XNOA 3QALE 2PHKA 4QMWA 2C1AA 3P5KA 3PSDA 4IHPA 2YISA 4G9CA 4ANBA 5CF4A 1LEWA 3GT8A 3PXKA 4IAIA 1CKPA 4ZK5A 3MY0A 3R2BA 3TZ8A 4BDAA 5BX0A 5BVFA 4DBXA 3VAPA 5A4CA 2GHMA 3EZRA 4EQUA 1YRPA 3AD5A 3HV4A 3VF8A 3FLNC 3RM7A 1O6YA 2XIYA 3CTHA 3ORMA 4XLIA 5D9HA 5HNBA 1PMEA 2ITOA 3P08A 4M68A 3OZ6A 4FEQA 3TTJA 2I40A 2XCHA 5LXMA 4KKHA 3BZ3A 4FEUA 4WKQA 2C6EA 4N4SA 4AFJA 5DVRA 5EI6A 3PPZA 3VWAA 2OZAB 3DOGA 3ODZX 4KAOA 1GZKA 4M84A 4MXYA 2WEVA 4RJ5A 5D1JA 2QVSE 3A60A 3PFQA 4F08A 3I6WA 2W06A 2YM8A 2ZVAA 5AM6A 2SRCA 3SOAA 3RJCA 3C5UA 4IAYA 5FBOA 1ND4A 3GC9A 4TXCA 4Y83A 2OJGA 3FMJA 3QUDA 4PDSA 2OF2A 5DT0A 3KXHA 4IJ9A 3KF4A 4TYIA 3RP9A 4EH2A 1PJKA 5L2SA 4BZNA 3QQGA 2ZMCA 3QKLA 5DFPA 4WHZA 5AP2A 3VF9A 2J5FA 3TIYA 5JH6A 2ERKA 4IZYA 4AZWA 3QRJA 4FT0A 4G3CA 5HIDA 4CKIA 4BL1A 1WBOA 4LV8A 4GEOA 2W96B 2Z7SA 3KK8A 4L9IA 3R7UA 5LMAA 4XHKB 1U54B 3TJCA 3LXLA 2Y8OA 4AGUA 4G5JA 3LOKA 2VO6A 2BHHA 3S0OA 4O84A 2YM7A 3HGKA 5AV4A 1RJBA 3NUSA 4TWCA 5ANIA 3H9RA 4JX3A 2W1GA 2YJSA 5A3XA 1H28A 5JEBA 3NLBA 4J71A 4OTFA 4ZY5A 2W0JA 3NS9A 2RG6A 4X3FB 4LRMA 4B8MA 4BCKA 2HW6A 4NTSA 3RAKA 3S4QA 1P4FA 3R30A 3WE8A 1UKHA 5D12A 4FT5A 1XWSA 4R3CA 3IG7A 3LAUA 2RF9A 5J7BA 4BBMA 3QGWA 4Q2AA 2H9VA 4L52A 5CQWA 3AGLA 1GIJA 4AOJA 3RAWA 4OTIA 4LRJA 4F9YA 4QP3A 3T3UA 3GQIA 4IZ5A 4RX8A 4TZRA 2PUUA 5L4QA 4FV2A 2I0YA 2JIVA 4ZS4A 4QT1A 4O7LA 1GIHA 2NRUA 4TWNA 5LVNA 3L9MA 2KULA 4YHFA 2X7OA 5T3QA 4FKGA 4FMQA 4I0TA 5BMSA 4EZ3A 4FODA 2QOIA 2ZAZA 2O5KA 4USDA 4HVSA 2G9XA 2VTRA 5I3RA 3ZLWA 2YIWA 5LWNA 3MESA 3OOGA 3C4ZA 4N6ZA 3ZYAA 2BPMA 4BYIA 5I0BA 5F9EA 1J1CA 4QP8A 5M08A 1U5RA 2E9PA 4L3JA 4MNEB 3ZCLA 1JWHA 1OIYA 2J50A 3SDJA 1ERKA 3KGAA 3MY5A 4GFMA 4X21A 4ZJVA 2HY81 2B1PA 3PA5A 3MVHA 3V5PA 4UZDA 1OPJA 3KCKA 4GFGA 4IX3A 1U5QA 3DB6A 4LL0A 4O83A 4BDKA 1FGIA 4NM5A 3IW6A 3JUHA 4TYEA 2PVRA 4BCNA 4OTQA 3FZOA 3ZFMA 4CKRA 5CQUA 3BGPA 1OGUA 4S34A 4FL2A 4PDYA 2GSFA 2PE2A 2REIA 3UOHA 4O7VA 3P1AA 4XLVA 3RCDA 4BZOA 3ORZA 2JDOA 4RC2A 3QFVA 3ZXZA 3WIGA 4K11A 4DG0E 5CXZA 3PUPA 5DE2A 2XM9A 3WILA 3NPCA 4RJ4A 4ERKA 3EMGA 3G6HA 5HLNA 2C5YA 5L8KA 4J95A 3TUBA 2JFLA 4P5QA 3MFRA 2WTWA 3AT2A 2C0TA 4FKUA 3U9NA 4DE4A 5KZIA 2OH0E 4F70A 4LUEA 5B2MA 4IEBA 2UZWE 3B2WA 2BALA 3PIZA 3P4KA 3UO4A 1V0BA 1VZOA 3FKNA 4YJSA 4FTRA 2XRWA 3ANQA 5LOHA 4JDKA 2JDTA 5IMEA 4APCA 5CVHA 4IC7A 2W1ZA 4V05A 4FKTA 1P4OA 3IOKA 1Z9XA 5FTOA 4EC9A 2YAAA 3BQRA 4XX9A 1U54A 2E9UA 3OEZA 2OKRA 3R8MA 2PTKA 4RIOA 2JDVA 4RRVA 4XUFA 5H8GA 1WFCA 2YZLA 1P5EA 4L01A 3QZHA 4NT4A 3BU3A 4FSQA 3R7VA 3EFLA 3VNTA 3LCSA 3COMA 2XRUA 5B7VA 4JAJA 4JQ8A 5B2KA 2GQRA 2YERA 2BDJA 3R8ZA 2PYWA 3VS3A 1Q4LA 4PF4A 5HTCA 3O51A 2ITYA 2XEZA 2X7GA 2C0OA 3B8RA 3Q5ZA 4FIGA 4GK3A 3U6HA 4MXAA 4UWYA 4X2FA 3F3UA 4DGOA 4IACA 4YZ9A 3VULA 2R3NA 4IH8A 2C1BA 4ZLYA 2YWVA 3EQFA 2QO7A 4DBNA 3JY0A 3TEIA 2FSOX 4UWCA 2YIYA 4MX9A 3CD3A 3LLTA 1BLXA 3CIKA 3QHRA 1OL6A 3UMWA 2P4IA 4KSQA 3QRTA 1PKDA 4E93A 2GNFA 4USFA 5JQ8A 3VBQA 1URCA 1XBAA 3I5ZA 4XG7A 4NFMA 1VYZA 5HG8A 5K0KA 4XG8A 2QQ7A 4DH5A 2YITA 4XP2A 3GNIB 4CT1A 2ZB1A 1ZZ2A 2GDOA 3P0MA 4G3EA 4UYNA 4PDOA 3BLQA 1REKA 4R77A 3HLLA 2HAKA 3MBLA 1OL5A 2WQNA 4FV1A 3LW0A 3RBWA 4DN5A 1VR2A 3D94A 3SQQA 1B6CB 2WMVA 4IANA 4Y95A 2ETMA 1APME 4AUAA 4TYHA 3BE2A 4S33A 3TNWA 2QOBA 4RA5A 3ERKA 2R3RA 2PVMA 4C35A 4KBAA 3BYMA 5FG8A 4DT9A 3RVGA 4FTLA 5GIPE 4TY1A 4BCIA 4OTHA 4ZSEA 4AN3A 4EI4A 5IDPA 2GQSA 3R9HA 4YURA 4W4YA 1PKGA 4C3PA 2R3GA 5M55A 2FA2A 3KKVA 4UN0C 3DBDA 3KRWA 1OM1A 5E4HA 4FVRA 2FYSA 4UB7A 5C01A 3VN9A 1UU9A 4C34A 5K4JA 3WE4A 2Z2WA 4KABA 2G2HA 3KVXA 1ZOHA 3V6SA 4L00A 3F7WA 4IAZA 5DR6A 4D55A 5CU6A 2F7XE 4QTEA 3VJOA 2R0UA 2W9ZB 4PPCA 4CCBA 4CLJA 4BDHA 4D28A 4J8MA 4ZIMA 2CCIA 4C8BA 2R3IA 4XP0A 4YC6A 5HG9A 1YI6A 3HDMA 5M4CA 4APPA 2VNWA 4FKPA 2ITWA 4RWKA 4RWIA 4BTFA 4JDHA 4MD8E 3RWQA 4G6NA 1JKSA 3UP7A 3W2RA 4ZAUA 2C6DA 4R1VA 5KO1A 4OTGA 4FTQA 3CD8A 2YLFA 4RLKA 2PZ5A 2GS7A 2WO6A 4E3CA 2P3GX 1H25A 4YSJA 4IVBA 4QMTA 4DFLA 2EB2A 4XG9A 4DEBA 3LE6A 3Q52A 1R3CA 3KC3A 2DS1A 4AW1A 5E8UA 2DUVA 3VHEA 4NCTC 3BYSA 3Q2MA 2CCHA 5EM6A 3TM0A 3A61A 3L8PA 4RG0A 1PXMA 5BPYA 3WBLA 5C27A 4EONA 5DOSA 4IB1A 3NZ0A 5IU2A 1FGKA 4HYSA 4ZEGA 2GHLA 4ERWA 5KKRB 5CNNA 5DPVA 2QI8A 3GB2A 4YTIA 5DT3A 4JG8A 4RWLA 5I9ZA 2PPQA 5AIKA 2ONLA 3OXIA 3R28A 4RVTA 1YKRA 4ZTSA 3IW5A 2V7AA 4I92A 3VUHA 4HYUA 2F7ZE 5GJFA 3Q6WA 3PE2A 4BCQA 3I0OA 3V51A 5HTIA 4Z7HA 1PXIA 5M53A 5LVPA 3QCSA 5CZHA 4FNXA 4C57A 5D10A 3TNHA 3QL8A 3LFEA 5EHLA 2XEYA 3NW6A 2WAJA 4D4RA 2XH5A 3QTWA 3SAYA 1J1BA 5AADA 4OAUC 5HO6A 5HBEA 1WVWA 3KF7A 1YHVA 4WG4A 2XNGA 2GPHA 2HENA 3UO6A 4F7NA 3ORPA 3MTFA 4FBXA 4R5YA 1WBPA 2VTTA 4C62A 4LOQA 4QP6A 5TF9A 1F5QA 2Y4IB 3VBXA 4BGGA 4RFYA 5FTGA 1H07A 3E8DA 4TYHB 3PXRA 2OBJA 4CFNA 2XZSA 3HV5A 2A2AA 4NEUA 3WF9A 2QG5A 4JRNA 4D2WA 3EQGA 1ZRZA 2VTMA 4XBRA 4BCFA 4YO6A 3DAKA 5FUTA 3E7VA 2NO3A 2W5BA 4AG8A 3KRXA 4BWKA 5DYJA 3FMKA 1UU7A 2CN5A 2XK6A 2VD5A 3OFMA 4GSBA 5CY3A 2UW6A 3K5UA 3VS4A 4ZTMA 5FEEA 2JDSA 2PVHA 2XKCA 3FMHA 3U6IA 4C4JA 4NJ3A 4A9UA 4AW0A 2C30A 3COKA 3DK3A 5EW8A 4A4XA 4UALA 2QLUA 4WUAA 4X2NA 3SOCA 4AZFA 2ZM4A 4BDFA 3P86A 3PZHA 4BCPA 4AA5A 3ULZA 1YXXA 5J9ZA 1U4DA 2VTNA 3Q4TA 4U8ZA 4L44A 3DU8A 5AP7A 3ORXA 3MA3A 4ITHA 5DG5A 4BB4A 4FEWA 2BDWA 3VQHA 1A9UA 3G51A 3NNUA 3EQPA 2XS0A 2Y6MA 3GUBA 3ZONA 4Q9ZA 5IQEA 4IWOA 3CC6A 3VW8A 4WNKA 5EDQA 2B9FA 3HUCA 4J96A 2V0DA 3O96A 3TV6A 4DFBA 5ANGA 1CTPE 2C6OA 3QA8A 3FQSA 4HPTE 5K5XA 5M57A 1WBVA 2OXXA 3TDWA 2W4KA 3RPRA 3MY1A 5HHWA 3VUIA 3NNXA 5CSVA 2BIKB 2JBOA 2BAQA 4O0SA 2H96A 3QZIA 4DFXE 3IGOA 4FZFB 5EHOA 2B53A 5CEIA 3ZSHA 3BBWA 1BYGA 3QQHA 4EOLA 4WRGA 3PPJA 4AF3A 4EZ5A 3TT0A 4PPAA 5ACKA 3R9OA 2J9MA 3R22A 3P78A 3QQLA 2BRBA 2JIIA 3LJ1A 4TN6A 2VWZA 1MRVA 2J0MB 3C7QA 5F95A 4F0IA 1MUOA 3PXQA 3VO3A 5GJGA 2PUIA 4FIEA 2XUUA 5IQHA 4IQ6A 4KA3A 3OUKA 4BF2A 4X2GA 5CTPA 4BWXA 3QYWA 4DG2E 2UZTA 4F9AA 4PRJA 3Q5IA 4LOOA 4K0YA 4BDIA 5A4QA 1IA9A 3G90X 1OKVA 3KXGA 3GC0A 5IEXA 2WMWA 5DHJA 1K2PA 3QHWA 1CM8A 3UG1A 4I5CA 4C58A 3BHTA 2OLCA 2WMSA 2I1MA 2YAKA 4PV0A 5HIBA 3SV0A 3UVQA 3OWJA 5E92A 3ZEPA 3I5NA 1FVVA 3L1SA 4GU6A 4QQCA 2WB8A 3FI2A 3NNWA 4Z7GA 2YFXA 2HZ0A 3CY2A 3RHXA 2ONLC 3NSZA 2DWBA 3VS6A 5CEPA 3GOKA 4DLJA 2YZAA 4O22A 3C51A 4FSNA 3DDQA 1YWNA 3FKLA 4CFFA 2R7BA 3MFSA 4O7YA 1HCLA 5DIAA 5CWZA 3UOKA 3FSFA 4NU1A 5E8VA 4GT5A 3QA0A 1KV2A 1Y6BA 3O71A 3TDVA 4AT5A 2ZV2A 2VWVA 1KE9A 4K8AA 3F3ZA 3EHAA 4N6YA 4YTCA 2X8EA 3ZZEA 3VRYA 4O1PA 1DS5A 4YBJA 1OB3A 2XJ1A 4RC3A 4A9SA 3P7AA 2UZVA 3CQUA 2O3PA 3RPSA 3PVUA 3Q2JA 3OXTA 4MYGA 5AX9A 2X81A 2OGVA 5DH3A 4LGGA 4DC2A 3QX2A 4K9YA 4QO9A 4QTCA 4KRDA 2ZDTA 2J90A 2V5QA 1JOWB 3GBZA 3ZU7A 2XKDA 3CQEA 4C38A 5J1WA 3IW7A 4FZ7A 4S31A 1Y8GA 4RIYB 3WZDA 4RIXB 4JQ7A 2WTIA 4F4PA 3KXMA 2VAGA 3HEGA 5FBNC 2O64A 2YABA 4TYGA 4QPSA 4K33A 1YWRA 3QUPA 3S95A 3T3VA 4MKCA 3DS6A 2HZIA 1M2RA 5TOZA 4M97A 3QX4A 3D0EA 2QG7A 3QKMA 4RIWB 4IW0A 2QOOA 2YDIA 3BWJA 2VV9A 2VZ6A 2BUJA 1OPKA 3AMAA 3SKCA 5HNIX 3A2CA 4KKEA 2I0VA 1K9AA 4XOZA 1CKIA 3QZGA 3R8PA 2OIQA 3DGKA 3AC3A 3DT1A 3OT3A 5IQCA 4N57A 3UBDA 3FI4A 4A4OA 1H1PA 3VS7A 4G31A 4G2FA 5A9UA 4AQCA 1OKYA 3LXNA 3FQHA 4AA4A 3L9PA 5BVDA 5BUEA 4O7SA 4EK5A 1O6KA 4RA4A 3V04A 3U4UA 2GTNA 3HV6A 4C4IA 2AYPA 5K3YA 3BHVA 4BN1A 1OIUA 1PMNA 3SXSA 3AC5A 4E4LA 1TVOA 3FPQA 2F2CB 4ID7A 5JMSA 3R0TA 1MQBA 1WVXA 4JJRA 4AE6A 4DG3E 1YXTA 3RGFA 4AX8A 4UWBA 3AD6A 2IJMA 1GZNA 3PJ2A 5LCKA 4WT6A 3WIKA 4LUDA 2C6LA 3I7BA 1HOWA 4UXQA 3R02A 4AT4A 3ORNA 4R8QA 5JFXA 2QHNA 1OPLA 3OROA 2PY3A 4F7SA 1OI9A 5F1ZA 4EYJA 2X0GA 5DEWA 1ZOEA 4CTBA 2J5EA 3E8EA 4BVUA 2PVJA 4GUBA 3ZRKA 3OT8A 5LVLA 3VS0A 3ACKA 3GFWA 1J7IA 4TL0A 4UMRA 2RGPA 1ZAOA 3FI3A 2V55A 3KXZA 4MCVA 2PUNA 3EQDA 4FR4A 4DEEA 4FGBA 4QTBA 3BU6A 3UOJA 2Y4PA 4HNFA 4U3ZA 3BPRA 4FZDB 4FSMA 4YJNA 4LFIA 4FI1A 3JPVA 4YPDA 3U9CA 1YOJA 2WGJA 4QOXA 2BVAA 3MH0A 4H1MA 5HE2A 2VO0A 4MAOA 1Q8ZA 2QD9A 3T9IA 1OKZA 3MTLA 5HQ0A 1Q97A 4BHZA 4UYAA 3FV8A 4EH7A 4BIBA 1YVJA 3ATTA 4JDJA 1XH5A 2B9HA 3QF9A 4D4VA 4GT3A 5KMKA 3LXPA 3LLAA 1WCCA 4ZTHA 5BYYA 2WU6A 1E9HA 2X2MA 2EXEA 5BMMA 4ZMFA 5JFSA 2PZIA 2XIZA 3C0IA 4XV1A 2P0CA 4IX5A 2B7AA 2NPQA 2HWPA 5IF1A 3NUPA 3D5UA 4PMTA 3DKCA 5AR8A 4I6QA 5HEZA 5AP6A 4ENYA 2IG7A 3DXPA 3CSVA 5HE0A 2J2IB 3C4CA 2BRGA 5ETAA 5JN2A 4IC8A 4D2SA 3W16A 5EQPA 5HO7A 1UWJA 3EFKA 5B0XA 4DA5A 3Q4CA 4B7TA 5ICPA 4OBPA 3A4PA 3NIZA 4WBBB 3TG1A 4R7IA 1MQ4A 5GJDA 2XIXA 3IW4A 4IADA 1SNXA 1YWVA 3OOMA 3PWYA 4X7QA 3SW4A 3KRRA 4LI5A 2W5AA 1Q8UA 3ALOA 3PYYA 4P2KA 3F82A 2LAVA 3U87A 4EQCA 1SVGA 3KRJA 4RT7A 1H1QA 3LFAA 3VQUA 5CU3A 2JKQA 5AV1A 1SMHA 5HORA 3A99A 5LVMA 2FSTX 4CSVA 3UQFA 3QLGA 3GVUA 4U97A 4EOPA 2F4JA 4EOJA 1J91A 3CXWA 1M2PA 2WTCA 2CMWA 2GCDA 3KCFA 1M2QA 1Q99A 5JGAA 2OIBA 2Z60A 4UX9A 2WMQA 2E9NA 3QLFA 2AUHA 5FP5A 1OKWA 3UJGA 3UQGA 3HX4A 3OBJA 4A9RA 5TKDA 5AIRA 2WTKB 3MH3A 4E26A 4H3PA 5FDPA 4OT6A 1WBSA 1ZYLA 5E7RA 3TKHA 4F1OA 2C3KA 4M14A 5A4TA 1BKXA 5EDPA 4DEGA 5KMMA 3AC1A 1IA8A 5KKRC 3EKKA 1IASA 1IAHA 3RPOA 1PW2A 4FYNA 5HNGA 4KKGA 3JYAA 4O6LA 3W18A 4UMPA 4FKIA 1YHWA 1SVEA 2IO6A 2XYNA 4FK6A 1W7HA 2PVYA 3D7ZA 2R9SA 3G5DA 2OG8A 3LCTA 3W2QA 3K54A 3OY3A 2UZEA 3C50A 4TRLA 4EK6A 3E87A 1LP4A 4BDGA 5HD4A 4W4VA 4GK2A 2VTSA 3NEWA 2OJFE 4YMJA 4YJUA 3HMNA 3W2PA 1QL6A 2QO9A 1GNGA 2QOQA 3MGYA 3EN9A 4IBMA 2IVTA 2ZOQA 5AP0A 1AQ1A 4C33A 2IW9A 4DFZE 3GGFA 3LZBA 3ZZWA 3I0QA 4DEAA 4P4CA 4RIXA 3ZUUA 5TR6A 4A7CA 4JQEA 4CFMA 5BVWA 4MF0A 1BI7A 4G5PA 4R1YA 1OZ1A 5IDNA 2FH9A 4F0GA 3UO5A 4MWHA 1FBNA 5BVNA 4O7WA 4HCTA 4WIHA 5AR5A 4CQGA 1H26A 3AD4A 4QTDA 4EOIA 3ZBXA 3BU5A 5D7VA 1J7LA 1PXKA 3O8PA 2FB8A 1XH8A 3II5A 3IK3A 4LMUA 4PUZA 2W1HA 4E4XA 1U46A 3MDYA 3V5WA 2QOLA 3FZRA 3ZXTA 3ELJA 4XG6A 3ZLXA 1ZWSA 2UW8A 4Z9LA 4CMUA 4DYMA 4M8TA 4YJTA 1V1KA 3GOPA 3O0GA 4BIDA 2JC6A 1ZZLA 4QMZA 3ZDIA 3K3IA 5AR3A 4ZTQA 4XH6A 4IM2A 2XK8A 3BI6A 3EQCA 2GTMA 3N9XA 4M12A 4QRCA 1CSNA 4O0WA 1V0PA 3ZRLA 4HJOA 4EUUA 2UV2A 4W9WA 3FC1X 4WO5A 3RWPA 3OHTA 3MPTA 4G34A 4QQTA 4I94A 5KCVA 5HI2A 5A4EA 4O2PA 4QMMA 4KIQA 3AC2A 2PL0A 5HIEA 5JGBA 2HW7A 3QTZA 4HZRA 4HW7A 3Q9ZA 1FINA 4U9AA 1ZYSA 5FXSA 1PXOA 4GUEA 5HTBA 5IEYA 4MH7A 3DKOA 1DAYA 4FKVA 4I1ZA 4P90A 5IA4A 2GNGA 4EOOA 4FSWA 5L6WL 3GCUA 4CV8A 3MW1A 4OBOA 3TI1A 2WIPA 4XYFA 5K9IA 3BE9A 4U7ZA 1Q61A 4H1JA 5I9UA 1PXNA 3U54A 3SX9A 4FEXA 4ZZMA 1W0XC 4AXAA 2VWIA 2OF4A 2BFXA 3PE1A 2YIQA 2J0JA 2YM5A 4JDIA 4QTAA 4A07A 5KMLA 2XYUA 2H34A 4RVKA 5GNKA 3NYVA 3VS5A 2QONA 3ZO2A 4CFWA 4NSTA 4CNHA 4FT7A 5CXHA 3JVSA 3V8SA 4K18A 1U59A 2ZM3A 3AT4A 2HXQA 3DBCA 3FLWA 4L6QA 4J52A 5CSXA 1H27A 2RL5A 2O63A 5CVFA 4D9TA 2VTQA 2PVKA 1NVRA 1XHAA 3PLSA 3HDNA 3SC1A 4M3QA 3TUCA 3NVKI 3R21A 3C9WA 4ZY4A 4ANLA 3HMMA 2OXYA 4AT3A 5L6OA 4GJ3A 1WBTA 3KXXA 4JIKA 3HMPA 3MI9A 3DY7A 2GS2A 4QP1A 3RZBA 3WZEA 5LJJA 2KTYA 4AW5A 2WTKC 3KY2A 4MK0A 4E1ZA 2R4BA 4J7BA 3R7YA 3NW5A 4FSUA 4L7SA 3IQ7A 5DRBA 3PJ8A 5BNJA 2ITPA 4BWPA 3AGMA 3BV3A 4BGQA 1LUFA 1JSUA 2UZNA 1Q3WA 3LCDA 3UNZA 2R7IA 5I5ZA 3I81A 4IAFA 1VEBA 1STCE 2GMXA 4Y5HA 4I93A 3ZEWA 5JQ5A 2A19B 5TT7A 4DAWA 1Z57A 5E1EA 4PP9A 4PP7A 2BKKA 3NUUA 3AMBA 1XH7A 4I0RA 4I41A 1UNHA 4WSQA 4E6AA 4Y8DA 3UDBA 1XR1A 4RSSA 3HMIA 1WBNA 3NVMB 3C13A 1KOBA 4O27B 3A4OX 2P2IA 5C4LA 1XH9A 3L8VA 3PY1A 2EB3A 2WU7A 2BRNA 3Q32A 2R0IA 3CGOA 3D83A 3TNQB 4BIEA 5JSMA 1OBGA 5EFQA 1P14A 3PLAE 2G01A 2OJIA 2XNNA 4D2VA 4EH5A 2ACXA 2OWBA 3G15A 2IN6A 3DPKA 4IJPA 4FIIA 3KK9A 3MFUA 4PNKA 3MN3A 1PXLA 2XK4A 4XJ0A 4YJOA 4FTUA 2XM8A 2XNPA 3ZLYA 3H0YA 4A9TA 2V22A 4YLJA 3BEAA 3QTXA 2XP2A 4XV2A 4W9XA 5CEMA 1Z5MA 1BX6A 4C02A 4PMPA 3FC2A 1FVRA 3QBNA 3FQEA 3FBVA 4ZSGA 1OL7A 4KS7A 3DJ7A 4GV1A 5EOBA 4G1WA 2YCSA 4M66A 3BRBA 3GFEA 4O86A 1MRUA 3TTIA 3D2KA 4BDEA 2X8IA 4AACA 2UW9A 5TO8A 3PIYA 3UIMA 3HVCA 1L8TA 2HZNA 3CR0A 1YXSA 4CGAA 2RFSA 2WMUA 2JLDA 1F0QA 3A62A 4IIRA 3DNEA 3RMFA 3DV3A 5D11A 4DTKA 4GG7A 2JD5A 2IW6A 3WOWA 4BCOA 3EB0A 2XBAA 4NFNA 1WBWA 3W2SA 2WTDA 3F3VA 5FLFA 4F0FA 4JS8A 3U55A 3ENHA 1KE8A 4ZJJA 3D2IA 1NXKA 3EN5A 5AUVA 1A48A 3M42A 4O0UA 4EORA 3SG8A 4ZZOA 1QMZA 5CU4A 5IH5A 3OCGA 3HECA 3PJ1A 5B2LA 3EQRA 3VC4A 4EKKA 3ZS5A 1JPAA 2UW3A 2UW0A 4J97A 4QMUA 3UMXA 4WRSA 4C7TA 3LQ3A 1JQHA 4BBEA 4EWQA 2ETKA 2OFUA 2ITZA 3UC4A 3QTUA 4LRKA 3O17A 5HU9A 2EVAA 4EYMA 2WD1A 3R01A 1UWHA 2E9OA 5LQFA 3JS2A 3QXPA 5C03A 1GOLA 2J4ZA 4E4MA 5C8NA 2R3JA 4QPMA 4AOTA 5I4NA 3CPCA 4JRVA 4RJ3A 3QAME 4FTOA 4DEHA 4YBKA 4YLKA 4NW5A 4CT2A 4I4EA 4ZOGA 4TKSA 4I5MA 2C68A 2YDKA 4QMOA 5EDRA 3VJNA 4B9DA 1SZMA 2CPKE 5KMIA 1RE8A 3DB8A 2YDJA 2Q83A 3OUNB 3WZKA 3KEXA 4C3RA 3SRVB 5E91A 3HL7A 2WPAA 4IWQA 5HU3A 2Z7LA 4RZVA 3D7TB 4ASZA 2OZOA 3QRIA 4QQJA 5EYKA 4HNIA 4EK8A 3W8QA 5AM7A 5IPJA 4FTNA 2WKMA 3NYOA 4J99A 2X7FA 1GZ8A 2C5XA 1ZY5A 2BAKA 2P33A 3EIDA 3DCVA 4U0IA 4BKJA 1WZYA 5CS6A 4GG5A 4I21A 2ZM1A 2FUMA 4FV9A 2GNIA 4YJRA 3T8OA 5A46A 2YCRA 4FEVA 3SG9A 3UODA 3W1FA 3Q04A 3BYOA 4GMYA 3AMYA 3POZA 4R3PA 2QO2A 3NGAA 4GW8A 4WBOA 4QYYA 5EYCA 4NL0A 5AAGA 4BCGA 3F5GA 1QPDA 3POOA 4QYFA 2CGXA 3ODYX 4O0RA 4E6QA 4CQEA 2BHEA 4RVLA 3ZHPC 2BR1A 4UMTA 3UIXA 4ARKA 3GCQA 3QC9A 3UIUA 4DT8A 5AAFA 4BCJA 2ESMA 4RJ7A 3V5JA 3PXYA 5EM5A 5IA2A 4GKIA 4GKHA 3CJFA 5IUIA 2HCKA 4L68A 2QR8A 2UZLA 2GQGA 4FNYA 4G3DA 3RKBA 4ACCA 4E5WA 4XG4A 3G2FA 1YI3A 4DFYA 2CLQA 3MB7A 3H9OA 1BL7A 4EHZA 2VRXA 5CEQA 4PL3A 3LM0A 2O2UA 2WIHA 1OVEA 2W1FA 4NWMA 3TKIA 2C3IB 2CKEA 2C0IA 5J95A 5EYMA 5KHXA 5KMNA 4O7ZA 3LVPA 2CNVA 3JXWA 3NNVA 3VS1A 4ALWA 4UY9A 2YN8A 3HMOA 3SLSA 5AUYA 3A7IA 3FAAA 4MVFA 2XJ2A 3HYHA 4BDDA 3VUDA 4F7JA 1Y57A 2VNYA 3F3WA 4ASXA 1H0WA 1WVYA 4QYGA 1YHSA 3O2MA 5CU0A 5F20A 3ZM9A 4RQKA 1G3NA 1H4LA 4LGDA 4O0XA 4Q5HA 4UBAA 5CX9A 3DXNA 3AG9A 5FGKA 3TACA 4CFVA 3KREA 4JX7A 3KMMA 4X6RA 1T45A 4E7WA 4K1BA 4NZWB 4C2WA 4IX4A 4CZYB 3CCNA 3I4BA 2CJMA 4J98A 4U6RA 4YZMA 3GCSA 3ATSA 5DWRA 1M52A 3I60A 4IZ7A 2CDZA 3LXKA 5LMKC 2JFMA 5K5NA 3CTQA 5AJQA 3NR9A 2C5NA 2ITQA 4XRLA 4PQNA 3SGCA 2RKUA 2IWIA 1YQJA 3R7GA 4ACDA 4M0YA 1JNKA 5DGZA 3OCSA 4Y85A 1RW8A 4NH1A 4A4LA 5HZNA 5KNJA 2E9VA 5HCYA 2YACA 5BUIA 4G9RA 5AV3A 4W8DA 2ZV7A 4AOIA 3P7BA 5CF8A 3CKXA 3LKMA 3OVVA 1GZOA 5AR2A 3WF7A 4XV3A 1W82A 3M11A 4NIFA 1KSWA 3BIZA 2EWAA 3V8TA 3BWFA 1QPJA 3QC4A 4M13A 4AS0A 4GL9A 4FA2A 3NUAA 3WZJA 5L2QA 4MXXA 5C1QB 4KRCA 4F1MA 2VTLA 2QOKA 5DNRA 3VBTA 4IB5A 3QCYA 2W5HA 4QP2A 3RK5A 3VHKA 4IB3A 5E8TA 4D2RA 3U6JA 4YJQA 3ULIA 3UZPA 2VX3A 2A0CX 4TTHB 4AA0A 5FTQA 3NUXA 3MB6A 3GU7A 5M09A 3DFCB 5IQFA 3M2WA 4TW9A 4D0WA 1W98A 2PE0A 4DTBA 3A7JA 3TL8A 4HZSA 4X3JA 3I7CA 4II5A 2Y7JA 4F9BA 4DF3A 4CFXA 2J51A 4TWOA 3QYZA 3VBYA 3FMNA 4E20A 5TE0A 4BI2A 4EL9A 4FKRA 3TZ7A 2JKMA 2W1DA 2XJ0A 4GRBA 2YM4A 3GENA 3PXZA 4IFCA 5HVYA 4FSRA 3OS3A 3HV7A 2R3MA 3RPVA 4FK3A 1NVSA 4FX3A 4E4NA 3A8WA 2UZDA 5HVJA 2BDFA 2YIXA 3C4EA 2R3KA 3P7CA 4FVQA 4AGCA 4F7LA 4H3BA 3DNDA 4DEIA 5C8KA 4YP8A 2CHLA 4MEDA 4MD7E 4C2VA 5EI8A 5JFVA 4FTMA 1BL6A 3FZPA 3QRUA 4KBCA 4HYIA 2J0IA 2WTJA 1R39A 3DJ6A 2VX0A 4G17A 4AU8A 4IFGA 2VWXA 4WOVA 2GNHA 3D5XA 3HP5A 4I23A 5D41A 5BQ0A 1DM2A 2B55A 4O7NA 1KE5A 4X3FA 4S32A 3F5UA 1BI8A 3FUPA 3CPBA 2NRYA 4I5HA 3S00A 4GT4A 2VX1A 4I3ZA 2H8HA 3ORTA 3F66A 1Q41A 4DEDA 3UZRA 4OT5A 2QC6A 2XKEA 1OIQA 2J7TA 2QLQA 3VBVA 5EQEA 3UGCA 2CLXA 3E88A 1EH4A 2CSNA 3FLYA 4D58A 5HVKA 5ANKA 3MS9A 3FLQA 4MF1A 3FZ1A 5LWMA 3E8NA 4FSTA 3ZMMA 3NAYA 1OECA 3QZFA 3OTVA 4OUCA 2XK3A 3GU4A 4QMLA 3EL8A 3W33A 3RK7A 2QODA 4YZDA 2XK9A 4UZHA 2WEIA 4HVGA 5EYDA 4EH8A 5I9VA 3RNIA 4RFZA 4F1TA 3LJ2A 5KZ0A 4RIYA 4K6ZA 2GNLA 2UVZA 3FEGA 5BUJA 5M4FA 2F49A 3N4UA 2VTJA 1PXPA 4MD9E 1FVTA 3ALNA 5HE1A 5AA9A 4RIWA 4NCTA 2XK7A 4XNEA 4C36A 4RVMA 2WQMA 4N0SA 3JY9A 3COIA 3BHHA 4CFUA 5AFVA 4GH2A 3KA0A 2BMCA 2XNEA 4EOMA 3U8WA 4O96A 2OI4X 4DCEA 2JGZA 1BUHA 4PL4A 3LMHA 4FG8A 3KQ7A 2PZRA 5CAUA 4XRJA 3GP0A 1NVQA 3ITZA 3REPA 4JNWA 4FE2A 2X9EA 1V0OA 4J1RA 2OH4A 4RJ8A 5FD2A 4D4YA 5KUPA 4L53A 4V04A 5I9XA 3AOXA 4PDPA 4FC0A 3E8CA 4F09A 4WG5A 4YTHA 4CXAA 4YZNA 2OW3A 5J79A 3PXFA 3LFBA 4YJVA 4KNBA 1XQZA 4PMSA 3NAXA 5HBHA 4YZBA 1URWA 2R64A 4JR3A 5L8LA 2R3OA 4ONAA 3BGZA 4O91A 4DH3A 4ZZNA 5J9LA 3FMLA 3QCQA 4YSMA 3UYTA 5CSPA 3PZEA 3W32A 1FMKA 4B6LA 4QYEA 3TCPA 4QMXA 1BMKA 2OIDA 2XBJA 3V01A 4FTAA 4ZMEA 2PWLA 4OTDA 1H0VA 3IW8A 2VTOA 3Q6UA 4E5AX 3DZOA 4GJ2A 2XVDA 1L3RE 3CTJA 3B2TA 3GXLA 4O7TA 5E9EA 5DA3A 3R7EA 3UC3A 3E64A 1KOAA 4TPTA 4MBIA 4O6EA 4AZTA 2VWBA 3LFDA 3VRZA 3RZFA 5CEOA 1B38A 3NIEA 3FXXA 2YJRA 4GVAA 1PRYA 5DRDA 1JKTA 3GQLA 3FZSA 4PTGA 4ZS0A 4B99A 3FMEA 4B0GA 3MWUA 2AC5A 2WQEA 1IAJA 2UVYA 5GINE 2JKOA 2WMRA 4F9WA 3LMIA 2EUFB 2OU7A 5CALA 3O8TA 1F3MC 5EKOA 2I6LA 3KULB 5K4IA 3BEGA 4BICA 3FHRA 4CG9A 3EN7A 3I6UA 4EOSA 4OW8A 1JLUE 3NW7A 4NK9A 3LPBA 1T46A 1G8AA 2Z8CA 4XG2A 2YEXA 4Z16A 1ZMVA 3E5AA 5AUTA 5M4UA 3UNKA 5E1SA 3VBWA 1S9IA 2OJ9A 3EQHA 4HCVA 4D2TA 3RM6A 3ZH8A 4YNOA 2HK5A 4MHAA 5J9YA 4ASEA 4BGHA 2PU8A 4RWJA 3WZUA 1CMKE 1IR3A 2B52A 3ZFYA 4GIIA 3CS9A 3DLSA 4LMNA 1PYEA 3ZC6A 3JVRA 4KIKA 3G9LX 2ITTA 2QU5A 4XP3A 3KN5A 5ANOA 4IDVA 4I6HA 2B4SB 3W2CA 4I5PA 1ZXEA 4FUXA 3M1SA 1MRYA 5E8XA 2I0EA 5BVEA 2VWUA 1PMVA 3R6XA 2ITUA 2Y6OA 3BYVA 4FZ6A 1OL1A 4F99A 5AWMA 3IPHA 4WNOA 3K2LA 3PP0A 3LCOA 4FIFA 3PY3A 3E7OA 2R3LA 3QTRA 4M69A 1VJYA 3PG1A 4QNYA 3U4WA 4IMYA 1UKIA 4HGLA 1H8FA 3G0FA 3H30A 4MXZA 3TJDA 4FOCA 2QOCA 3MVJA 4QD6A 2O65A 1KE6A 3EYGA 2NP8A 1FQ1B 3D5VA 3L9LA 3LFFA 2ZJWA 3E62A 4J8NA 4KSPA 4R3RA 5J5TA 4W4XA 4D2PA 4M67A 2Y0AA 1Q8TA 2UVXA 4H39A 5CLPA 1YOLA 5LARA 1JAMA 1H1WA 2QURA 3OG7A 5LCJA 2BILB 4MWIA 5A54A 4FSYA 2XMYA 2QU6A 4OLIA 3FY0A 3NCZA 3GEQA 3MVMA 1FMOE 3CKWA 3VVHA 2F9GA 3PDTA 1DI9A 3D14A 4M0ZA 2ZB0A 3ANRA 3KMWA 4GFOA 5AX3A 4JBOA 4BYJA 3KL8A 1J3HA 4RFMA 5CASA 2IZSA 3OEFX 4C37A 3ROYA 4HVHA 3QTSA 2X39A 3QRKA 3LFSA 3BHYA 1PMUA 5DI1A 5FWKK 3EZVA 5DLSA 3QGYA 3UPZA 3R8LA 4EOKA 1KUTA 3FI8A 4R78A 2JEDA 4NM3A 1IRKA 4D5KA 3QWJA 3QD4A 2J6MA 4HYHA 4OTPA 4CD0A 4XOYA 3IECA 4ANQA 4RZWA 4YUQA 4IB0A 5CT7A 1QPCA 2XKFA 3CY3A 4MBJA 3G0EA 4FT3A 3UVRA 1W8CA 3V6RA 1AGWA 2PE1A 3HA8A 3TV7A 4YNEA 5L8JA 1ZLTA 4FTJA 4FNWA 4BDJA 5I9WA 2OFVA 4B4LA 3DA6A 5AR7A 4RX9A 4HOKA 1GIIA 4FV5A 3DDPA 3AQVA 2X4ZA 2XIKA 3UE4A 2OK1A 5H8EA 3ET7A 1E1XA 4R7HA 3BBTB 3ID6C 5AV2A 1YXUA 5M06A 4AW2A 2QKWB 3F9NA 3NUYA 1Q62A 4C4FA 5HLPA 1ZYCA 4E6DA 2QNJA 3VUTA 1JSVA 4FV6A 4M7IA 2CGVA 4JG6A 5C9CA 4D1SA 4U79A 4XG3A 2JAMA 2V62A 2ZDUA 4Q5EA 3COHA 4I6BA 3IONA 2QHMA 4YR8A 2EU9A 3OC1A 4M15A 2WELA 4RPVA 3ZOSA 3C5IA 3DQXA 5CU2A 4CLIA 2VO3A 4IX6A 3TV4A 2G2IA 5AUWA 2RG5A 2WMBA 4EH9A 2VN9A 2WQBA 2GS6A 2PK9A 3LQ5A 2B9JA 3HKOA 4JI9A 1ZARA 4F65A 1SM2A 4U81A 3H10A 3BCEA 3OCBA 5AV0A 2X8DA 1SYKA 3ZUVA 1NY3A 4LL5A 5IH6A 3BKBA 2X4FA 4EOQA 2CNQA 2WZJA 2UZBA 2OICA 3EQIA 2RFEA 1W83A 3RK9A 3IGGA 3MYGA 4AWIA 4BKYA 5CI7A 3FMDA 1P2AA 4FG7A 3ORKA 4FOBA 3KFAA 5E8SA 2PMIA 1Y91A 1G8SA 3Q4UA 2Z7RA 2WQOA 4RLLA 4PY1A 5FDXA 3GC7A 4EH4A 4RBLA 3MIYA 4TYJA 5G1XA 4WNMA 5AP1A 5IMXA 2W7XA 3ZDUA 3E92A 3CGFA
chains in the Genus database with same CATH superfamily
5EG3A 3MSSA 4U45A 2BZHB 2RFDA 3MH2A 2WNTA 3NYXA 3DBQA 4FV0A 5AMNA 4C4HA 3D15A 2PMNX 2Y9QA 3SA0A 2VWYA 4ZSJA 3WF6A 3PG3A 3ORLA 1CDKA 4HPUE 3R83A 5FXRA 3IO7A 4OAVB 3H9FA 4QP7A 1OITA 3NYNA 1YXVA 4O21A 3QD3A 4EHEA 1R0PA 3V8WA 3ENMA 1SVHA 2RFNA 4BI0A 5L3AA 1QPEA 2H6DA 3VIDA 2BKZA 3G9NA 5FRIA 4CYJA 5AA8A 4DFNA 1PXJA 3EQBA 3DLZA 4KIOA 4FG9A 1OL2A 3VUKA 3ZBFA 4BTJA 5IA5A 4USEA 1ZMUA 4TWPA 2IZTA 4KUJA 4ZTLA 3GCPA 3F2NA 3TWJA 3UNJA 2PMOX 3PWDA 5M44A 4KIKB 1UU8A 4TNDA 1YW2A 1O9UA 4AGDA 3C0GA 4NUSA 2FGIA 4LYNA 3Q9YA 4OTRA 4FIJA 4EHVA 3TMOA 3NMUF 5EW3A 2WHBA 2QOHA 3F2AA 4DHFA 2X9FA 4F6SA 3R1YA 2R3HA 4NKAA 4F63A 4JIAA 1G8JA 5IG1A 1XBCA 4FV7A 1KE7A 4MNEA 5BYLA 2C6MA 4R7BA 2I0HA 4G6LA 4IXPA 5ANJA 2C4GA 2LGCA 4WSYA 1LEZA 2VTAA 4Y46A 3LHJA 3TUDA 3AXWA 1MP8A 3O5AA 2BZJA 3DAEA 3RPYA 3L9NA 2PMLX 3QUEA 3R71A 4LG4A 4DFUA 4M69B 5H8BA 3FLZA 3KB7A 3OF0A 2VGPA 2BTSA 3R7IA 3PJ3A 5AP4A 3HNGA 3CQWA 3WF8A 3KRLA 3H3CA 2F2UA 5H3QA 4C4GA 4D1ZA 2W1EA 4UEUA 4HGEA 5CENA 3G33A 1QCFA 2XIRA 3PSCA 4Y73A 4ALUA 3BGQA 4F64A 3PJCA 4F6UA 1J7UA 3O7LB 4JG7A 3TNPC 2ETRA 2GHGA 3RINA 5IQIA 3W0MA 3P79A 5BYZA 3TXOA 4ANMA 3UYSA 1YDRE 4IVCA 3OCTA 4OBQA 4AP7A 4EH3A 3R1SA 4FTKA 4ANNA 2RSVA 1OUYA 4AGWA 5A4LA 3ETAA 4L43A 1OBDA 4BDBA 3HRCA 3SXRA 4GYGA 3IDBA 4FICA 4NTTA 4ASDA 5HKMA 2UW4A 2OO8X 4O38A 4MQ1A 1OUKA 2XNBA 5IA1A 2C3LA 3FL5A 4CCUA 5FQDC 1FOTA 4V0GA 3CEKA 5EHYA 4X2KA 4WUNA 2ZMDA 3PVGA 3PA4A 2DQ7X 2UW7A 2VTIA 2OJJA 2W99B 3EKNA 3QQKA 5C26A 1Q3DA 4JBQA 4MTAA 2CGUA 3OTUA 4O1OA 5EQYA 1H01A 4KBKA 3THBA 3MPMA 2JAVA 4YHJA 3DK6A 2Y4IC 4GIHA 1DI8A 1E1VA 1YOMA 2X6DA 2YIRA 3TKUA 4FT9A 1X8BA 3PSBA 4Y72A 3MH1A 4A9YA 4G3FA 4MNFA 5FM2A 3S2PA 3S3IA 3DZQA 4CVAA 3DFAA 5L2WA 3ROCA 4CRSA 2YM3A 4LV5A 1YDTE 3E63A 5M51A 3ORIA 5IQAA 3O23A 5EM8A 4EBWA 3UQCA 1Y6AA 5EKNA 3OWPA 2Q0BA 4FF8A 4KB8A 3DXQA 4OGRA 5HCXA 1KV1A 3C0HA 3DKFA 4RJ6A 3OW3A 1ZY4A 3F7ZA 3MA6A 3DKGA 4JT3A 3Q53A 4LQMA 4ANOA 4FKQA 2IZUA 1GY3A 5GZ9A 2VGOA 1REJA 4YHTA 5HBJA 4DTAA 4C61A 2ZV9A 5D7AA 4DGMA 1Y8YA 3G6GA 3ZLSA 4CZUA 2HXLA 3KVWA 1YI4A 3MFTA 5CI6A 2RIOA 4FZAB 1CKJA 2J0KA 5G6VA 4ZP5A 3RNYA 3D9VA 1I09A 3Q96A 5HGIA 3HV3A 3B8QA 5CAVA 5DMZA 1LPUA 1NT2A 3UP2A 1H00A 4CG8A 2XNMA 4UMUA 3DJ5A 1PY5A 5E90A 3SRVA 5IA3A 1TKIA 4ORKA 4Z55A 3HAVA 2CKPA 5I3OA 5DT4A 3PA3A 2R2PA 4G3GA 4DH8A 4E6CA 3PVWA 4BZDA 5M07A 2WOUA 1Q8WA 3BLRA 3Q60A 4I0SA 4XCUA 3VUGA 4FV4A 5J5SA 5LMKA 3BL7A 3QD2B 2IVVA 2HOGA 4C59A 3O50A 1ATPE 3UPXA 1NA7A 4R5SA 4XS2A 2Z7QA 4RX5A 4I20A 4U43A 4YJPA 4O7RA 4FV8A 5I9YA 2YCFA 3DQWA 3ZTXA 4H58A 4EEVA 4HGSA 3KN6A 5IEVA 3EL7A 4C3FA 4FL1A 3FJQE 3F69A 4ACGA 3QQFA 4FSZA 1Q5KA 1UA2A 3BLHA 3DAJA 1Q8YA 5BVKA 3FYKX 5F94A 3OD6X 1H1SA 3A7GA 2GNJA 3R2YA 4O82A 4JR7A 1XH4A 3SXFA 3R04A 5GIOE 1OMWA 4YLLA 4PPBA 3ZSGA 5IUGA 4TNBA 4PTEA 3U51A 5HX6A 1JBPE 5C8MA 2YCQA 1H08A 4ZSLA 1SNUA 3PUFC 3QXOA 4G6OA 2A27A 4WG3A 5AUXA 4UMQA 4NJDA 4X0MA 4F6WA 4YPSA 2CNUA 4KWPA 4IM0A 2JITA 4V0GB 5CYIA 5JFWA 3ZM4A 3I1AA 3VS2A 2B9IA 2BROA 4IE9A 4RX7A 4QP9A 2EXMA 2W4JA 3F5PA 4UV0A 3R9DA 4CRLA 4BTMA 4DGNA 2G2FA 3NRMA 3RHKA 4EC8A 3OP5A 4X3FC 4U5JA 4W8EA 4ZY6A 4GCJA 3R9NA 2IZRA 4BDCA 5IA0A 4FKOA 1OIRA 3EFJA 3GU6A 1IEPA 2YWPA 3QTIA 4ITJA 4FKSA 2B54A 3T9TA 4IM3A 2G1TA 4IVAA 4JBVA 3HZTA 3OWKA 2C6KA 3SW7A 5T68A 2QOFA 5EI2A 5A6OA 4RMZA 3R00A 3PY0A 3WARA 3AKJA 4HVDA 2BZIB 5A6NA 2PSQA 5GHVA 4FTTA 4YZCA 4D9UA 5LVOA 4RGJA 4LM5A 2FO0A 4GYIA 1UNLA 4JBPA 1ZOGA 4BBFA 2R3FA 2XA4A 4TT7A 5K0XA 4DDGA 4GU9A 3QCXA 5CSHA 5JRSA 4CTCA 1R78A 3UZTA 5L2IA 3RCJA 3N4TA 4YGAA 1TQMA 4NKSA 4AAAA 2EXCX 4ZTNA 4FTCA 3O7LD 4H36A 4FGRA 3Q4ZA 5F4NA 1G5SA 1FPUA 1S9JA 2C5VA 3QKKA 4EQMA 3F61A 3UIBA 3H4JA 4XMOA 5JZNA 4NM0A 1IG1A 5CEKA 5EH0A 4N70A 2HWOA 4ZSAA 4R6VA 4FL3A 5HESA 4L3LA 3TNIA 4IAAA 4S30A 4DINA 3R9RA 2VU3A 4KIPA 1TQPA 2NNWB 3WI6A 5HE3A 2G15A 2XCKA 2C6IA 5C4KA 5L2TA 4HVIA 2IVSA 1B39A 4XBUA 1RDQE 4NIFB 2ITNA 4XEYA 4BCMA 4X6QC 5CF6A 4DDIA 4DGLC 5AR4A 2ERZE 2BIYA 2B0QA 4D5HA 3NX8A 4AQKA 3GU5A 4Z3VA 2GU8A 4H3QA 2UZUE 3CBLA 3JR1A 4EK4A 4U44A 2CN8A 3NDMA 5ANEA 2WMTA 3FSKA 3PP1A 4BTKA 4IZAA 4G16A 1ZMWA 3TZMA 5KMJA 2XALA 4H05A 3VUMA 3N51A 2C3JA 4FKLA 5CANA 2W05A 3L8SA 4EKLA 4KD1A 3HA6A 2A4LA 2BTRA 5HG5A 4LGHA 3FKOA 5BV3A 4O0TA 3NUNA 3OWLA 4IWPA 2IW8A 4FNZA 4AN9A 3N4VA 3EH9A 3P9JA 2AC3A 2GFCA 3NWWA 3HAMA 5E8YA 2GFSA 2FSLX 2X6EA 3CJGA 4BHNA 3IDPA 4BRXA 4EH6A 3OMVA 1XJDA 2CKQA 3KXNA 1XH6A 1I44A 3K3JA 4JLCA 1ZYJA 4FUYA 2YLEA 3ACJA 2XANA 3V3VA 4QMNA 3FMMA 3GU8A 4FVPA 4QPAA 5EOLA 3IDCA 3QQUA 2ZYBA 4ZLZA 5JK3A 4DGGA 5GZAA 4BKZA 3SHEA 2CKOA 5J8IA 3PTGA 3KU2A 3CP9A 4NW6A 4YC8A 4B8LA 2W4OA 3EWHA 1DAWA 4K77A 3FY2A 2WOTA 2X1NA 3Q9XA 5ACBC 4E8AA 4EK3A 5IQDA 3S1HA 5HX8A 4LOPA 2UW5A 3ZSIA 3HUBA 3ZO4A 4L8MA 4L45A 5DEYA 4I6FA 3R7OA 3FXWA 4I4FA 3RALA 3O8UA 4QMVA 1WAKA 4OR5A 3MVLA 2OSCA 3AC8A 5HOAA 3UG2A 3LCKA 4FKJA 2C69A 3PVBA 2F57A 2QR7A 4ZXTA 4AFEA 3A7FA 3Q3BA 4YU2A 5FXQA 4Y5QA 5H2UA 3MV5A 1ZYDA 3C4FA 4U80A 5HD7A 1PF8A 5HICA 3H0ZA 3FYJX 4PWNA 1XMLA 4O0VA 1AD5A 4CEGA 2HZ4A 3CLYA 4QP4A 4QQ5A 5HG7A 1H1RA 3BQCA 4AZEA 5JT2A 3V5QA 3FZTA 5E8ZA 1YDSE 3F6XA 2PVLA 2BRMA 3A7HA 1TQIA 2P55A 3KMUA 2I7QA 4ALVA 2HIWA 4U41A 5IUHA 2PVFA 4ZTRA 1JSTA 4I22A 3RI1A 2E2BA 1JKKA 3DK7A 1XBBA 3RTPA 2UUEA 3DBFA 3WF5A 3LFQA 3F3TA 1R1WA 4L67A 1M14A 5EW9A 3RAHA 5AAEA 5CF5A 5IQGA 5ETIA 4BCHA 5CAQA 5IQBA 2FVDA 3FHIA 4WD5A 2VTHA 1GAGA 5FEQA 5GZ8A 5BVOA 3PRFA 3A8XA 2IPXA 5E8WA 2W1CA 2ITXA 4RC4A 5ETFA 5DBXA 4EZ7A 5IISA 1UV5A 2O0UA 4IAKA 3W8LA 4BFMA 3TIZA 1UNGA 4DH1A 3FWQA 4O4EA 4ZJIA 4EBVA 4BJJB 2F7EE 4FYOA 1XKKA 2BCJA 3F88A 3QTQA 2IEWA 4HCUA 5DR2A 3EOCA 2W9FB 4AXDA 3TZ9A 1JKLA 3BX5A 1GJOA 5L6PA 2JBPA 3FDNA 3R1NA 4YO4A 4DLIA 1A06A 4MBLA 4KINA 4YTFA 5KHWA 3E3BX 4BY9E 2Z02A 3UTOA 1WMKA 3ZUTA 3LQ8A 3MJ1A 2DYLA 3AT3A 3UVPA 3ZO3A 3BHUA 5JZJA 1NW1A 4O81A 1R0EA 3UDSA 3GCVA 2A1AB 5EM7A 4KS8A 3P23A 2C6TA 3IS5A 2OXDA 3LJ0A 2C47A 4NM7A 3DBEA 4JAIA 1W84A 5KMOA 5LMBA 3E3PA 3LM5A 4GVJA 4FTIA 5AUZA 2W1IA 2J0LA 3EYHA 2VUWA 4FIHA 4GS6A 4L3PA 4U40A 3MPAA 4UXLA 5ETCA 3V5TA 5ANDA 4EHGA 4PMMA 2VWWA 4BR3A 2UZOA 4CMTA 2FSMX 3PIXA 5JRQA 2HY0A 3FE3A 4PL5A 4P7EA 4L46A 3QD0A 5AP5A 3LFCA 4GK4A 3PFYA 3HRBA 3PRIA 4AZSA 2R3PA 5KX8A 5CNOA 2YHVA 3D4QA 2BAJA 3R63A 5CSWA 2IVUA 4QMYA 3OY1A 4DHJA 2P2HA 3R8UA 4EWHA 5IH4A 5EK7A 1Q24A 2PZYA 4MXCA 2QCSA 2X2KA 2VTPA 4JVGA 3F2RA 5JKGA 4C4EA 3HRFA 2JIUA 3IKAA 4AE9A 5A14A 3K5VA 3IOPA 4A06A 4ENXA 3KULA 3QU0A 2WMXA 4MQ2A 4O4BB 4PNIA 3FL4A 4U42A 4V01A 4J53A 5DR9A 4ACHA 4D4SA 4HGTA 2ITVA 5FEDA 3GC8A 4JXFA 4XV9A 3W0OA 1VYWA 3L8XA 3C4WA 4RQVA 4I24A 1UU3A 1HCKA 1K3AA 2QKRA 4S2ZA 3FLSA 4FKWA 4DCAA 3AC4A 3OBGA 4W4WA 3FXZA 3UOLA 3ZFXA 4NYEA 1W2FA 3SD0A 5T6KA 3QWKA 1M7QA 2OZAA 2WMAA 3C4XA 3C1XA 3MIAA 4E5BA 4CKJA 2C5OA 2BZKB 4IVDA 4CV9A 3EN6A 2HELA 4OTWA 4QYHA 4DH7A 3WYYA 3SVVA 5HCZA 4YC3A 3BELA 3PPKA 4ITIA 4QMQA 3WYXA 2AEGA 3I79A 3QQJA 5J1VA 2YM6A 2WFYA 3Q9WA 4Q9SA 4DITA 5IKWA 2V7OA 5M4IA 1UVRA 4O0YA 5AUUA 2X2LA 3FPMA 3EN4A 3HP2A 4IDTA 1PYXA 4PTCA 4WA9A 2JKKA 2PVNA 5AEPA 5KBRA 4E73A 1PHKA 4CZTA 5CAPA 3R8VA 4QNAA 1H24A 4WNPA 3BYUA 1LR4A 1XO2B 4K2RA 2R5TA 5CT0A 4BC6A 4ZLOA 3ZRMA 2Q0NA 2WTVA 3LIJA 3ZO1A 5DN3A 5J7HA 2PULA 2YA9A 3DTWA 4P5ZA 1M7NA 4L7FA 2JDRA 1KWPA 5HO8A 4BI1A 2PUPA 3LMGA 3W2OA 3R1QA 5FP6A 2O8YA 2VO7A 5CAOA 2W17A 1W2DA 3CE3A 4PX6A 5FM3A 2CGWA 3NCGA 4IWDA 5J87A 3W10A 4EJNA 5M56A 3D7TA 3GI3A 2HYYA 3D5WA 3R73A 5CZIA 2XB7A 1RQQA 3F5XA 4C0TA 5KE0A 5ITAA 3MJ2A 3EFWA 3EJ1A 3V5LA 2PZPA 4D1XA 2WXVA 4AN2A 4O2ZA 1JVPP 3RAIA 4CYIA 2BRHA 3TN8A 3OW4A 4JOAA 4ACMA 3OXZA 4QMPA 1ST0A 1O6LA 4QMSA 2R3QA 2ZV8A 3DTCA 3E93A 4L42A 4U3YA 4JL9A 5AP3A 3W55A 4MXOA 4D0XA 4F9CA 4EUTA 5HLWA 4FRFA 5IZFA 3BV2A 3LFNA 2XF0A 5JGDA 3VW6A 5KBQA 5CVGA 1M17A 4ANSA 2A98A 4CMOA 3ZC5A 4X2JA 5H9BA 4AZVA 2BFYA 4FV3A 2XNOA 3QALE 2PHKA 4QMWA 2C1AA 3AKLA 3P5KA 3PSDA 4IHPA 2YISA 4G9CA 4ANBA 5CF4A 1LEWA 3GT8A 3PXKA 4IAIA 1CKPA 4ZK5A 3MY0A 3R2BA 3TZ8A 4BDAA 5BX0A 5BVFA 4DBXA 3VAPA 5A4CA 2GHMA 3EZRA 4EQUA 1YRPA 3AD5A 3HV4A 3VF8A 3FLNC 3RM7A 1O6YA 2XIYA 3CTHA 3ORMA 4XLIA 5D9HA 5HNBA 1PMEA 2ITOA 3P08A 4M68A 3OZ6A 4FEQA 3TTJA 2I40A 2XCHA 5LXMA 4KKHA 3BZ3A 4FEUA 4WKQA 2C6EA 4N4SA 4AFJA 5DVRA 5EI6A 3PPZA 3VWAA 2OZAB 3DOGA 3ODZX 4KAOA 1GZKA 4M84A 4MXYA 2WEVA 4RJ5A 5D1JA 2QVSE 3A60A 3PFQA 4F08A 3I6WA 2W06A 2YM8A 2ZVAA 5AM6A 2SRCA 3SOAA 3RJCA 3C5UA 4IAYA 5FBOA 1ND4A 3GC9A 4TXCA 4Y83A 2OJGA 3FMJA 3QUDA 4PDSA 2OF2A 5DT0A 3KXHA 4IJ9A 3KF4A 4TYIA 3RP9A 4EH2A 1PJKA 5L2SA 4BZNA 3QQGA 2ZMCA 3QKLA 5DFPA 4WHZA 5AP2A 3VF9A 2J5FA 3TIYA 5JH6A 2ERKA 4IZYA 4AZWA 3QRJA 4FT0A 4G3CA 5HIDA 4CKIA 4BL1A 1WBOA 4LV8A 4GEOA 2W96B 2Z7SA 3KK8A 4L9IA 3R7UA 5LMAA 4XHKB 1U54B 3TJCA 3LXLA 2Y8OA 4AGUA 4G5JA 3LOKA 2VO6A 2BHHA 3S0OA 4O84A 2YM7A 3HGKA 5AV4A 1RJBA 3NUSA 4TWCA 5ANIA 3H9RA 4JX3A 2W1GA 2YJSA 5A3XA 1H28A 5JEBA 3NLBA 4J71A 4OTFA 4ZY5A 2W0JA 3NS9A 2RG6A 4X3FB 4LRMA 4B8MA 4BCKA 2HW6A 4NTSA 3RAKA 3S4QA 1P4FA 3R30A 4FJVA 3WE8A 1UKHA 5D12A 4FT5A 1XWSA 4R3CA 3IG7A 3LAUA 2RF9A 5J7BA 4BBMA 3QGWA 4Q2AA 2H9VA 4L52A 5CQWA 3AGLA 1GIJA 4AOJA 3RAWA 4OTIA 4LRJA 4F9YA 4QP3A 3T3UA 3GQIA 4IZ5A 4RX8A 4TZRA 2PUUA 5L4QA 4FV2A 2I0YA 2JIVA 4ZS4A 4QT1A 4O7LA 1GIHA 2NRUA 4TWNA 5LVNA 3L9MA 2KULA 4YHFA 2X7OA 5T3QA 4FKGA 4FMQA 4I0TA 5BMSA 4EZ3A 4FODA 2QOIA 2ZAZA 2O5KA 4USDA 4HVSA 2G9XA 2VTRA 5I3RA 4QDEA 3ZLWA 2YIWA 5LWNA 3MESA 3OOGA 3C4ZA 4N6ZA 3ZYAA 2BPMA 4BYIA 5I0BA 5F9EA 1J1CA 4QP8A 5M08A 1U5RA 2E9PA 4L3JA 4MNEB 3ZCLA 1JWHA 1OIYA 2J50A 3SDJA 1ERKA 3KGAA 3MY5A 4GFMA 4X21A 4ZJVA 2HY81 2B1PA 3PA5A 3MVHA 3V5PA 4UZDA 1OPJA 3KCKA 4GFGA 4IX3A 1U5QA 3DB6A 4LL0A 4O83A 4BDKA 1FGIA 4NM5A 3IW6A 3JUHA 4TYEA 2PVRA 4BCNA 4OTQA 3FZOA 3ZFMA 4CKRA 5CQUA 3BGPA 1OGUA 4S34A 4FL2A 4PDYA 2GSFA 2PE2A 2REIA 3UOHA 4O7VA 3P1AA 4XLVA 3RCDA 4BZOA 3ORZA 2JDOA 4RC2A 3QFVA 3ZXZA 3WIGA 4K11A 4DG0E 5CXZA 3PUPA 5DE2A 2XM9A 3WILA 3NPCA 4RJ4A 4ERKA 3EMGA 3G6HA 5HLNA 2C5YA 5L8KA 4J95A 3TUBA 2JFLA 4P5QA 3MFRA 2WTWA 3AT2A 2C0TA 4FKUA 3U9NA 4DE4A 5KZIA 2OH0E 4F70A 4LUEA 5B2MA 4IEBA 2UZWE 3B2WA 2BALA 3PIZA 3P4KA 3UO4A 1V0BA 1VZOA 3FKNA 4YJSA 4FTRA 2XRWA 3ANQA 5LOHA 4JDKA 2JDTA 5IMEA 4APCA 5CVHA 4IC7A 2XAOA 2W1ZA 4V05A 4FKTA 1P4OA 3IOKA 1Z9XA 5FTOA 4EC9A 2YAAA 3BQRA 4XX9A 1U54A 2E9UA 3OEZA 2OKRA 3R8MA 2PTKA 4RIOA 2JDVA 4RRVA 4XUFA 5H8GA 1WFCA 2YZLA 1P5EA 4L01A 3QZHA 4NT4A 3BU3A 4FSQA 3R7VA 3EFLA 3VNTA 3LCSA 3COMA 2XRUA 5B7VA 4JAJA 4JQ8A 5B2KA 2GQRA 2YERA 2BDJA 3R8ZA 2PYWA 2AQXA 3VS3A 1Q4LA 4PF4A 5HTCA 3O51A 2ITYA 2XEZA 2X7GA 2C0OA 3B8RA 3Q5ZA 4FIGA 4GK3A 3U6HA 4MXAA 4UWYA 4X2FA 3F3UA 4DGOA 4IACA 4YZ9A 3VULA 2R3NA 4IH8A 2C1BA 4ZLYA 2YWVA 3EQFA 2QO7A 4DBNA 3JY0A 3TEIA 2FSOX 4UWCA 2YIYA 4MX9A 3CD3A 3LLTA 1BLXA 3CIKA 3QHRA 1OL6A 3UMWA 2P4IA 4KSQA 3QRTA 1PKDA 4E93A 2GNFA 4USFA 5JQ8A 3VBQA 1URCA 1XBAA 3I5ZA 4XG7A 4NFMA 1VYZA 5HG8A 5K0KA 4XG8A 2QQ7A 4DH5A 2YITA 4XP2A 3GNIB 4CT1A 2ZB1A 1ZZ2A 2GDOA 3P0MA 4G3EA 4UYNA 4PDOA 3BLQA 1REKA 4R77A 3HLLA 2HAKA 3MBLA 1OL5A 2WQNA 4FV1A 3LW0A 3RBWA 4DN5A 1VR2A 3D94A 3SQQA 1B6CB 2WMVA 4IANA 4Y95A 2ETMA 1APME 4AUAA 4TYHA 3BE2A 4S33A 3TNWA 2QOBA 4RA5A 3ERKA 2R3RA 2PVMA 4C35A 4KBAA 3BYMA 5FG8A 4DT9A 3RVGA 4FTLA 5GIPE 4TY1A 4BCIA 4OTHA 4ZSEA 4AN3A 4EI4A 5IDPA 2GQSA 3R9HA 4YURA 4W4YA 1PKGA 4C3PA 2R3GA 5M55A 2FA2A 3KKVA 4UN0C 3DBDA 2ZFYA 3KRWA 1OM1A 5E4HA 4FVRA 2FYSA 4UB7A 5C01A 3VN9A 1UU9A 4C34A 5K4JA 3WE4A 2Z2WA 4KABA 2G2HA 3KVXA 1ZOHA 3V6SA 4L00A 3F7WA 4IAZA 5DR6A 4D55A 5CU6A 2F7XE 4QTEA 3VJOA 2R0UA 2W9ZB 4PPCA 4CCBA 4CLJA 4BDHA 4D28A 4J8MA 4ZIMA 2CCIA 4C8BA 2R3IA 4XP0A 4YC6A 5HG9A 1YI6A 3HDMA 5M4CA 4APPA 2VNWA 4FKPA 2ITWA 4RWKA 4RWIA 4BTFA 4JDHA 4MD8E 3RWQA 4G6NA 1JKSA 3UP7A 3W2RA 4ZAUA 2C6DA 4R1VA 5KO1A 4OTGA 4FTQA 3CD8A 2YLFA 4RLKA 2PZ5A 2GS7A 2WO6A 4E3CA 2P3GX 1H25A 4YSJA 4IVBA 4QMTA 4DFLA 2EB2A 4XG9A 4DEBA 3LE6A 3Q52A 1R3CA 3AKKA 3KC3A 2DS1A 4AW1A 5E8UA 2DUVA 3VHEA 4NCTC 3BYSA 3Q2MA 2CCHA 5EM6A 3TM0A 3A61A 3L8PA 4RG0A 1PXMA 5BPYA 3WBLA 5C27A 4EONA 5DOSA 4IB1A 3NZ0A 5IU2A 1FGKA 4HYSA 4ZEGA 3VONA 2GHLA 4ERWA 5KKRB 5CNNA 5DPVA 2QI8A 3GB2A 4YTIA 5DT3A 4JG8A 4RWLA 5I9ZA 2PPQA 5AIKA 2ONLA 3OXIA 3R28A 4RVTA 1YKRA 4ZTSA 3IW5A 2V7AA 4I92A 3VUHA 4HYUA 2F7ZE 5GJFA 3Q6WA 3PE2A 4BCQA 3I0OA 3V51A 5HTIA 4Z7HA 1PXIA 5M53A 5LVPA 3QCSA 5CZHA 4FNXA 4C57A 5D10A 3TNHA 3QL8A 3UDTA 3LFEA 5EHLA 2XEYA 3NW6A 2WAJA 4D4RA 2XH5A 3QTWA 3SAYA 1J1BA 5AADA 4OAUC 5HO6A 5HBEA 1WVWA 3KF7A 1YHVA 4WG4A 2XNGA 2GPHA 2HENA 3UO6A 4F7NA 3BLAA 3W0NA 3ORPA 3MTFA 4FBXA 4R5YA 1WBPA 2VTTA 4C62A 4LOQA 4QP6A 5TF9A 1F5QA 2Y4IB 3VBXA 4BGGA 4RFYA 5FTGA 1H07A 3E8DA 4TYHB 3PXRA 2OBJA 4CFNA 2XZSA 3HV5A 2A2AA 4NEUA 3WF9A 2QG5A 4JRNA 4D2WA 3EQGA 1ZRZA 2VTMA 4XBRA 4BCFA 4YO6A 3DAKA 1W2CA 5FUTA 3E7VA 2NO3A 2W5BA 4AG8A 3KRXA 4BWKA 5DYJA 3FMKA 1UU7A 2CN5A 2XK6A 2VD5A 3OFMA 4GSBA 5CY3A 2UW6A 3K5UA 3VS4A 4ZTMA 5FEEA 2JDSA 2PVHA 2XKCA 3FMHA 3U6IA 4C4JA 4NJ3A 4A9UA 4AW0A 2C30A 3COKA 3DK3A 5EW8A 4A4XA 4UALA 2QLUA 4WUAA 4X2NA 3SOCA 4AZFA 2ZM4A 4BDFA 3P86A 3PZHA 4BCPA 4AA5A 3ULZA 1YXXA 5J9ZA 1U4DA 2VTNA 3Q4TA 4U8ZA 2NYAA 4L44A 3DU8A 5AP7A 3ORXA 3MA3A 4ITHA 5DG5A 4BB4A 4FEWA 2BDWA 3VQHA 1A9UA 3G51A 3NNUA 3EQPA 2XS0A 2Y6MA 3GUBA 3ZONA 4Q9ZA 5IQEA 4IWOA 3CC6A 3VW8A 4WNKA 5EDQA 2B9FA 3HUCA 4J96A 2V0DA 3O96A 3TV6A 4DFBA 5ANGA 1CTPE 2C6OA 3QA8A 3FQSA 4HPTE 5K5XA 5M57A 1WBVA 2OXXA 3TDWA 2W4KA 3RPRA 3MY1A 5HHWA 3VUIA 3NNXA 5CSVA 2BIKB 2JBOA 2BAQA 4O0SA 2H96A 3QZIA 4DFXE 3IGOA 4FZFB 5EHOA 2B53A 5CEIA 3ZSHA 3BBWA 1BYGA 3QQHA 4EOLA 4WRGA 3PPJA 4AF3A 4EZ5A 3TT0A 4PPAA 5ACKA 3R9OA 2J9MA 3R22A 3P78A 2XARA 3QQLA 2BRBA 2JIIA 3LJ1A 4TN6A 2VWZA 1MRVA 2J0MB 3C7QA 5F95A 4F0IA 1MUOA 3PXQA 3VO3A 5GJGA 2PUIA 4FIEA 2XUUA 5IQHA 4IQ6A 4KA3A 3OUKA 4BF2A 4X2GA<