3G51A

Structural diversity of the active conformation of the n-terminal kinase domain of p90 ribosomal s6 kinase 2
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
280
Chain Sequence
IKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESITVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein S6 kinase alpha-3
publication title Structural diversity of the active N-terminal kinase domain of p90 ribosomal S6 kinase 2
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 82
structure length 280
sequence length 300
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3g51A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3g51A01
3ORZA 3CJGA 4FIEA 3BU6A 4EK3A 4G3GA 5IG1A 3JR1A 2PMNX 3L1SA 1H25A 3BIZA 1M14A 4JBOA 3G5DA 1S9JA 5F20A 2IVUA 1JKKA 3R9HA 4DG3E 5LWMA 2EXEA 3BV2A 4C38A 4MQ2A 5C01A 4Z7GA 3MESA 3ZRKA 4J96A 1IAHA 4ZTLA 4H58A 3UNZA 4FSWA 2YM5A 4QTDA 1UWJA 4FBXA 5JK3A 3HA6A 4FSZA 1WAKA 4AN3A 2JDSA 5FWKK 5BUJA 2XIXA 4ZJIA 4MNEA 1UV5A 2BRNA 2W4JA 4FTQA 5AUVA 4P4CA 3O50A 4P2KA 5I3RA 3NR9A 4ZXTA 3EYGA 4IWPA 5HG7A 4CCUA 5FLFA 3AT3A 4AACA 3CC6A 4AGDA 2BRGA 4RWKA 2W5BA 4RWJA 5AP7A 4ASXA 4BDCA 1RJBA 5EQYA 4IM0A 2Y4PA 2C30A 3O8TA 4EK4A 2VTNA 5F9EA 3LFSA 5EW9A 4O0UA 2IG7A 2RL5A 3LOKA 5GHVA 5D11A 4E73A 5K4IA 3EYHA 4K2RA 2PUNA 1Y91A 2IZTA 5A4CA 1GIHA 5DVRA 3UP7A 4DFNA 4QTAA 3R8UA 3AC4A 1PYEA 3K3JA 4CFWA 5HCYA 5CVGA 4GVAA 2QU6A 2QHMA 4FNXA 4EOKA 4I5PA 5I9XA 4AN2A 5EDRA 1HCKA 4BCMA 2Y9QA 3R04A 3VUGA 5C4LA 1B39A 4IAIA 2R3KA 5DN3A 1MRUA 4JL9A 3FLYA 2O65A 1ND4A 4Y85A 2Y6OA 2B4SB 2YHVA 4O27B 3LXLA 3W2CA 5JKGA 3DKGA 4GU6A 2G01A 2IO6A 3RNIA 4JBPA 4QMUA 3MH3A 3DAKA 3SV0A 1A48A 5M53A 3CCNA 4YJNA 4C4IA 1H1PA 2GDOA 3QRJA 1KWPA 5BYYA 3E88A 4RJ7A 4EWQA 5L8LA 2J0IA 2PYWA 3CQWA 3HX4A 3FHRA 3FE3A 5IISA 4G6NA 3VNTA 5KX8A 1K3AA 3BEAA 1PJKA 2HELA 3UC4A 5BX0A 2W1DA 2Z7RA 3EH9A 4ZEGA 3PSBA 4F9BA 4GEOA 1ZMUA 2EU9A 3D2KA 5EHOA 4FTRA 1KE7A 3EN5A 3M1SA 3P5KA 3PIYA 4O96A 3KMWA 4EUTA 3P86A 5CEIA 4EZ3A 4LI5A 2GTNA 4QQ5A 2JGZA 4GK4A 2BZIB 2F49A 5IQDA 3SHEA 4I0RA 2WU7A 4TYHA 3RKBA 3FYJX 3JXWA 3N51A 1UU8A 4HNIA 4N4SA 5EM6A 4D2RA 2O0UA 1KE5A 2BIYA 2VAGA 1WVYA 5AP5A 3NVKI 3TJCA 3QUDA 4GRBA 4Q9SA 3EQPA 2B7AA 3AC8A 4CZYB 4QT1A 4AS0A 4DEDA 1KE9A 2ACXA 5I9WA 1XH7A 5KKRC 1O6KA 1FVRA 3LFBA 3SLSA 2VTPA 5HE2A 3G15A 3UO6A 2H8HA 4JX3A 4Y73A 3RI1A 3UOLA 2R3LA 3R73A 4MXOA 4BDBA 2CSNA 2ITOA 4EBVA 3H9RA 5CENA 5IF1A 2JITA 2WTDA 3AQVA 3QKLA 3L8PA 4XV9A 4X6RA 3LQ8A 2VWZA 3EHAA 2A4LA 2CHLA 2W9ZB 4EKLA 5I9ZA 2R3OA 5IQBA 2CGUA 3EQBA 4XOZA 3OWLA 4N0SA 3S95A 3GU6A 3ORLA 3PXQA 3V51A 1BI8A 2HY0A 1Y8YA 4R7HA 3T3VA 4QQTA 2C6IA 5GZAA 4U80A 3V6RA 4QTBA 3BKBA 1XHAA 3UMXA 4NEUA 4C62A 3O0GA 3KRRA 4PUZA 3MTFA 5IQHA 3QZFA 3ZC6A 2GMXA 2I1MA 4PNKA 1P2AA 2XMYA 1Q99A 3OTUA 4YP8A 3ZO3A 4D2VA 3UZRA 5CWZA 2LAVA 2VX0A 4ZAUA 3AGMA 3F6XA 3I4BA 1QPCA 3MB7A 5TOZA 2BZKB 3MPTA 3NSZA 1W82A 3ULZA 4RRVA 3A7GA 4D0WA 4F1MA 3R01A 3K5VA 4CMTA 5M51A 3V8WA 4DFUA 4JBQA 4AN9A 3KU2A 3VIDA 5CALA 4U8ZA 3UODA 2ITNA 3HDNA 1PXIA 3D7TA 3DLSA 4A9TA 3LM0A 3Q3BA 3F2NA 3PLSA 4FIIA 3Q32A 3KN5A 3H9FA 4X0MA 4DF3A 3FMLA 1B6CB 3I81A 5IDPA 3IKAA 3B8RA 3PA4A 5ANOA 2H6DA 5AUWA 4WG4A 4IFGA 3H10A 2OF4A 5IH4A 5HNIX 2C6MA 1KUTA 3QTWA 3VS5A 3OW3A 3PSDA 3WZJA 1KV1A 4E5AX 5IEXA 3FQHA 2X2MA 2WQOA 4FTCA 3I79A 2JDRA 4RX9A 2ZVAA 4I94A 5BVNA 4K9YA 2VU3A 3FHIA 4KNBA 4KS8A 2ZJWA 3FZSA 4RIXA 4EZ5A 3UNKA 4O84A 4KWPA 3IW8A 1OIYA 3OOGA 5AADA 3FY0A 3Q2JA 5FDPA 3U54A 3ZUUA 4D1XA 4UZDA 4PX6A 4JNWA 3GC9A 4M97A 2EXCX 1XH9A 4NM5A 5TF9A 1YXUA 3E7OA 3HMOA 3LFNA 4ZY6A 4JS8A 4X3FB 5HZNA 4EJNA 2UW0A 4RJ6A 2QOCA 5DR6A 1E1VA 4CFMA 3H0ZA 3OBGA 4DH1A 3OWKA 3D9VA 1SNUA 2XYUA 4LMNA 4CNHA 4R1YA 3GFWA 3PY1A 3TCPA 4E5BA 3R7EA 4B0GA 4FTUA 1ZRZA 4FKLA 2ITTA 1P14A 1X8BA 3TNQB 3KGAA 3WOWA 4D5KA 2PE0A 2R7BA 3WI6A 1Q3WA 5CEMA 5JFWA 4JG8A 3SW4A 5CF6A 5CS6A 4F6WA 4ZSGA 3Q5IA 3QTXA 5BVOA 3PXFA 4JR7A 4TYIA 1ATPE 1BL6A 2CGXA 2YA9A 5J9YA 4MKCA 5CQUA 1Q8WA 2OJJA 4FNWA 3BHYA 5BVKA 4N70A 5TO8A 4D4YA 3P08A 1YXXA 2VTJA 3RBWA 3SVVA 3FBVA 3LFQA 2R64A 3LJ0A 3R30A 5IA0A 4Q5EA 4LYNA 4FV0A 4O82A 1JQHA 3QRTA 5L2WA 1PXNA 2WQMA 3VUTA 2CMWA 3SOCA 4A4LA 1ZMWA 2GCDA 1Q8UA 3EQFA 1YDTE 3COHA 3S4QA 2YLEA 1O6YA 2RFNA 3QRUA 5IQCA 5M08A 5TKDA 4O7ZA 3WZEA 3ZXTA 3BYSA 4D58A 4L42A 4YJUA 4KB8A 2X81A 3OTVA 2O3PA 5F4NA 3BX5A 4D4VA 3EQCA 3PFQA 4J7BA 5M4FA 1WBOA 4NKSA 5CU3A 5HICA 2R2PA 3NWWA 4RG0A 2E9VA 3VBTA 2XJ2A 4FV9A 3OW4A 3P7CA 2WNTA 4OBQA 4B9DA 5CEPA 5J7HA 4JT3A 4XUFA 5AWMA 4AZEA 4KUJA 2JKQA 4ZZOA 1I44A 2DUVA 2XKCA 1AQ1A 2KTYA 4JI9A 3HV6A 2HZ0A 1PXKA 4HW7A 1OB3A 2NO3A 4GV1A 2DYLA 4RA5A 2W96B 2YDJA 5EW8A 3R7VA 5FM3A 3VS7A 1BKXA 5BYLA 2BHEA 1PXMA 4BHNA 4RX7A 1Q8YA 5D1JA 4DLJA 3A7JA 4F7LA 4G34A 5AV4A 3UE4A 4MBLA 2RFSA 4HGSA 4LMUA 3O51A 4PL5A 1PMVA 2G9XA 2FUMA 4RIWB 4BKZA 2WTCA 4FV7A 4YUQA 5D41A 4GIIA 4MEDA 4RFZA 1K2PA 5HNBA 5IA5A 3FJQE 4A06A 4E6CA 3N4VA 1H07A 3D5VA 4KKEA 3W33A 3WF5A 4BCKA 2XUUA 2UUEA 5HBEA 1OBDA 4L3JA 3ZFXA 2X2KA 3LPBA 3SQQA 4BBEA 3MH1A 3QUPA 4UXQA 3RHKA 2P4IA 5CZIA 5HBHA 3PY0A 3POZA 4XP2A 4HVIA 4FV3A 3ZYAA 4MNEB 1KV2A 4KIKA 5DRBA 3CS9A 3MH2A 5M4IA 4IAFA 2XB7A 4MWIA 3OVVA 4C37A 5L2QA 4RVLA 3UPXA 2QOFA 3E8DA 4PRJA 4IACA 4HPUE 5J87A 3R2BA 1BUHA 3ATTA 2CCIA 4QOXA 2UVYA 4QPSA 3VO3A 3GUBA 3B2TA 2YJSA 4FT9A 3NPCA 3CXWA 4QD6A 2C1BA 3QFVA 4FV4A 4DTAA 4WRGA 3ZM9A 4IADA 5C26A 2GHMA 4X2GA 4CYJA 1Z57A 2OW3A 2RIOA 2ZAZA 4O2ZA 3SKCA 4WD5A 4FTAA 1T46A 1YW2A 2RFDA 2IW8A 4RLLA 3ZS5A 5DNRA 3KC3A 4S32A 1GZ8A 4UMRA 2ETKA 3TZ8A 3MGYA 5HIEA 3DOGA 3ACJA 3IDPA 3O17A 2OGVA 3ORIA 4ANQA 4FTLA 4DE4A 5A46A 4YZDA 2WIPA 3CTJA 5E7RA 1UNGA 3F61A 3TUCA 4ZTMA 3C5UA 3TKHA 2RFEA 4BDKA 3E63A 4D9UA 4WNOA 2R7IA 5BQ0A 4UMTA 1VYWA 1Z5MA 1Q62A 3WIGA 2CLQA 4AF3A 5L4QA 4TW9A 4K1BA 4LOOA 1Q8TA 4A9UA 5KHWA 3R1NA 2XJ1A 3OEZA 3M42A 4YLLA 1YDRE 5CI6A 4JRVA 5LCKA 4D4RA 4DGMA 5CSWA 2C0OA 3C0IA 3A4OX 4A9YA 4PPBA 1A9UA 2X8DA 4S31A 3R83A 4PF4A 4LRJA 1Q8ZA 3ALOA 4IW0A 2Z02A 4JXFA 2YJRA 4EORA 4QMPA 1Q61A 5FTGA 2WB8A 2R5TA 4I4EA 4I93A 5FXSA 2ITWA 3VAPA 5JN2A 4DFXE 4PMSA 3OY1A 3R6XA 4RJ8A 5JEBA 4TYHB 5IDNA 5LXMA 4K33A 4O1PA 4O7WA 2FGIA 2JAMA 2B9JA 4IX5A 4WIHA 2CCHA 3HDMA 4IX6A 4H3PA 1SVHA 4Y72A 5L2TA 5JZJA 3LLAA 4RT7A 1OKVA 4GUEA 4E93A 1W0XC 2BKKA 2J51A 5IQFA 2WMRA 3LAUA 5AX3A 4KA3A 3HMPA 3TV6A 4FTOA 3IQ7A 4QP2A 3IOPA 4HYIA 3I5ZA 5BMMA 3A60A 4F08A 2X4ZA 1MQBA 3TIYA 4YTHA 3TV4A 1HCLA 1YVJA 4TY1A 4WKQA 5FRIA 4IZ5A 3OWJA 5AV0A 3BE9A 4KIQA 3L9NA 2O5KA 2CGWA 3W32A 3TKIA 4YC8A 1FPUA 4JVGA 3D15A 4UZHA 3PWYA 3V5WA 2YWVA 1V0PA 1Q3DA 5CTPA 2Z7SA 4KRCA 4FVPA 4X21A 3TM0A 5M09A 3ZFYA 3EFKA 2X9FA 4MXYA 4F9AA 1H1SA 3OC1A 5IA3A 4FIFA 4FVQA 3FMNA 2X7FA 4C59A 3L8SA 3ERKA 4E6QA 2FA2A 5HE3A 4I41A 4MXCA 4WG3A 5I3OA 4NH1A 2XIYA 4F9YA 3C4ZA 2XA4A 3KF7A 5C4KA 4IWDA 3ZH8A 2F7ZE 5HI2A 5BVFA 1H28A 1CSNA 4EH3A 4G2FA 4CGAA 4YZBA 4DEBA 3RPSA 3TNPC 4APPA 2ZOQA 3MB6A 2GS2A 3NCGA 5AUYA 1S9IA 3MIAA 3HLLA 4NIFA 3T9IA 4DC2A 4J8MA 5LVLA 4C34A 2ESMA 1L8TA 2WTVA 3MH0A 1JBPE 3FAAA 2JD5A 1QMZA 3CD3A 5K0KA 3D7TB 3M11A 4FT5A 2UV2A 1OUYA 2IVVA 4FZFB 2ETMA 3Q9XA 3T3UA 4A7CA 3F82A 5IQEA 3E62A 2VWYA 4C36A 3HV4A 2ZM3A 2WMBA 4J1RA 4CT2A 1SMHA 4IZYA 2J0JA 3C0HA 3UQCA 3U87A 4AXAA 4AFEA 1PMEA 2ZM4A 4LV8A 2C3LA 5D12A 4RZWA 2BKZA 4O6EA 2J0KA 1YQJA 4FKOA 3QC4A 3CBLA 3MPAA 3ZFMA 4O38A 5C27A 4BIEA 4EK8A 4FSQA 4U3ZA 2WU6A 3ZOSA 2XK3A 4TL0A 4DT9A 4QP8A 3F69A 5AIRA 2HOGA 4TPTA 3V8SA 1UKIA 3NZ0A 1OKYA 4L53A 5ANDA 2GQRA 2PMLX 5EOBA 4ACHA 1G5SA 1O6LA 2FO0A 1IEPA 2E2BA 4GYIA 3FI2A 5JGAA 4MD8E 4XG4A 4ZTQA 4E5WA 4B7TA 3CQEA 4EQCA 3BGPA 3P9JA 4PDPA 3V5TA 3NDMA 4TYEA 2BTRA 3K54A 4LL0A 4BCIA 3GCUA 2ITPA 4QMMA 2EXMA 2W7XA 5F1ZA 4C33A 1W83A 4S2ZA 4R3CA 4KAOA 5E1SA 4QMNA 3HP5A 1I09A 3IW4A 4ITJA 5FGKA 3E93A 1OL5A 2PZPA 4U79A 3PXZA 3PZEA 3FMKA 4L6QA 4JQ7A 5C9CA 3W2OA 3UIBA 3WYYA 2JIUA 2W4KA 3EFWA 3P1AA 4RGJA 5J5SA 2F2CB 5E9EA 4GG7A 2OIDA 4M7IA 2WQBA 2VNYA 1Q4LA 3LCOA 4GJ3A 1CTPE 1SNXA 2BILB 4LRMA 4ALWA 1JAMA 4BZNA 4BTFA 4OBOA 1WFCA 5LARA 4UMQA 1YI3A 4C02A 4QP1A 3RTPA 2X2LA 3QD0A 4II5A 5LMKC 4X2KA 4M68A 1QPDA 4DEAA 4RX8A 2PE1A 3WZKA 2VZ6A 3LCDA 4ACMA 2W1IA 2QODA 5EHYA 5EHLA 3EFLA 3UYSA 2WEIA 4I1ZA 1XKKA 3DNEA 3QQUA 4IX4A 4OTPA 2XM8A 4YO6A 1E1XA 3GU7A 4KD1A 5E8VA 5J79A 4PL3A 4N6ZA 5HVYA 3CEKA 4IVAA 4TRLA 1ZYCA 2QOOA 2ZYBA 4O0RA 3IO7A 5BNJA 2JDOA 3UO5A 3TG1A 4BI2A 4GT3A 1R0EA 3BRBA 4DTBA 5IQGA 1ZZLA 3BGQA 3LQ5A 3BWJA 2O63A 2WMTA 4EH8A 2REIA 4TYJA 5AUXA 2BDFA 3C4XA 1KE6A 3HV3A 2FH9A 3PVWA 3KRLA 1WCCA 3MVHA 3NNXA 1UWHA 2XEYA 4R3PA 4BDJA 1Y6BA 2PMIA 3ULIA 3O8UA 4F7JA 2ZB0A 5B7VA 1JKTA 5L8KA 3ELJA 4BZOA 5BMSA 3C1XA 5IEVA 4GS6A 4E26A 3FYKX 3D94A 3WBLA 2UVZA 3BU3A 4EOMA 4FSNA 2E9UA 2RSVA 3FZPA 4QYGA 4D1ZA 5ANIA 4GG5A 1NT2A 1TQPA 2R0IA 1JNKA 2WIHA 2QKWB 2P3GX 3F3ZA 2HXLA 2OI4X 2QOKA 1E9HA 2X6EA 3QL8A 4IAYA 2IW6A 3AD5A 3AXWA 3V6SA 4GFMA 4L7SA 2PVFA 4CV9A 3B8QA 4OW8A 3CR0A 4APCA 4HVSA 4GCJA 1GNGA 4IAAA 4PPCA 2H96A 5FD2A 3ORPA 4LFIA 2W1GA 2X7GA 2EB2A 2QR8A 3OY3A 4DEHA 3QCQA 4J71A 2B1PA 2AYPA 3RHXA 2WFYA 4JDHA 3EJ1A 5KMJA 4YNOA 3DDQA 3LVPA 3ZLXA 4CTBA 2CJMA 1STCE 4GJ2A 2J2IB 3NAXA 1L3RE 4QMYA 2VGOA 2UW6A 2UZVA 5HX8A 3E8CA 3VF9A 3MDYA 3G2FA 4E4MA 3PG1A 5HORA 3F5XA 4NK9A 2UZBA 5HIBA 3OBJA 5HKMA 3WE4A 3VRYA 5JQ8A 3GT8A 2UZNA 3KXXA 4RVKA 3GNIB 2BDJA 3KQ7A 4FIJA 4Y5HA 3RZFA 4CCBA 5IU2A 5JGBA 3R1QA 3NUNA 3UP2A 4MQ1A 3Q04A 4DFYA 2JBPA 3R8LA 4QTEA 4BCQA 1J3HA 4M0ZA 3RAWA 3ORMA 4FTJA 3PLAE 4BBMA 4W4WA 5DI1A 3ORXA 4MAOA 3FMHA 5BYZA 3CGFA 4I6HA 2BMCA 3P23A 3POOA 1OL1A 3UIMA 2ZV8A 3VC4A 3VUIA 3ACKA 5AJQA 2QNJA 1FQ1B 4AFJA 5KMIA 4QYYA 5L6OA 2X39A 3WILA 3H30A 4DCAA 5AR5A 5CEOA 3BV3A 4ZP5A 2BFYA 3RMFA 2HWPA 2QO2A 5BUEA 4EK5A 3DFAA 4IAKA 1CKJA 1K9AA 2FYSA 2XCKA 4R77A 2NPQA 2VWVA 4XHKB 4B6LA 5BVWA 1OBGA 2UW3A 2PU8A 4NW5A 1CDKA 1LP4A 3EQHA 3KK8A 3D4QA 4C0TA 2WTKC 3DJ5A 3QHRA 3O71A 4RC4A 3QQKA 1OM1A 3NLBA 3REPA 3SRVA 2WGJA 3DQXA 3V3VA 1GIJA 1OIQA 4NSTA 3U6IA 4DFLA 4PQNA 5E8YA 3HRCA 4AT5A 4D9TA 4XBUA 4HYUA 3L8VA 5G1XA 5L8JA 2J50A 3WZUA 5HTIA 3O7LB 4KINA 4F64A 1QPJA 2B9HA 1J1BA 4CFNA 1XJDA 3FKNA 2VO3A 3QTRA 4YTIA 4AE9A 2A1AB 5B2KA 3VS3A 3VUMA 4RQVA 2OO8X 4C4EA 5M07A 4F0IA 4EQMA 4XG3A 3P7BA 3E5AA 2JIIA 2H34A 3GC7A 4NW6A 4BGHA 4DHFA 3Q96A 3C50A 3ZO1A 2BPMA 2RKUA 2VUWA 2WTWA 4JDJA 3WE8A 2XIKA 3GENA 3KREA 2PTKA 5E92A 3GCVA 5G6VA 3A62A 1PW2A 1G8SA 3V5QA 4BTJA 3KCFA 1OL2A 4X3FC 1JSVA 1GZOA 2ZV7A 3FLZA 4DTKA 2E9OA 3FLSA 3U6HA 4FG9A 4JBVA 3EL7A 3MVJA 3O8PA 2YLFA 3NX8A 4CEGA 4NFMA 5LVMA 2GTMA 4PMTA 4AZVA 2OIQA 1OPLA 5DRDA 4O7SA 3IW5A 4C35A 2YEXA 3EN9A 2UW7A 4MF1A 3C4CA 1LUFA 4JJRA 3EN6A 2PVKA 3RK7A 4AOJA 2DS1A 4O7YA 2JIVA 3MY1A 3OP5A 1R0PA 3Q4CA 4MD7E 3VBWA 2C6KA 2WELA 3R63A 4ZSLA 3EFJA 2Y4IC 3MPMA 4CLJA 4BWKA 4CTCA 4F65A 2F4JA 2Y8OA 2QLUA 3BBTB 4M8TA 4NCTC 4YJOA 2OIBA 5FP5A 2BFXA 3SAYA 4HYSA 1V1KA 4RC2A 4RIOA 4OTHA 4IM3A 2UW9A 2YCSA 3GC8A 4O6LA 4B8MA 4BVUA 3KK9A 3W8QA 4CQGA 3DTWA 3DT1A 3PWDA 2CN8A 4HVDA 3TWJA 4EH4A 4BTKA 2XIRA 2F9GA 3R21A 5AAGA 4HOKA 3UG2A 4EHEA 5FEQA 3HAMA 4O0SA 4TXCA 3HZTA 4ONAA 4CG9A 3W2PA 3VS1A 2NNWB 4FG8A 3RPRA 3HV5A 3EKNA 5AP0A 4QMOA 4N57A 4QO9A 2PZYA 2W0JA 2QOHA 4ACCA 4YSMA 4X7QA 3G0FA 3R9OA 4NZWB 3GCSA 3FMDA 3C7QA 4RSSA 5HLPA 3TZ9A 4RMZA 2VTLA 4CFUA 4F1TA 3WYXA 2GNGA 3E8NA 1UKHA 5ANEA 4R6VA 5LVPA 1NVRA 2PZIA 4Y95A 3R9DA 1W7HA 5AIKA 3RNYA 1QCFA 1REKA 4O83A 3KB7A 3DXNA 2XNBA 5CSVA 3A7HA 4BCJA 2YISA 1OL7A 3MA6A 3AD4A 3FUPA 4OTWA 4YU2A 1PY5A 4FEXA 3VN9A 3W8LA 3ZLSA 4FE2A 1Q97A 5AR4A 2VWBA 2PVMA 3NUAA 2XRWA 2J9MA 3DK3A 1YXSA 4FK6A 2OZAA 5CY3A 3RZBA 4W8EA 5I9YA 4J53A 2VX1A 3PPJA 3QTZA 2QI8A 5E8TA 3TIZA 4UN0C 2O64A 4MWHA 3G9LX 3TZMA 1CKPA 1IASA 3R00A 4K0YA 4BTMA 2FSLX 4A4OA 2PVNA 3F3UA 3OUNB 4ORKA 3TNHA 1WZYA 4U43A 4FC0A 4UMUA 3LE6A 3DBEA 3KEXA 3ENMA 2P2HA 3ZUVA 3I5NA 3DK6A 4ASEA 2JAVA 5IQAA 4FKRA 2NP8A 4W9WA 3U8WA 3R7UA 3ZEPA 4FK3A 4L00A 1M2QA 5DWRA 3FZ1A 2WEVA 2UZOA 5DPVA 4F63A 2GSFA 2GU8A 3RM6A 4P5QA 4FV5A 5AR2A 4MF0A 4XLVA 5B2LA 1OI9A 4IX3A 4FL3A 3UMWA 3I7CA 3DPKA 2C0TA 2XKDA 2DQ7X 3HYHA 5L2IA 1U59A 3I0OA 4TKSA 5CLPA 1ZYLA 5EYCA 2VO7A 4FKPA 3LCSA 2JKOA 2C69A 4YJTA 4FTIA 4DEGA 1FINA 4WBBB 1ZOGA 4F99A 4Z9LA 4H36A 4NYEA 3OS3A 2YABA 4ERWA 3PVBA 4FOBA 1CMKE 2XYNA 1UU3A 4RFYA 4CRSA 4GW8A 1PXLA 3JPVA 4TT7A 3GCQA 4EOPA 3MFRA 3R28A 4BKJA 2BRBA 3KRXA 5TR6A 4AGWA 4U42A 3ORTA 1ZAOA 2P0CA 3HAVA 4CQEA 4YR8A 2IVTA 3MWUA 5LCJA 4EOIA 1SVEA 4JAIA 4PP7A 4I4FA 4IB5A 4D0XA 2FSTX 3RWPA 2ITZA 3UDBA 4IIRA 4FKWA 3G33A 4YPSA 3L9PA 4ZLYA 5DOSA 4C57A 3N9XA 5AM6A 5DR9A 2XZSA 3RAIA 4U0IA 3K5UA 1BYGA 4ENXA 4Q5HA 2VD5A 3WF6A 5HIDA 5KZ0A 3W18A 3QWKA 3MA3A 5HOAA 1YWVA 3UQGA 4BCGA 5FM2A 5DYJA 3QKMA 1VZOA 4IWOA 3FEGA 4AW0A 4PMMA 3SA0A 5EQEA 3RK5A 2CGVA 1IRKA 4YJRA 4J95A 3OCTA 5EOLA 3NEWA 3BHHA 1WBVA 3DB8A 3QCSA 3NNWA 4FYOA 5CSXA 1WBTA 3UC3A 3SW7A 2I0YA 2WTJA 3OOMA 4LGDA 4MVFA 2O8YA 5AAFA 2HYYA 3IOKA 3BI6A 3A2CA 5KKRB 5J5TA 2A2AA 2BTSA 4A9SA 4GKIA 3AG9A 3TJDA 2WMWA 5CX9A 4IVCA 2GFCA 3ZBXA 3PZHA 5IUIA 4LG4A 5M4CA 3IW6A 3ZU7A 4YPDA 4DFZE 5CF8A 3QZHA 4IJPA 1JPAA 3AMYA 3NW6A 5EG3A 2BALA 3WZDA 4DN5A 2B55A 5ANGA 4G16A 2WAJA 3QZGA 5CU4A 4BR3A 3FMMA 4HCUA 5DEYA 1PYXA 3KRWA 3PP1A 5JZNA 5LMAA 4UMPA 2YACA 1M2RA 5EYMA 5BPYA 4MBIA 3UNJA 5EM7A 2VX3A 4JDIA 4QQCA 4S30A 3LFEA 4L3PA 1A06A 4QMQA 3PE2A 1APME 4BHZA 3RAHA 3RPVA 4EI4A 1DAWA 1J7LA 4NM7A 5AFVA 4E8AA 1M52A 3SG8A 3GVUA 3ANRA 3HEGA 4OBPA 2OH4A 4M15A 3NNUA 3KCKA 2OBJA 3F7ZA 4CD0A 4FEWA 5K5XA 4EH7A 3PA5A 5CVHA 3OT8A 2VTOA 4BBFA 5GIOE 3ID6C 1YHVA 3CKXA 3D5WA 4TNBA 3BE2A 4TWPA 3H0YA 3K3IA 3SG9A 2QVSE 2XK9A 3NNVA 1OUKA 4DGLC 2P33A 3A61A 3OZ6A 5EDQA 4IBMA 4OT6A 2IWIA 5JQ5A 3ANQA 1G3NA 5BVEA 4C7TA 4YBKA 3DAJA 4JQ8A 1RE8A 2PK9A 2J7TA 3BZ3A 1ERKA 4XV1A 4ASDA 4BDEA 3QQJA 5K5NA 3U6JA 2VTQA 2BRHA 4Y8DA 2X4FA 4EKKA 3MV5A 4UEUA 1XR1A 2J5EA 3DV3A 4IWQA 4FZ7A 2ITVA 2C3JA 4GH2A 5IA4A 2Z60A 4FI1A 4YTFA 4K8AA 3S3IA 3R9RA 4RVMA 4FEVA 4FZAB 3VUDA 3ODZX 4O0VA 2C5NA 2IVSA 3ZLWA 4XJ0A 2X9EA 4F6SA 5CAVA 4X6QC 3VS2A 3SD0A 4W8DA 3CTQA 3KXZA 3MTLA 3QXOA 5E8XA 3CD8A 5GJGA 3LXNA 1TKIA 4XLIA 2JC6A 5CAOA 5ETAA 2C4GA 4XMOA 3FSKA 4YGAA 3MVLA 3ZRLA 2C5OA 1QPEA 2JFMA 4S34A 2PZ5A 3ETAA 3N4UA 4IXPA 5D9HA 5B2MA 3OWPA 4WOVA 2QG5A 4FVRA 2VWUA 2WMAA 3SXFA 1OIRA 2Y6MA 4EHZA 3QQFA 4HPTE 2VWIA 3ORKA 3E92A 4ACDA 4DG2E 2I6LA 4K18A 5HCXA 3D0EA 2I0VA 3AMAA 3ROCA 2BAKA 2XNNA 4AOIA 3KN6A 5CEQA 4CLIA 2R3JA 3SXSA 3AD6A 5EYDA 4YLKA 3FLNC 3LJ1A 3TT0A 2B9FA 3NS9A 2W1ZA 4RX5A 3R7YA 2R4BA 5DR2A 4TZRA 5FG8A 3FWQA 4IZAA 4HVHA 5AV1A 2V5QA 3TI1A 4D28A 3AC5A 2Z7QA 1FMOE 2YCFA 4FUXA 5AUZA 2V22A 3AC1A 4QMSA 2WMXA 4BDFA 4C4JA 2VWXA 3DZQA 4D2TA 4UX9A 1ZY5A 5HU9A 5LMKA 3VJOA 2GNFA 2VNWA 2I7QA 5L2SA 3D5XA 4BWXA 3KULA 2PHKA 1MQ4A 4F6UA 2XRUA 4AGUA 4KBKA 3R71A 4FICA 4O0XA 5CZHA 3LFDA 4N6YA 4OUCA 5FTOA 2ZDUA 4U9AA 3VBQA 1M17A 3JS2A 1DM2A 5M55A 3VS6A 3UVQA 5FP6A 5IQIA 1UA2A 2QONA 2QCSA 3G9NA 2JBOA 5ANJA 5AA9A 4ZTSA 4BN1A 4BDAA 3O23A 3ZMMA 1PKDA 4ZJJA 4U41A 2F2UA 3NVMB 3R7OA 4WUNA 2YIXA 3L9MA 3KMMA 3OEFX 3MFSA 4PDOA 3WF8A 5J9ZA 3QX2A 2QOQA 2FB8A 2J5FA 4KBAA 4L44A 4C4GA 2I0EA 1GZKA 3BYUA 4FSRA 4BF2A 3GBZA 3W2SA 4C3FA 5J7BA 4FTKA 4UYNA 4WNMA 3VUKA 3ZUTA 5K9IA 4CG8A 1YWRA 4H05A 5IMXA 2C3IB 2P2IA 3KY2A 4E6AA 4U3YA 5LOHA 4ZIMA 5EI6A 4NWMA 3VHEA 3LHJA 5HVKA 5AR8A 2Y7JA 4JLCA 5ETIA 1Y57A 1WBNA 3WARA 3IGGA 4R5YA 3IW7A 1YWNA 5HLWA 3DBCA 3F88A 3WF7A 1PMNA 4O86A 3FMJA 4FOCA 1UNHA 4FSTA 4E20A 5HE1A 3FKOA 2IZRA 3R8ZA 3KXHA 2CN5A 3BU5A 5I9UA 4R8QA 2R3MA 4FYNA 1GIIA 2HZ4A 2OZAB 2WZJA 2ITYA 3HA8A 3JYAA 3RM7A 2YM8A 5H8BA 1WBPA 2XNMA 3OXTA 1OPJA 3NUSA 3A8WA 3MJ2A 3C9WA 1H8FA 4LGGA 4YTCA 3L8XA 1GY3A 4QMLA 3ODYX 3A4PA 5AEPA 3UOJA 2UW8A 1H1WA 4UXLA 3ZDIA 3ET7A 2XP2A 3G6HA 3QZIA 5EYKA 3OXIA 4CT1A 2WQNA 5C8NA 2CKEA 3D83A 2GNLA 4AT4A 4UWCA 3D7ZA 5AP4A 5H2UA 3H4JA 3NUUA 4FUYA 4LL5A 4V01A 3ZXZA 3LQ3A 4FKTA 5A6NA 1YI6A 3MY0A 3TEIA 4V05A 4FTMA 3C5IA 4GMYA 3PJ3A 5M44A 3DK7A 4RJ5A 3WIKA 1W8CA 5CQWA 3R2YA 4IVDA 2W4OA 4DFBA 3OHTA 4B4LA 4RIXB 4BDHA 5LQFA 3KVWA 3KXMA 5JGDA 3HRBA 5CSHA 4RQKA 4ANMA 1YOLA 2GQSA 3DKOA 2WMVA 2CNQA 3NCZA 1SZMA 2ZMCA 3DJ7A 3KXGA 5ETFA 2PVRA 3V01A 4HZRA 4FKGA 4FL1A 4DA5A 4XRLA 3PTGA 2J4ZA 1JWHA 2ZDTA 4Z7HA 1PXPA 3HMMA 1UU9A 2OWBA 3BLRA 4FKQA 4PDSA 3RJCA 4C4FA 3NRMA 5HX6A 3SGCA 4OTDA 2XBAA 1P4FA 3R1YA 5HG9A 4LRKA 2VGPA 2EVAA 1R3CA 1B38A 4Z16A 3AT2A 1YHWA 5EM8A 4O7VA 2B53A 2E9PA 4GYGA 3DS6A 5A4LA 4IC7A 3FLWA 4IH8A 4EOLA 4GU9A 4P90A 3TUBA 4I6FA 4F7SA 2RGPA 3CGOA 2G2HA 3OT3A 5HO6A 4FV8A 2X8EA 5HCZA 1PXJA 5FBOA 3CE3A 3BELA 3MY5A 1F5QA 3VVHA 4F70A 3LFCA 5KMLA 1MP8A 5DEWA 5E8UA 1H27A 3QTUA 3PJ8A 4QYFA 4WO5A 5AV2A 5ACBC 3QD3A 4FNYA 2BDWA 3RPYA 4QP9A 5CAUA 2PZRA 3PDTA 4ALUA 3HNGA 2QG7A 2Q83A 1XQZA 3VBYA 5M4UA 3NMUF 5EFQA 4MTAA 3DDPA 4DH5A 3UQFA 1PF8A 4DH8A 1O9UA 2GHLA 1U46A 4EWHA 4RWIA 3U9NA 1UVRA 2HZNA 1CKIA 3TNWA 4E1ZA 3OCBA 4D55A 2W1EA 4CZTA 2OJFE 4IMYA 3MSSA 4C2WA 4GT5A 4RJ3A 4YJSA 4BL1A 2XKEA 4JAJA 4DGGA 1W98A 2VN9A 4QMTA 3DJ6A 1ZXEA 2R9SA 2OJ9A 2XK8A 4XEYA 3QD2B 2B9IA 3GB2A 3VQHA 2QR7A 4E4XA 4U45A 3QQHA 3WF9A 3PY3A 2VO0A 3FC1X 4X3JA 3PPZA 1VYZA 4R5SA 3F7WA 4X3FA 3THBA 2WOUA 3ZZWA 4AOTA 2P55A 4JX7A 2R3PA 4NJDA 4QP6A 3W16A 5JMSA 4NTSA 4DITA 3N4TA 1VEBA 1ZWSA 5FUTA 1XBAA 1ZZ2A 2XS0A 5HD7A 5A9UA 4FZ6A 4MH7A 4PTCA 4EUUA 2UZTA 4AUAA 3FKLA 2GS6A 4FR4A 3TV7A 4QP3A 4ALVA 5ACKA 3QX4A 4CMOA 4QYEA 4WG5A 2ONLC 4AZTA 4FA2A 3QF9A 4HGEA 4OT5A 2BZHB 3Q60A 4J99A 2XVDA 3ATSA 4MXXA 5CEKA 4NCTA 4V0GA 5F95A 3S2PA 5IUHA 5KZIA 1QL6A 3KXNA 4ACGA 2XNPA 3V5PA 5C8MA 4L67A 3LM5A 3BLHA 5E8SA 1KE8A 4ANSA 2LGCA 2XK6A 2H9VA 3U4WA 4KIKB 5KUPA 2FSMX 3A7FA 3FI4A 3MJ1A 3MIYA 3FXZA 5EQPA 5FEDA 2CNVA 2J90A 4BZDA 2C5YA 2BAQA 1LEZA 4G9CA 3BCEA 5TT7A 3FZRA 5H8EA 3AT4A 3GQIA 4G5JA 5J1WA 4O7TA 4YMJA 2YM3A 3QKKA 4L8MA 3PYYA 3EMGA 4OTQA 3RINA 4AAAA 4AA5A 5DH3A 2R3RA 5FEEA 3GGFA 2R3IA 4UWYA 4FT7A 1DS5A 5HEZA 1OITA 3UBDA 5A6OA 3JVRA 3RCDA 3GC0A 3LMHA 3DY7A 3EQDA 3UG1A 4FTNA 5KBQA 4GK3A 4PL4A 4KBCA 3HVCA 3R7GA 3AGLA 4ZS4A 1ZYSA 5DA3A 3SDJA 4EQUA 4ZLOA 2W1CA 1ZYDA 4JG7A 4FGBA 4HCVA 3SX9A 3MFUA 3VW8A 4MXZA 4JDKA 4YBJA 4CSVA 1U4DA 4FKUA 4ZSJA 4BI1A 4CXAA 5DT4A 1IA9A 3VF8A 4E7WA 4I24A 5FBNC 3ZEWA 3ZSHA 2B54A 2EUFB 3C13A 3TACA 4ZMEA 4C3PA 5T6KA 5JFXA 4KSQA 3AOXA 4RC3A 2YCQA 1SVGA 5FQDC 1PKGA 3NAYA 5AX9A 2BROA 5K0XA 2YN8A 3G0EA 4AA4A 3E87A 4RIWA 2NRYA 1UU7A 4I22A 2PVHA 3GU5A 4AW2A 3DQWA 2CKOA 1REJA 4XG7A 3RP9A 1XO2B 3COKA 1YHSA 4E4NA 3COIA 3SC1A 2UZEA 2ITUA 5IZFA 5A3XA 4W4VA 1Y8GA 3E3PA 3PVGA 5ICPA 3LMGA 1U5QA 3MN3A 5C03A 2YWPA 4XV3A 3RGFA 3V8TA 3QTQA 3ZM4A 2CNUA 2BUJA 2PULA 3W1FA 4I21A 2PSQA 3LZBA 4NFNA 4BCFA 1Z9XA 5IA1A 5CAPA 3FSFA 3R02A 4EH5A 3DKFA 3V5LA 4EHGA 4PDYA 4BFMA 4JIKA 3W55A 4C58A 2JKMA 4NTTA 2VWWA 2PE2A 3F66A 3QLFA 4ID7A 3JVSA 4F9WA 5KMOA 4TN6A 2DWBA 4KKGA 2BAJA 4FNZA 4ZTNA 5TE0A 3NUXA 5L6PA 4JR3A 4PTEA 1J91A 4M84A 1YXVA 4GT4A 2JFLA 4W9XA 3FI8A 3QWJA 1XH4A 3F3VA 5H3QA 3TZ7A 2HWOA 4EL9A 4DBXA 4BY9E 1WVXA 3KULB 4RLKA 2ERZE 3U4UA 1XH8A 2UZUE 3AC3A 5AM7A 4RZVA 4O91A 1OMWA 3QYZA 3F3WA 3R8VA 5HTBA 3EL8A 2OXYA 2YAKA 2PUPA 2YIYA 3CY2A 4RPVA 2W17A 3BWFA 2RG5A 4EC8A 3PIZA 1URCA 2BVAA 4E6DA 3QALE 4B8LA 1DI8A 5HE0A 2CKQA 3PG3A 4G31A 4MYGA 5GJFA 5AR3A 3TL8A 4I23A 4USDA 2PVYA 4DGNA 2X7OA 4Q9ZA 2VO6A 4M66A 2GNHA 4WSYA 2FSOX 2O2UA 3F9NA 2UW4A 5HTCA 1JLUE 5CF4A 3FC2A 3QUEA 4GKHA 4TNDA 1WBSA 3MFTA 2QO7A 1OVEA 3EN4A 3PSCA 4ZY4A 2C5XA 5JRQA 3LW0A 3CQUA 4QTCA 4Y46A 4O0YA 3PP0A 5AA8A 4RFMA 4J52A 3KL8A 3VQUA 3QA8A 4X2JA 2OF2A 3W10A 2HW7A 3Q9WA 3CTHA 4L68A 2WKMA 4QMXA 4WBOA 2YIRA 4BCPA 2AUHA 1R1WA 5EW3A 4QMZA 1YRPA 4C2VA 4NIFB 1YXTA 5AP2A 5JFSA 4H3QA 3GI3A 4LOPA 4K77A 1FOTA 2HK5A 4I5HA 4AWIA 5HVJA 4ZJVA 4J98A 3JUHA 3FPQA 5A14A 4IAZA 4ZOGA 1HOWA 4O22A 4PTGA 4G17A 5DGZA 3VUHA 4YHTA 4XNEA 2R3NA 4DT8A 4CMUA 3UGCA 4U40A 4BCOA 5ETCA 2PY3A 4NL0A 1IR3A 3MYGA 3ZTXA 4AW5A 1ZY4A 3BHVA 4OTGA 3QTSA 3UJGA 2WO6A 3BGZA 3FQSA 4MK0A 4OAVB 2QD9A 4C3RA 4M3QA 4AZSA 4O7RA 4O1OA 4QNYA 5CXZA 5IH5A 2XEZA 5EDPA 3UOKA 4KIOA 2X8IA 5AMNA 2RF9A 3UO4A 4IB0A 5ANKA 3CPCA 4OR5A 2W05A 4D4SA 1YDSE 4ZMFA 5H8GA 3UOHA 4QMWA 4O2PA 5IPJA 3QQLA 4DLIA 5CU6A 3DB6A 3DGKA 3FV8A 2QOIA 5DT3A 3DNDA 4P5ZA 3HRFA 4I6BA 2PL0A 4XS2A 3DU8A 4JQEA 4NU1A 3CP9A 4EC9A 4FKIA 4NM0A 5AV3A 5DFPA 4NUSA 5IA2A 4W4YA 3R0TA 4CYIA 4MD9E 5H9BA 3KFAA 4GK2A 5FXQA 4EBWA 1J7IA 4QPAA 3LCTA 5HU3A 5GJDA 5A4QA 2V7AA 3QU0A 4ZTHA 1ZOEA 5M57A 3TDWA 2QO9A 3Q4ZA 5K4JA 1RDQE 3BHTA 3KMUA 1UNLA 3QXPA 2BCJA 2ITXA 3KA0A 4PV0A 3ZCLA 4Q2AA 4EOOA 2XKFA 2ZMDA 4ZSEA 3OG7A 5I4NA 4IB3A 4FKSA 4M13A 4WRSA 3A8XA 4CFXA 4EHVA 4XCUA 3VBXA 3NGAA 4R7IA 5K3YA 2UZLA 1KSWA 1NA7A 3HP2A 3ZO4A 1J7UA 4YZCA 2WTKB 1H26A 2JDTA 3DCVA 4ANLA 3M2WA 2G2IA 3QRIA 3QD4A 4XYFA 3KF4A 1H4LA 1ZYJA 5I9VA 3MVMA 5E1EA 4EEVA 3S1HA 2WD1A 3ZO2A 3LCKA 5HO7A 4YO4A 4KKHA 2QQ7A 3PJCA 5CXHA 4OGRA 4CFFA 5J9LA 4NJ3A 2B52A 4LUDA 5A54A 1NVSA 5BVDA 4FV6A 1OKWA 3EIDA 3JY0A 4NT4A 4RWLA 5HG5A 2YZAA 1OKZA 1JKSA 1ZMVA 4IB1A 5C1QB 4AQCA 2UW5A 4XG2A 3T9TA 4HVGA 1JVPP 2YIWA 1OECA 4XV2A 4L3LA 2X6DA 5LVNA 5IKWA 3HECA 5DE2A 1Q24A 1M7QA 3EB0A 3G90X 3H3CA 3DBDA 5D7AA 2CDZA 4XH6A 2YM7A 4I6QA 1T45A 3GP0A 3OROA 4FEQA 5AAEA 3ITZA 4C61A 3LJ2A 4I20A 3D5UA 3GEQA 2XM9A 4G3FA 3CY3A 4MNFA 5JRSA 4JG6A 4BYIA 4DEEA 4F09A 4XG8A 4EJ7A 3LIJA 4CZUA 5M06A 3O96A 3RWQA 2JEDA 3P7AA 2QHNA 5AP6A 4ANNA 2OJGA 3QA0A 4DYMA 1IG1A 3EN7A 4FZDB 3NYXA 4TWNA 5GZ8A 1GAGA 2C6DA 2IN6A 3BYOA 3NUYA 4GVJA 2A27A 2ITQA 3H9OA 4K6ZA 4L52A 4MXAA 5DBXA 5M56A 5EK7A 4ZTRA 2W5HA 3IPHA 3COMA 2Y4IB 3EQGA 5KMMA 2GNJA 4V0GB 2VTSA 4G3EA 4KIPA 3ZHPC 4LV5A 5J1VA 4BYJA 5KO1A 4ZS0A 3P78A 3U9CA 4IQ6A 4R7BA 3HUBA 2IZSA 3PXYA 2XIZA 3ZZEA 2UZDA 3IECA 5CU0A 3TXOA 3CPBA 5DIAA 1YOJA 3FY2A 2BZJA 4QQJA 3A7IA 4BRXA 4L7FA 4ZZNA 3F5GA 5CVFA 4J97A 3RPOA 3DA6A 2XJ0A 2CKPA 4FT3A 1OL6A 4ENYA 1WMKA 4M12A 4L45A 3DXPA 2PUUA 1U5RA 2WXVA 2HIWA 2CLXA 3QAME 4M69A 4O7NA 3LXKA 3Q6UA 5IH6A 3PRFA 1DI9A 4WUAA 3FXWA 4ZK5A 2VTHA 5KBRA 2CPKE 4OTIA 3GU4A 1H0VA 4ANOA 1PRYA 3EOCA 3C4EA 3FZOA 3VBVA 1JKLA 4CKIA 3F5PA 5CF5A 5J8IA 3DKCA 4QMVA 4YLJA 4IZ7A 1R78A 3TN8A 2OK1A 2R3FA 4DGOA 4UB7A 4HGLA 4G6LA 4DINA 2QOLA 3EKKA 3EWHA 3BEGA 4BICA 2WQEA 1IA8A 3HGKA 1BI7A 2R0UA 3L9LA 5KE0A 3O7LD 4U44A 5AR7A 3TTIA 2C47A 5CI7A 4A4XA 4EOJA 3PIXA 4FKVA 5E90A 2HCKA 3S0OA 4UBAA 3CLYA 2IPXA 3E64A 4MHAA 4F0GA 4YHFA 3ZRMA 4O0TA 1M2PA 3TNIA 3V04A 2E9NA 3FXXA 4XRJA 4U97A 3MBLA 4QYHA 3BBWA 4AG8A 3TUDA 4EH9A 4H3BA 3ROYA 4G9RA 1JOWB 3IK3A 3V5JA 5HLNA 3QRKA 5LMBA 2OXDA 5DG5A 5LVOA 2YZLA 3UYTA 4F1OA 1MRYA 2QC6A 5KMKA 1H24A 1GJOA 5EKNA 1XBCA 4RJ4A 4XG9A 3VS4A 2J6MA 1U54A 4GFGA 4DH3A 4F0FA 3I7BA 2PUIA 4BI0A 4ZY5A 2IW9A 5A4TA 1IAJA 2W06A 3PJ1A 4JIAA 4EH6A 2WMSA 3B2WA 3ZC5A 5AP3A 2QOBA 4C8BA 2R3HA 4DEIA 4ZSAA 4RIYA 4QNAA 3JY9A 5JFVA 4UYAA 2YCRA 3OUKA 4FIHA 4LUEA 4M0YA 3SRVB 4HJOA 4U6RA 4GUBA 4Y83A 4DH7A 2J0LA 4PMPA 4EONA 5CT7A 4ASZA 4ERKA 3GXLA 4PY1A 3OD6X 3PRIA 4KSPA 1NXKA 4GFOA 2QLQA 5GZ9A 5EH0A 4U7ZA 5HBJA 3HV7A 4FMQA 2OLCA 2OXXA 2V62A 3GOKA 3R7IA 3O2MA 2EWAA 3SXRA 2G1TA 1P5EA 5GINE 5AUTA 1VR2A 4PNIA 2R3GA 2W5AA 2JDVA 3EQIA 4C4HA 2WMQA 3KVXA 1YOMA 4IFCA 4H1MA 3UPZA 1FVTA 4X2NA 4AT3A 3FLQA 2WMUA 3TKUA 4EOSA 4FEUA 1XH5A 3IONA 5KMNA 5HD4A 4ZZMA 2YFXA 5EM5A 2C68A 4ARKA 3FL5A 2F57A 2UZWE 2C6EA 5CNOA 2IJMA 4LOQA 3DFCB 2JLDA 2OZOA 2HY81 4AX8A 3DBQA 2BRMA 3PJ2A 4G3CA 2VRXA 1V0OA 1MUOA 4IDVA 3Q52A 3DAEA 4XOYA 3UZPA 3LFAA 2FVDA 4FODA 4B99A 4E4LA 4XP0A 4O0WA 3OXZA 4LM5A 3UZTA 2IZUA 3NYVA 4M14A 3PUPA 4BIDA 3D2IA 2G2FA 2AC3A 3ZDUA 5I5ZA 1OGUA 4DAWA 4HCTA 4WNPA 4QPMA 3DTCA 4WSQA 3EQRA 1YKRA 4DG0E 2XF0A 5DMZA 1YI4A 5AP1A 4H1JA 3G6GA 2BHHA 4PPAA 4HYHA 3QCXA 4EK6A 2C3KA 4G6OA 4FV1A 4D2SA 1DAYA 3C4FA 4IC8A 4XBRA 4Z3VA 4F4PA 2A19B 5E8WA 2I0HA 3VRZA 5CU2A 5E91A 1PHKA 2XK4A 2GPHA 2HZIA 2SRCA 3QLGA 5T68A 3R9NA 3ZSIA 3F3TA 4D1SA 2Q0BA 1V0BA 4L9IA 2WPAA 4BGGA 1KOAA 2QKRA 4OTFA 4LQMA 3Q5ZA 3I0QA 1FVVA 4M67A 4FTTA 1H08A 4AGCA 4H39A 2Y0AA 4CKRA 2BR1A 1WBWA 4HZSA 4AE6A 1SYKA 3A99A 1BX6A 5CANA 1TQIA 3Q9ZA 5EKOA 2Q0NA 3LLTA 4PP9A 3P0MA 4U81A 5E4HA 2C6LA 3F2AA 4CKJA 4YHJA 3QBNA 4I0SA 3QGYA 4XX9A 3ZSGA 4EOQA 4EYJA 2ONLA 4I0TA 4YC6A 3UIUA 2GS7A 4IHPA 3GFEA 2HXQA 5DLSA 5CASA 2GQGA 3ZBFA 5JSMA 4I5CA 1FGIA 2PWLA 2WOTA 2YAAA 3FZTA 2VTTA 3P4KA 1URWA 3CKWA 3DXQA 3CIKA 4OAUC 2XNOA 3Q2MA 1ZOHA 2HENA 4FX3A 2XK7A 4IJ9A 2VTMA 1FGKA 4FV2A 2ERKA 4QRCA 1ZLTA 2W9FB 5JT2A 4D2WA 4UV0A 4BC6A 4TWOA 1W84A 2YM6A 3HKOA 2OFUA 2VTRA 4MX9A 2UVXA 4BGQA 3UTOA 3GCPA 2ZB1A 5FXRA 2W1HA 4NM3A 3RCJA 4Z55A 5HESA 2F7XE 3RALA 4EH2A 3BYMA 4YZMA 5I0BA 2YITA 3FL4A 5CSPA 3TDVA 4G5PA 1JSTA 1Y6AA 3PXKA 3RK9A 2Z8CA 1TQMA 3P79A 1H1RA 3VJNA 3NYNA 2C6OA 3E7VA 4BDDA 5HQ0A 1NVQA 5J95A 4G1WA 3R8MA 4FIGA 2WTIA 3UIXA 2OJIA 4UWBA 4IVBA 2VV9A 5IUGA 2RG6A 5LWNA 1OZ1A 4YZNA 1AGWA 3MW1A 4USFA 3IDCA 5HGIA 4A9RA 3Q53A 3Q4UA 4AZWA 2YDIA 4KABA 4DCEA 2QURA 4FL2A 5JH6A 1FMKA 2VTAA 1OIUA 5BUIA 4CVAA 4FSYA 3LXPA 4BDIA 1CM8A 3PVUA 4TYGA 3QTIA 4WHZA 1NY3A 3I1AA 4BCNA 3IGOA 4BCHA 4FF8A 4L01A 3IS5A 3F2RA 4V04A 3QC9A 4EZ7A 4D5HA 4J8NA 3GU8A 2ZM1A 4RBLA 5L6WL 4QP7A 2GFSA 1RW8A 3IDBA 4WNKA 3CJFA 3FPMA 4BB4A 4R78A 4YJPA 3PPKA 4FT0A 4NKAA 1GZNA 2YDKA 1RQQA 3NW5A 4QP4A 3OCGA 4R3RA 4AU8A 4BIBA 4AZFA 4BWPA 1G8AA 3OF0A 2OG8A 3NUPA 4S33A 5KNJA 3K2LA 3LKMA 4UY9A 1BL7A 3PA3A 2C0IA 4L43A 4UALA 1P4OA 2YERA 5FTQA 4AA0A 2J0MB 3KKVA 4YC3A 2W1FA 4FSUA 3W2QA 4YJQA 3FMEA 2W99B 3HMNA 4JOAA 5CAQA 5ITAA 4O81A 1MRVA 5D7VA 3CSVA 4E3CA 2YM4A 5A4EA 4WA9A 2QU5A 3LFFA 4X2FA 4YNEA 2GHGA 4JRNA 4K11A 4P7EA 3S00A 2PPQA 1KOBA 5DT0A 5GNKA 3BQCA 3EZVA 2PVLA 5F94A 4XG6A 4YURA 2F7EE 2G15A 3SOAA 2KULA 2ETRA 3ZONA 3LMIA 2VTIA 2XNGA 4FG7A 1XH6A 3U51A 3PE1A 4ANBA 4ZLZA 3UVPA 1H01A 1F0QA 1XWSA 4I5MA 4BDGA 1Q5KA 3I60A 2OU7A 5KHXA 2V55A 1AD5A 1GOLA 5L3AA 1XBBA 3E3BX 4L46A 3HL7A 5CYIA 3U55A 2V0DA 4GIHA 4FSMA 4XP3A 5HNGA 3FI3A 1FBNA 3ENHA 1LR4A 3QGWA 2ZV2A 5D10A 4IEBA 4HGTA 3F5UA 2OICA 4EYMA 4OTRA 2PMOX 3RAKA 1M7NA 4PWNA 3W2RA 4YSJA 1H1QA 2OSCA 5EI8A 4M69B 1Q41A 4A07A 3VWAA 3II5A 4G3DA 4IANA 1JSUA 5B0XA 4IM2A 2R3QA 4FGRA 4IDTA 4IE9A 2EB3A 4LGHA 1F3MC 3D14A 3FQEA 4O21A 2OKRA 3GOPA 5LJJA 3DZOA 3QQGA 2OFVA 2BIKB 1BMKA 4CFVA 3NIZA 4AP7A 3HMIA 4MCVA 5FDXA 4YJVA 3T8OA 1EH4A 2HAKA 2XBJA 1ZARA 3VW6A 4I3ZA 3FDNA 3OCSA 1PXOA 5AUUA 1NW1A 1J1CA 1SM2A 3OFMA 4TWCA 1LPUA 4GL9A 2B0QA 3UVRA 4R1VA 3IG7A 3R1SA 4RVTA 1LEWA 3ORNA 1H00A 2XH5A 3VS0A 3NW7A 1H0WA 4RA4A 5HG8A 5HHWA 3R8PA 5KCVA 3C4WA 3G51A 4WT6A 2AC5A 3TTJA 4O7LA 1WVWA 3NYOA 2YIQA 2HW6A 3DBFA 5EI2A 3Q9YA 4AW1A 3AMBA 4GSBA 2C6TA 3QHWA 4D2PA 3PXRA 3Q4TA 2A0CX 3Q6WA 4HNFA 3OMVA 3MI9A 2ZV9A 4TTHB 2V7OA 3EZRA 5T3QA 2I40A 5CNNA 4I92A 3I6WA 3VULA 2JKKA 1U54B 3E8EA 5C8KA 1R39A 3BPRA 4W4XA 2Z2WA 2OH0E 3GQLA 4ITIA 4ITHA 2X1NA 4F9CA 4MBJA 4YZ9A 3C0GA 2C1AA 3MS9A 3DLZA 2XNEA 5IMEA 4CV8A 4CRLA 4Y5QA 4RIYB 4KRDA 4OLIA 2C5VA 3AC2A 3QYWA 3VHKA 2PVJA 4U5JA 3BYVA 3RVGA 4KS7A 1BLXA 3ALNA 3ZLYA 4USEA 5E8ZA 1OPKA 3NIEA 5IEYA 5CT0A 2X0GA 4FKJA 5GIPE 2Z7LA 3R22A 1PMUA 3KRJA 5HO8A 5DHJA 3C51A 3BLQA 2NRUA 1TVOA 2XCHA 2GNIA 4F7NA 3BHUA 3QCYA 3BQRA 1VJYA 3HUCA 2WHBA 4BKYA 3I6UA 4DBNA
chains in the Genus database with same CATH superfamily
3ORZA 3CJGA 4FIEA 3BU6A 4EK3A 4G3GA 5IG1A 3JR1A 2PMNX 3L1SA 1H25A 3BIZA 1M14A 4JBOA 3G5DA 1S9JA 5F20A 2IVUA 1JKKA 3R9HA 4DG3E 5LWMA 2EXEA 3BV2A 4C38A 4MQ2A 5C01A 4Z7GA 3MESA 3ZRKA 4J96A 1IAHA 4ZTLA 4H58A 3UNZA 4FSWA 2YM5A 4QTDA 1UWJA 4FBXA 5JK3A 3HA6A 4FSZA 1WAKA 4AN3A 2JDSA 5FWKK 5BUJA 2XIXA 4ZJIA 4MNEA 1UV5A 2BRNA 2W4JA 4FTQA 5AUVA 4P4CA 3O50A 4P2KA 5I3RA 3NR9A 4ZXTA 3EYGA 4IWPA 5HG7A 4CCUA 5FLFA 3AT3A 4AACA 3CC6A 4AGDA 2BRGA 4RWKA 2W5BA 4RWJA 5AP7A 4ASXA 4BDCA 1RJBA 5EQYA 4IM0A 2Y4PA 2C30A 3O8TA 4EK4A 2VTNA 5F9EA 3LFSA 5EW9A 4O0UA 2IG7A 2RL5A 3LOKA 5GHVA 5D11A 4E73A 5K4IA 3EYHA 4K2RA 2PUNA 1Y91A 2IZTA 5A4CA 1GIHA 5DVRA 3UP7A 4DFNA 4QEBA 4QTAA 3R8UA 3AC4A 1PYEA 3K3JA 4CFWA 5HCYA 5CVGA 4GVAA 2QU6A 2QHMA 4FNXA 4EOKA 4I5PA 5I9XA 4AN2A 5EDRA 1HCKA 4BCMA 2Y9QA 3R04A 3VUGA 5C4LA 1B39A 4IAIA 2R3KA 5DN3A 1MRUA 4JL9A 3FLYA 2O65A 1ND4A 4Y85A 2Y6OA 2B4SB 2YHVA 4O27B 3LXLA 3W2CA 5JKGA 3DKGA 4GU6A 2G01A 2IO6A 3RNIA 4JBPA 4QMUA 3MH3A 3DAKA 3SV0A 1A48A 5M53A 3CCNA 4YJNA 4C4IA 1H1PA 2GDOA 3QRJA 1KWPA 5BYYA 3E88A 4RJ7A 4EWQA 5L8LA 2J0IA 2PYWA 3CQWA 3HX4A 3FHRA 3FE3A 5IISA 4G6NA 4O4CA 3VNTA 5KX8A 1ST0A 1K3AA 3BEAA 1PJKA 2HELA 3UC4A 5BX0A 2W1DA 2Z7RA 3EH9A 4ZEGA 3PSBA 4F9BA 4GEOA 1G8KA 1ZMUA 2EU9A 3D2KA 5EHOA 4FTRA 1KE7A 3EN5A 3M1SA 3P5KA 3PIYA 4O96A 1G8JA 3KMWA 4EUTA 3P86A 5CEIA 4EZ3A 4LI5A 2GTNA 4QQ5A 4AXEA 2JGZA 4GK4A 2BZIB 2F49A 5IQDA 3SHEA 4I0RA 2WU7A 4TYHA 3RKBA 3FYJX 3JXWA 3N51A 1UU8A 4HNIA 4N4SA 5EM6A 4D2RA 2O0UA 1KE5A 2BIYA 2VAGA 1WVYA 5AP5A 3NVKI 3TJCA 3QUDA 4GRBA 4Q9SA 3EQPA 2B7AA 3AC8A 4CZYB 4QT1A 4AS0A 4DEDA 4AXDA 1KE9A 4FRFA 2ACXA 5I9WA 1XH7A 5KKRC 1O6KA 1FVRA 3LFBA 3SLSA 2VTPA 5HE2A 3G15A 3UO6A 2H8HA 4JX3A 4Y73A 3RI1A 3UOLA 2R3LA 3R73A 4MXOA 4BDBA 2CSNA 2ITOA 4EBVA 3H9RA 5CENA 5IF1A 2JITA 2WTDA 3AQVA 3QKLA 3L8PA 4XV9A 4X6RA 3LQ8A 2VWZA 3EHAA 2A4LA 2CHLA 2W9ZB 4EKLA 5I9ZA 2AQXA 2R3OA 5IQBA 2CGUA 3EQBA 4DHJA 4XOZA 3OWLA 4N0SA 3S95A 3GU6A 3ORLA 3PXQA 3V51A 1BI8A 2HY0A 1Y8YA 4R7HA 3T3VA 4QQTA 2C6IA 5GZAA 4U80A 3V6RA 4QTBA 3BKBA 1XHAA 3UMXA 4NEUA 4C62A 3O0GA 3KRRA 4PUZA 3MTFA 5IQHA 3QZFA 3ZC6A 2GMXA 2I1MA 4PNKA 1P2AA 2XMYA 1Q99A 3OTUA 4YP8A 3ZO3A 4D2VA 3UZRA 5CWZA 2LAVA 2VX0A 4ZAUA 3AGMA 3F6XA 3I4BA 1QPCA 3MB7A 5TOZA 2BZKB 3MPTA 3NSZA 1W82A 3ULZA 4RRVA 3A7GA 4D0WA 4F1MA 3R01A 3K5VA 4CMTA 5M51A 3V8WA 4DFUA 4JBQA 4AN9A 3KU2A 3VIDA 5CALA 4U8ZA 3UODA 2ITNA 3HDNA 1PXIA 3D7TA 3DLSA 4A9TA 3LM0A 3Q3BA 3F2NA 3PLSA 4FIIA 3Q32A 3KN5A 3H9FA 4X0MA 3VONA 4DF3A 3FMLA 1B6CB 3I81A 5IDPA 3IKAA 3B8RA 3PA4A 5ANOA 2H6DA 5AUWA 4WG4A 4IFGA 3H10A 2OF4A 5IH4A 5HNIX 2C6MA 1KUTA 3QTWA 3VS5A 3OW3A 3PSDA 3WZJA 1KV1A 4E5AX 5IEXA 3FQHA 2X2MA 2WQOA 4FTCA 3I79A 2JDRA 4RX9A 2ZVAA 4I94A 5BVNA 4K9YA 2VU3A 3FHIA 4KNBA 4KS8A 2ZJWA 3FZSA 4RIXA 4EZ5A 3UNKA 4O84A 4KWPA 3IW8A 1OIYA 3OOGA 5AADA 3FY0A 3Q2JA 5FDPA 3U54A 3ZUUA 4D1XA 4UZDA 4PX6A 4JNWA 3GC9A 4M97A 2EXCX 1XH9A 4NM5A 5TF9A 1YXUA 3E7OA 3HMOA 3LFNA 4ZY6A 4JS8A 4X3FB 5HZNA 4EJNA 2UW0A 4RJ6A 2QOCA 5DR6A 1E1VA 4CFMA 3H0ZA 3OBGA 4DH1A 3OWKA 3D9VA 5BV3A 1SNUA 2XYUA 4LMNA 4CNHA 4R1YA 3GFWA 3PY1A 3TCPA 4E5BA 3R7EA 4B0GA 4FTUA 1ZRZA 4FKLA 1TFFA 2ITTA 1P14A 1X8BA 3TNQB 3KGAA 3WOWA 4D5KA 2PE0A 2R7BA 3WI6A 1Q3WA 5CEMA 5JFWA 4JG8A 3SW4A 5CF6A 5CS6A 4F6WA 4ZSGA 3Q5IA 3KIOC 3QTXA 5BVOA 3PXFA 4JR7A 4TYIA 1ATPE 1BL6A 2CGXA 2YA9A 5J9YA 4MKCA 5CQUA 1Q8WA 2OJJA 4FNWA 3BHYA 5BVKA 4N70A 5TO8A 4D4YA 3P08A 1YXXA 2VTJA 3RBWA 3SVVA 3FBVA 3LFQA 2R64A 3LJ0A 3R30A 5IA0A 4Q5EA 4LYNA 4FV0A 4O82A 1JQHA 3QRTA 5L2WA 4AXCA 1PXNA 2WQMA 3VUTA 2CMWA 3SOCA 4A4LA 1ZMWA 2GCDA 1Q8UA 3EQFA 1YDTE 3COHA 3S4QA 2YLEA 1O6YA 2RFNA 3QRUA 5IQCA 5M08A 5TKDA 4O7ZA 3WZEA 3ZXTA 3BYSA 4D58A 4L42A 4YJUA 4KB8A 2X81A 4F78A 3OTVA 2O3PA 5F4NA 3BX5A 4D4VA 3EQCA 3PFQA 4J7BA 5M4FA 1WBOA 4NKSA 5CU3A 5HICA 2R2PA 3NWWA 4RG0A 2E9VA 3VBTA 2XJ2A 4FV9A 3OW4A 3P7CA 2WNTA 4OBQA 4B9DA 5CEPA 5J7HA 4JT3A 4XUFA 5AWMA 4AZEA 4KUJA 2JKQA 4ZZOA 1I44A 2DUVA 2XKCA 1AQ1A 2KTYA 4JI9A 3HV6A 2HZ0A 1PXKA 4HW7A 1OB3A 2NO3A 4GV1A 2DYLA 4RA5A 2W96B 2YDJA 5EW8A 3R7VA 5FM3A 3VS7A 1BKXA 5BYLA 2BHEA 1PXMA 4BHNA 4RX7A 1Q8YA 5D1JA 4DLJA 3A7JA 4F7LA 4G34A 5AV4A 3UE4A 4MBLA 2RFSA 4HGSA 4LMUA 3O51A 4PL5A 1PMVA 2G9XA 2FUMA 4RIWB 4BKZA 2WTCA 4FV7A 4YUQA 5D41A 4GIIA 4MEDA 4RFZA 1K2PA 5HNBA 5IA5A 3FJQE 4A06A 4E6CA 3N4VA 1H07A 3D5VA 4KKEA 3W33A 3WF5A 4BCKA 2XUUA 2UUEA 5HBEA 1OBDA 4L3JA 3ZFXA 2X2KA 3LPBA 3SQQA 4BBEA 3MH1A 3QUPA 4UXQA 3RHKA 2P4IA 5CZIA 5HBHA 3PY0A 3POZA 4XP2A 4HVIA 4FV3A 3ZYAA 4MNEB 1KV2A 4KIKA 5DRBA 3CS9A 3MH2A 5M4IA 4IAFA 2XB7A 4MWIA 3OVVA 4C37A 5L2QA 4RVLA 3UPXA 2QOFA 3E8DA 4PRJA 4IACA 4HPUE 5J87A 3R2BA 1BUHA 3ATTA 2CCIA 4QOXA 2UVYA 4QPSA 3VO3A 3GUBA 3B2TA 2YJSA 4FT9A 3NPCA 3CXWA 4QD6A 2C1BA 3QFVA 4FV4A 4DTAA 4WRGA 3ZM9A 1W2DA 4IADA 5C26A 2GHMA 4X2GA 4CYJA 1Z57A 2OW3A 2RIOA 2ZAZA 4O2ZA 3SKCA 4WD5A 4FTAA 1T46A 1YW2A 3W0MA 2RFDA 2IW8A 4RLLA 3ZS5A 5DNRA 3KC3A 4S32A 1GZ8A 4UMRA 2ETKA 3TZ8A 3MGYA 5HIEA 3DOGA 3ACJA 3IDPA 3O17A 2OGVA 3ORIA 4ANQA 4FTLA 4DE4A 5A46A 4YZDA 2WIPA 3CTJA 5E7RA 1UNGA 3F61A 3TUCA 4ZTMA 3C5UA 3TKHA 2RFEA 4BDKA 3E63A 4D9UA 4WNOA 2R7IA 5BQ0A 4UMTA 1VYWA 1Z5MA 1Q62A 3WIGA 2CLQA 4AF3A 5L4QA 4TW9A 4K1BA 4LOOA 1Q8TA 4A9UA 5KHWA 3R1NA 2XJ1A 3OEZA 3M42A 4YLLA 1YDRE 5CI6A 4JRVA 5LCKA 4D4RA 4DGMA 5CSWA 2C0OA 3C0IA 3A4OX 4A9YA 4PPBA 1A9UA 2X8DA 4S31A 3R83A 4PF4A 4LRJA 1Q8ZA 3ALOA 4IW0A 2Z02A 4JXFA 2YJRA 4EORA 4QMPA 1Q61A 5FTGA 2WB8A 2R5TA 4I4EA 4I93A 5FXSA 2ITWA 3VAPA 5JN2A 4DFXE 4PMSA 3OY1A 3R6XA 4RJ8A 5JEBA 4TYHB 5IDNA 5LXMA 4K33A 4O1PA 4O7WA 2FGIA 2JAMA 2B9JA 4IX5A 4WIHA 2CCHA 3HDMA 4IX6A 4H3PA 1SVHA 4Y72A 5L2TA 5JZJA 3LLAA 4RT7A 1OKVA 4GUEA 4E93A 1W0XC 2BKKA 4DDIA 2J51A 5IQFA 2WMRA 3LAUA 5AX3A 4KA3A 3HMPA 3TV6A 4FTOA 3IQ7A 4QP2A 3IOPA 4HYIA 3I5ZA 5BMMA 3A60A 4AAYA 4F08A 2X4ZA 1MQBA 3TIYA 4YTHA 3TV4A 1HCLA 1YVJA 4TY1A 4WKQA 5FRIA 4IZ5A 3OWJA 5AV0A 3BE9A 4KIQA 3L9NA 2O5KA 2CGWA 3W32A 3TKIA 4YC8A 1FPUA 4JVGA 3D15A 4UZHA 3PWYA 3V5WA 2YWVA 1V0PA 1Q3DA 5CTPA 2Z7SA 4KRCA 4FVPA 4X21A 3TM0A 5M09A 3ZFYA 3EFKA 2X9FA 4MXYA 4F9AA 1H1SA 3OC1A 5IA3A 4FIFA 4FVQA 3FMNA 2X7FA 4C59A 3L8SA 3ERKA 4E6QA 2FA2A 5HE3A 4I41A 4MXCA 4WG3A 5I3OA 4NH1A 2XIYA 4F9YA 3C4ZA 2XA4A 3KF7A 5C4KA 4IWDA 3ZH8A 2F7ZE 5HI2A 5BVFA 1H28A 1CSNA 4EH3A 4G2FA 4CGAA 2A98A 4YZBA 3RPSA 3TNPC 4DEBA 4APPA 2ZOQA 3MB6A 2GS2A 3NCGA 5AUYA 1S9IA 3MIAA 3HLLA 4NIFA 3T9IA 4DC2A 4J8MA 5LVLA 4C34A 2ESMA 1L8TA 2WTVA 3W0NA 3MH0A 1JBPE 3FAAA 2JD5A 1QMZA 3CD3A 5K0KA 3D7TB 3M11A 4FT5A 2UV2A 1OUYA 2IVVA 4FZFB 4BJJA 2ETMA 3Q9XA 3T3UA 4A7CA 3F82A 5IQEA 3E62A 2VWYA 4C36A 3HV4A 2ZM3A 2WMBA 4J1RA 4CT2A 1SMHA 4IZYA 2J0JA 3C0HA 3UQCA 3U87A 4AXAA 4AFEA 1PMEA 2ZM4A 4LV8A 2C3LA 5D12A 4RZWA 2BKZA 4O6EA 2J0KA 1YQJA 4FKOA 3QC4A 3CBLA 3MPAA 3ZFMA 4O38A 5C27A 4BIEA 4EK8A 4FSQA 4U3ZA 2WU6A 3ZOSA 2XK3A 4TL0A 4DT9A 4QP8A 3F69A 5AIRA 2HOGA 4TPTA 2X0OA 3V8SA 3AKJA 1XMLA 1UKIA 3NZ0A 1OKYA 4L53A 5ANDA 2GQRA 2PMLX 5EOBA 4ACHA 1G5SA 1O6LA 2FO0A 1IEPA 2E2BA 4GYIA 3FI2A 5JGAA 4MD8E 4XG4A 4ZTQA 4E5WA 4B7TA 3CQEA 4EQCA 3BGPA 3P9JA 4PDPA 3V5TA 3NDMA 4TYEA 2BTRA 3K54A 4LL0A 4BCIA 3GCUA 2ITPA 4QMMA 2EXMA 2W7XA 5F1ZA 4C33A 1W83A 4S2ZA 4R3CA 4KAOA 5E1SA 4QMNA 3HP5A 1I09A 3IW4A 4ITJA 5FGKA 3E93A 1OL5A 2PZPA 4U79A 3PXZA 3PZEA 3FMKA 4L6QA 4JQ7A 5C9CA 3W2OA 3UIBA 3WYYA 2JIUA 2W4KA 3EFWA 3P1AA 4RGJA 5J5SA 2F2CB 5E9EA 4GG7A 2OIDA 4M7IA 2WQBA 2VNYA 1Q4LA 3LCOA 4GJ3A 1CTPE 1SNXA 2BILB 4LRMA 4ALWA 1JAMA 4BZNA 4BTFA 4OBOA 1WFCA 5LARA 4I6LA 4UMQA 1YI3A 4C02A 4QP1A 3RTPA 2X2LA 3QD0A 4II5A 5LMKC 4X2KA 4M68A 1QPDA 4DEAA 4RX8A 2PE1A 3WZKA 2VZ6A 3LCDA 4ACMA 2W1IA 2QODA 5EHYA 5EHLA 3EFLA 3UYSA 2WEIA 4I1ZA 1XKKA 3DNEA 3QQUA 4IX4A 4OTPA 2XM8A 4YO6A 1E1XA 3GU7A 4KD1A 5E8VA 5J79A 4PL3A 4N6ZA 5HVYA 3CEKA 4IVAA 4TRLA 1ZYCA 2QOOA 2ZYBA 4O0RA 3IO7A 5BNJA 2JDOA 3UO5A 3TG1A 4BI2A 4GT3A 1R0EA 3BRBA 4DTBA 5IQGA 1ZZLA 3BGQA 3LQ5A 3BWJA 2O63A 2WMTA 4EH8A 2REIA 4TYJA 5AUXA 3AKKA 2BDFA 3C4XA 1KE6A 1W2FA 2FH9A 3HV3A 3PVWA 3KRLA 1WCCA 3MVHA 3NNXA 1UWHA 2XEYA 4R3PA 4BDJA 1Y6BA 2PMIA 3ULIA 3O8UA 4F7JA 2ZB0A 5B7VA 1JKTA 5L8KA 3ELJA 4BZOA 5BMSA 3C1XA 5IEVA 4GS6A 4E26A 3FYKX 3D94A 3WBLA 2UVZA 3BU3A 4EOMA 4FSNA 2E9UA 2RSVA 3FZPA 4QYGA 4D1ZA 5ANIA 4GG5A 1NT2A 1TQPA 2R0IA 1JNKA 2WIHA 2QKWB 2P3GX 3F3ZA 2HXLA 2OI4X 2QOKA 1E9HA 2X6EA 3QL8A 4IAYA 2IW6A 3AD5A 3AXWA 3V6SA 4GFMA 4L7SA 2PVFA 4CV9A 3B8QA 4OW8A 3CR0A 4APCA 4HVSA 3BL7A 4GCJA 1GNGA 4IAAA 4PPCA 2H96A 5FD2A 3ORPA 4LFIA 2W1GA 2X7GA 2EB2A 2QR8A 3OY3A 4DEHA 3QCQA 4J71A 2B1PA 2AYPA 3RHXA 2WFYA 4JDHA 3EJ1A 5KMJA 4YNOA 3DDQA 3LVPA 3ZLXA 4CTBA 2CJMA 1STCE 4GJ2A 2J2IB 3NAXA 1L3RE 4QMYA 2VGOA 2UW6A 2UZVA 5HX8A 3E8CA 3VF9A 3MDYA 3G2FA 4E4MA 3PG1A 5HORA 3F5XA 4NK9A 2UZBA 5HIBA 3OBJA 5HKMA 3WE4A 3VRYA 5JQ8A 3GT8A 2UZNA 3KXXA 4RVKA 3GNIB 2BDJA 3KQ7A 4FIJA 4Y5HA 3RZFA 4CCBA 5IU2A 5JGBA 3R1QA 3NUNA 3UP2A 4MQ1A 3Q04A 4DFYA 2JBPA 3R8LA 4QTEA 4BCQA 1J3HA 4M0ZA 3RAWA 3ORMA 4FTJA 3PLAE 4BBMA 4W4WA 5DI1A 3ORXA 4DHZA 4MAOA 3FMHA 5BYZA 3CGFA 4I6HA 2BMCA 3P23A 3POOA 1OL1A 3UIMA 2ZV8A 3VC4A 3VUIA 3ACKA 5AJQA 2QNJA 1FQ1B 4AFJA 5KMIA 4QYYA 5L6OA 2X39A 3WILA 3H30A 4DCAA 5AR5A 5CEOA 3BV3A 4ZP5A 2BFYA 3RMFA 2HWPA 2QO2A 5BUEA 4EK5A 3DFAA 3NFGB 4IAKA 1CKJA 1K9AA 2FYSA 2XCKA 4R77A 2NPQA 2VWVA 4XHKB 4B6LA 5BVWA 1OBGA 2UW3A 2PU8A 4NW5A 1CDKA 1LP4A 3EQHA 3KK8A 3D4QA 4C0TA 2WTKC 3DJ5A 1OGYA 3QHRA 3O71A 4RC4A 3QQKA 1OM1A 3NLBA 3REPA 3SRVA 4LV7A 2WGJA 3DQXA 3V3VA 1GIJA 1OIQA 4NSTA 3U6IA 4DFLA 4PQNA 5E8YA 3HRCA 4AT5A 4D9TA 4XBUA 4HYUA 3L8VA 5G1XA 4O4FA 2J50A 5L8JA 3WZUA 3O7LB 4KINA 5HTIA 4F64A 1QPJA 2B9HA 1J1BA 4CFNA 1XJDA 3FKNA 2VO3A 3QTRA 4YTIA 4AE9A 2A1AB 5B2KA 3VS3A 3VUMA 4RQVA 2OO8X 4C4EA 5M07A 4F0IA 4EQMA 4XG3A 3P7BA 3E5AA 2JIIA 2H34A 3GC7A 4NW6A 4BGHA 4DHFA 3Q96A 3C50A 3ZO1A 2BPMA 2RKUA 2VUWA 2WTWA 4JDJA 3WE8A 2XIKA 3GENA 3KREA 2PTKA 5E92A 3GCVA 5G6VA 3A62A 1PW2A 1G8SA 3V5QA 4BTJA 3KCFA 1OL2A 4X3FC 1JSVA 1GZOA 2ZV7A 3FLZA 4DTKA 2E9OA 3FLSA 3U6HA 4FG9A 4JBVA 3EL7A 3MVJA 3O8PA 2YLFA 3NX8A 4CEGA 4NFMA 5LVMA 2GTMA 4PMTA 4AZVA 2OIQA 1OPLA 5DRDA 4O7SA 3IW5A 4C35A 2YEXA 3EN9A 2UW7A 4MF1A 2XARA 3C4CA 1LUFA 4JJRA 3EN6A 2PVKA 3RK7A 4AOJA 2DS1A 4O7YA 2JIVA 3MY1A 3OP5A 1R0PA 3Q4CA 4MD7E 3VBWA 2C6KA 2WELA 3R63A 4ZSLA 3EFJA 2Y4IC 3MPMA 4CLJA 4BWKA 4CTCA 4F65A 2F4JA 2Y8OA 2QLUA 3BBTB 4M8TA 4NCTC 4YJOA 2OIBA 5FP5A 2BFXA 3SAYA 4HYSA 1V1KA 4RC2A 4RIOA 4OTHA 4IM3A 2UW9A 2YCSA 3GC8A 4O6LA 4B8MA 4BVUA 3KK9A 3W8QA 4CQGA 3DTWA 3DT1A 3PWDA 2CN8A 4HVDA 3TWJA 4EH4A 4BTKA 2XIRA 2F9GA 3R21A 5AAGA 4HOKA 3UG2A 4EHEA 5FEQA 3HAMA 4O0SA 4TXCA 3HZTA 4ONAA 4CG9A 3W2PA 3VS1A 2NNWB 4FG8A 3RPRA 3HV5A 4BJJB 3EKNA 5AP0A 4QMOA 4N57A 4QO9A 2PZYA 2W0JA 2QOHA 4ACCA 4YSMA 4X7QA 3G0FA 3R9OA 4NZWB 3GCSA 3FMDA 3C7QA 4RSSA 5HLPA 3TZ9A 4RMZA 2VTLA 4CFUA 4F1TA 3WYXA 2GNGA 3E8NA 1UKHA 5ANEA 4R6VA 5LVPA 1NVRA 2PZIA 4Y95A 3R9DA 1W7HA 5AIKA 3RNYA 1QCFA 1REKA 4O83A 3KB7A 3DXNA 2XNBA 5CSVA 3A7HA 4BCJA 2YISA 1OL7A 3MA6A 3AD4A 3FUPA 4OTWA 4YU2A 1PY5A 4FEXA 3VN9A 3W8LA 3ZLSA 4FE2A 1Q97A 5AR4A 2VWBA 2PVMA 3NUAA 2XRWA 2J9MA 3DK3A 1YXSA 4FK6A 2OZAA 5CY3A 3RZBA 4W8EA 5I9YA 3AKLA 4J53A 2VX1A 3PPJA 3QTZA 2QI8A 5E8TA 3TIZA 4UN0C 2O64A 4MWHA 3G9LX 3TZMA 1CKPA 1IASA 3R00A 4K0YA 4BTMA 2FSLX 4A4OA 2PVNA 3F3UA 3OUNB 4ORKA 3TNHA 1WZYA 4U43A 4FC0A 4UMUA 3LE6A 3DBEA 3KEXA 3ENMA 2P2HA 3ZUVA 3I5NA 3DK6A 4ASEA 2JAVA 5IQAA 4FKRA 2NP8A 4W9WA 3U8WA 3R7UA 3ZEPA 4DDGA 4FK3A 4L00A 1M2QA 4QDEA 5DWRA 3FZ1A 2WEVA 2UZOA 5DPVA 4F63A 2GSFA 2GU8A 3RM6A 4P5QA 4FV5A 5AR2A 4MF0A 4XLVA 5B2LA 1OI9A 4IX3A 4FL3A 3UMWA 3I7CA 3DPKA 2C0TA 2XKDA 2DQ7X 3HYHA 5L2IA 1U59A 3I0OA 4TKSA 5CLPA 1ZYLA 5EYCA 2VO7A 4FKPA 3LCSA 2JKOA 1W2CA 2C69A 4YJTA 4FTIA 4DEGA 1FINA 4WBBB 1ZOGA 4F99A 4Z9LA 4H36A 4NYEA 3OS3A 2YABA 4ERWA 3PVBA 3W0RA 4FOBA 1CMKE 2XYNA 1UU3A 4RFYA 4CRSA 4GW8A 1PXLA 3JPVA 4TT7A 3GCQA 4EOPA 3MFRA 3R28A 4BKJA 2BRBA 3KRXA 5TR6A 4AGWA 4U42A 3ORTA 1ZAOA 2P0CA 3HAVA 4CQEA 4YR8A 2IVTA 3MWUA 5LCJA 4EOIA 1SVEA 4JAIA 4PP7A 4I4FA 4IB5A 4D0XA 2FSTX 3RWPA 2ITZA 3UDBA 4IIRA 4FKWA 3G33A 4YPSA 3L9PA 4ZLYA 5DOSA 4C57A 3N9XA 5AM6A 5DR9A 3BLAA 2XZSA 3RAIA 4U0IA 2X0QA 3K5UA 1BYGA 4ENXA 4Q5HA 2VD5A 3WF6A 5HIDA 5KZ0A 3W18A 3QWKA 3MA3A 5HOAA 1YWVA 3UQGA 4BCGA 5FM2A 5DYJA 3QKMA 1VZOA 4IWOA 3FEGA 4AW0A 4PMMA 3SA0A 5EQEA 3RK5A 2CGVA 1IRKA 4YJRA 4J95A 3OCTA 5EOLA 3NEWA 3BHHA 1WBVA 3DB8A 3QCSA 3NNWA 4FYOA 5CSXA 1WBTA 3UC3A 3SW7A 2I0YA 2WTJA 3OOMA 4LGDA 4MVFA 2O8YA 5AAFA 2HYYA 3IOKA 3BI6A 3A2CA 5KKRB 5J5TA 2A2AA 2BTSA 4A9SA 4GKIA 3AG9A 3TJDA 2WMWA 5CX9A 4IVCA 2GFCA 3ZBXA 3PZHA 5IUIA 4LG4A 5M4CA 3IW6A 3ZU7A 4YPDA 4DFZE 5CF8A 3QZHA 4IJPA 1JPAA 3AMYA 3NW6A 5EG3A 2BALA 3WZDA 4DN5A 2B55A 5ANGA 4G16A 2WAJA 3QZGA 5CU4A 4BR3A 3FMMA 4HCUA 5DEYA 1PYXA 3KRWA 3PP1A 5JZNA 5LMAA 4UMPA 2YACA 1M2RA 3PFYA 5EYMA 5BPYA 4MBIA 3UNJA 5EM7A 2VX3A 4JDIA 4QQCA 4S30A 3LFEA 4L3PA 1A06A 4QMQA 3PE2A 1APME 4BHZA 3RAHA 3RPVA 4EI4A 1DAWA 1J7LA 4NM7A 5AFVA 4E8AA 1M52A 3SG8A 3GVUA 3ANRA 3HEGA 4OBPA 2OH4A 4M15A 3NNUA 3KCKA 2OBJA 3F7ZA 4CD0A 4FEWA 5K5XA 4EH7A 3PA5A 5CVHA 3OT8A 2VTOA 4BBFA 5GIOE 3ID6C 1YHVA 3CKXA 4O4DA 3D5WA 4TNBA 3BE2A 4TWPA 3H0YA 3K3IA 3SG9A 2QVSE 2XK9A 3NNVA 1OUKA 4DGLC 2P33A 3A61A 3OZ6A 5EDQA 4IBMA 4OT6A 2IWIA 5JQ5A 3ANQA 1G3NA 5BVEA 4C7TA 4YBKA 3DAJA 4JQ8A 1RE8A 2PK9A 2J7TA 3BZ3A 1ERKA 4XV1A 4ASDA 4BDEA 3QQJA 5K5NA 3U6JA 2VTQA 2BRHA 4Y8DA 2X4FA 4EKKA 3MV5A 4UEUA 1XR1A 2J5EA 3DV3A 4IWQA 4FZ7A 2ITVA 2C3JA 4GH2A 5IA4A 2Z60A 4FI1A 4YTFA 4K8AA 3S3IA 3R9RA 4RVMA 4FEVA 4FZAB 3VUDA 3ODZX 4O0VA 2C5NA 2IVSA 3ZLWA 4XJ0A 2X9EA 4F6SA 5CAVA 4X6QC 3VS2A 3SD0A 4W8DA 3CTQA 3KXZA 3MTLA 3QXOA 5E8XA 3CD8A 5GJGA 3TMOA 3LXNA 1TKIA 4XLIA 2JC6A 5CAOA 5ETAA