3G5LA

Crystal structure of putative s-adenosylmethionine dependent methyltransferase from listeria monocytogenes
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
222
structure length
222
Chain Sequence
EGLKAAGEWHELKKMLPDFNQKTVLDLGCGFGWHCIYAAEHGAKKVLGIDLSERMLTEAKRKTTSPVVCYEQKAIEDIAIEPDAYNVVLSSLALHYIASFDDICKKVYINLKSSGSFIFSVEHPVFTADGRQDWYTDETGNKLHWPVDRYFNESMRTSHFLGEDVQKYHRTVTTYIQTLLKNGFQINSVIEPEPAPELKDLPEMQDEYRRPMMLLISATKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of S-Adenosylmethionine Dependent Methyltransferase from Listeria Monocytogenes
rcsb
source organism Listeria monocytogenes str. 4b f2365
molecule tags Transferase
molecule keywords Putative S-adenosylmethionine dependent methyltransferase
total genus 67
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3g5lA00
2PT6A 5DLYA 4OA5A 3C6KA 5CVVA 7MHTA 3A4TA 3Q7EA 4DF3A 2G1PA 2AR0A 3KQVA 3P97A 5EHIA 4FP9A 4P7KA 1WZNA 3LCCA 5EMMA 2LD4A 5E2BA 3TM5A 1VL5A 2UYCA 3P9KA 3O31A 4GC9A 3MTIA 2I6GA 5EZSA 1Q0TA 2Z6AA 2F8LA 3KQYA 4RTRA 3UJ9A 3NDJA 2ZBPA 2HMYB 5LR6A 3CJRA 3RODA 4HTFA 1EJ0A 3GRUA 3HVKA 5BW5A 2GLUA 2ZULA 3LL7A 3O4FA 2ERCA 4JXJA 3UJCA 1JG2A 3LDFA 2YXDA 2CL5A 1ORHA 2P40A 3SM3A 3LKZA 3HM2A 3ER8A 4C05A 1N7JA 2K4MA 3GCZA 5HIIA 1JQ3A 3DLCA 4MTLA 3TPZA 3EMBA 3P9CA 3KQOA 4RSRA 4ER0A 3KPYA 1ORIA 4EQZA 2IH4A 5DWQA 3HCBA 3BT7A 3UBTA 3LSTA 5K0FA 4GOLD 4C07A 2P7IA 3HP7A 4RVHA 3THRA 2OXTA 1Y8CA 2NYUA 2ONYA 2IDKA 1SQGA 3NJRA 1L9KA 3P71T 4G56A 5DTQA 5DSXA 2JHCA 2AOVA 1NBIA 4CXMA 3T0IA 4GOND 1B42A 1FP1D 2GAFA 3NDIA 3MB5A 4IV8A 5CVJA 3VC2A 3KR2A 3BGVA 3HA7A 3SR4A 1KPIA 3I53A 4AX8A 5DX1A 5K09A 4QVKA 5K0JA 3B3GA 2N47A 3KPVA 5HIMA 1ZQ9A 3UJDA 5K01A 3R9XB 4GF5A 4YUZA 5KS2A 2PVCA 2UYQA 5FHRA 3WSTA 3FYDA 1IM8A 2IBTA 3BKXA 3LX6A 3G2MA 4X61A 1NT2A 2P35A 3C6MA 3LPMA 1KP9A 4X63A 3BWMA 5T64A 3AJDA 3BXOA 3K6RA 2QRVA 4M7RA 1R6AA 1ZHFA 1RI2A 5EMKA 1BC5A 5EIFA 1QAOA 3REOA 5FWDA 2BM9A 2OPBA 4QQNA 5B1SA 1FPQA 1TW3A 2G8NA 3CCFA 2EFJA 2ZIGA 4RTPA 3ELYA 1YUBA 1X19A 3EVCA 5C0OE 2HTEA 4YV2A 5LQRA 5K0NA 5DX8A 4GC5A 4PWYA 1JG4A 4RX1A 4XUDA 4RTQA 3SSMA 3DOUA 2IFTA 3HA5A 3NTVA 4RTNA 3HTXA 5LQCA 4F86A 2ZBQA 4XUCA 3HCEA 3IEIA 1VBFA 4GQBA 5KQRA 1SKMA 4RYLA 2ZCJA 5E1DA 2AN4A 5K0EA 3FYCA 3FPHA 4CKCA 5DPMA 4RTMA 1VP9A 3HCAA 3EVGA 1OR8A 3B3JA 2PWPA 3GO4A 4R6XA 3EVZA 4CKBA 4CWAA 3EVBA 5FQNA 5LQKA 3KR0A 3DH0A 1JQDA 2PT9A 3TLJA 4PYMA 2Q41A 3G5TA 1XTPA 2BR3A 2EX4A 1YFJA 4E2ZA 1VPTA 1X1DA 3BWCA 2CWWA 4V0RA 3FPEA 2OO3A 4M38A 5FA8A 4RVFA 5JR3A 1G60A 2P8JA 3T7SA 1JTFA 1G6Q1 2OZVA 1FJXA 3GRRA 3GJYA 3GXOA 3KR9A 1BKYA 3MQ2A 3OU7A 4O29A 3AXSA 4Y2HA 4BP3A 3FTDA 5GM1A 8MHTA 1P1BA 1XCLA 2GH1A 2IPXA 5E9QA 4EKGA 2AS0A 5EQJB 1UWVA 2IDJA 4OQDA 3DMHA 3SX0A 3LDGA 3KPJA 2AN5A 5HILA 3DR5A 4BLVA 5FA5A 3FUTA 1NW3A 1EQAA 4U7TB 2OYRA 3SSNA 3GRYA 3DMFA 3NWBA 1EG2A 4WXHA 4E2WA 3HCFA 2AOTB 3LECA 2AOUA 1NBHA 1V39A 1QAMA 4FT4A 1DL5A 3MERA 4YUWA 3FZGA 3TMAA 1XDZA 2B78A 2DULA 3C3PA 3CC8A 1D2CA 3FUXA 2ZWVA 3ID6C 3R0QA 5K0LA 3ER9A 2AVDA 1NW6A 1RI1A 3TKYA 5IKMA 2WK1A 1FP2A 2QYOA 1XCJA 2JH9A 1INLA 1SVUA 1O9HA 3KKZA 5E8JA 5ICCA 2GS9A 3PVCA 1XXLA 3DXZA 3JWIA 5E8RA 4EK9A 3RIEA 1M6EX 3VC1A 1I1NA 4PCLA 5C1IA 1P39A 3TR6A 3E23A 1DUSA 5EGSA 4OA8A 3G89A 4X1OA 3ERCA 4ATNA 5CVDA 1UFKA 3M6UA 5GIOE 1JQEA 1VQ1A 5BP7A 2HWKA 4RTSA 4OQEA 2IP2A 4P7FA 3UZUA 1ZG3A 3EGVA 3ELUA 4XUEA 4DA4A 3G5LA 5ERGB 5IH3A 3FTEA 2BM8A 4RTLA 2AZTA 4LG1A 5E9JA 3EGIA 3GU3A 2C7PA 4PYIA 4R6WA 4E70A 1AQJA 1QAQA 2FK7A 3SSOA 1YZHA 2IH5A 3FRIA 2YQZA 5FADA 3MCTA 1X1AA 4HGYA 2H1RA 3K0BA 4EKIA 5LSAA 5KVAA 5CIYA 1SQFA 1MJFA 3P2IA 2C7QA 4RWZA 5CM2Z 4PYJA 1HMYA 2PJDA 4HSGA 1M6YA 3CGGA 3VYWA 5EIWA 5GOZA 4R8RA 1VLMA 2EJTA 2FHPA 4YUYA 3HVJA 3UJAA 5DM1A 4YMGA 5K0BA 2ESRA 4Y30A 2V74B 1L3IA 1M0EA 4ER3A 3P2EA 4XCXA 4P7GA 2Y1XA 4LWPA 5HEKA 5P8WA 4A6DA 3KPUA 1TW2A 2IBSA 2O0LA 2PXAA 3G8AA 4GBED 4RVGA 2PXCA 5DX0A 5EOVA 4HC4A 4YV0A 5DRTA 4H0NA 2P7HA 5F2KA 2YXLA 2VDUE 3G2OA 4QVGA 4YV1A 2V7EA 2YXEA 4YUXA 3FUVA 5EKXA 2FRXA 3FPFA 3HCDA 4E33A 3OU6A 3GWZA 3KR1A 3ME5A 4PIPA 4HRAA 4DM3A 5GINE 1YFLA 1FBNA 5JUWA 3T7TA 4Z2YA 3B3FA 5C9ZA 2IH2A 3EGEA 3EVEA 3F4KA 3LKDA 2AOUB 3H2BA 3DP7A 2O06A 2PX2A 3EPPA 3TKAA 3UWPA 3EEOA 5MHTA 1NKVA 3FUUA 2IIPA 3U81A 2ZW9A 3JWGA 4B17A 3HVHA 4BP1A 5FWAA 4AUKA 3D2LA 5EVJA 3QV2A 5EZQA 1G8SA 4IV0A 1AV6A 3DLIA 3KQPA 2B9EA 1QYRA 3LGAA 3QOXA 3CVOA 1RI5A 5D1NA 3UJ7A 5DM0A 4QTTB 5EMLA 5KYGA 3SGLA 2H00A 5EC8A 1JR4A 3TOSA 2PX4A 1NV9A 3NW9A 3FUWA 2I9KA 3OFJA 4AZVA 3LBFA 3TRKA 5E1BA 1NW7A 3GDHA 2ZWAA 3Q87B 5CVEA 3A7DA 2ORED 3EEYA 4DCMA 5BXYA 2P1DA 2EG5A 4ER6A 4DKJA 3EVAA 4YUVA 5ICEA 1KYWA 2ZLBA 3PFGA 3I58A 1EAMA 3TM4A 5EHGA 3KQSA 4DCGA 3BKWA 4DMGA 2CKDA 5HOQA 2IGTA 2ZIFA 4IKPA 5EEHA 5CCBA 4WVLA 4QDKA 4RVDA 3GGDA 1IY9A 3KU1A 5E1MA 4EVIA 3OCJA 3TFWA 4PNEA 5LQJA 1R18A 3PS9A 3BWYA 4C04A 4AZWA 1L3CA 5DSTA 1F38A 2I7CA 2ZFUA 1R00A 3BGIA 1D2GA 3G2QA 3O7WA 5T6BA 1QZZA 3X0DA 4RV9A 4PCAA 2QE6A 3A7EA 2ZTHA 3I64A 3PT9A 5K8VA 3I9FA 3GRZA 4QPNA 5H02A 1KIAA 3G2PA 4FSDA 4KIGA 3E8SA 4C06A 5M5BA 2NXJA 3KQMA 2YUIA 2ZSUA 3FTFA 1I4WA 4KWCA 1NV8A 1O54A 1R74A 1BHJA 2XVAA 3E05A 3G7UA 2JG3A 1UIRA 1N7IA 1TPYA 3CKKA 3JWHA 5K0GA 3CJQA 1JSXA 1U2ZA 4HH4A 4DZRA 4MWZA 1T43A 4F85A 1YF3A 1F3LA 5FULA 4MHTA 3HEMA 4C4AA 3IHTA 5K0CA 3AY0A 1VP3A 2R3SA 2XYVA 3MAGA 2JJQA 1KYZA 3ELDA 2ONZA 2P3LA 2I62A 1EIZA 2EJUA 1YZ3A 4KVZA 2UYHA 4PYOA 1ZGJA 4C03A 5LQNA 3UJ6A 1WXXA 1G38A 3RW9A 1PRYA 2FK8A 3P2KA 1X1CA 3NVMB 5CVUA 3OZSA 1KPHA 1O9GA 3P8ZA 3B5IA 5CUQA 2HV9A 2O57A 3PTAA 3B89A 3UJ8A 4OBXA 3M70A 2PGXA 1VIDA 1AQIA 1NW5A 4PYLA 2AOWA 3KPWA 4M37A 3HNRA 4PGHA 2P41A 1IXKA 1YB2A 4P58A 4KDCA 5E1OA 5FQOA 4CTJA 3A26A 4EMSA 3E7PA 4QTUB 3V97A 3OZTA 2JHPA 2UZ4A 3A25A 1KXZA 4PYKA 3GRVA 5G02A 2PBFA 1P1CA 2PX5A 3PFHA 4PONA 5E9WA 1D2HA 3IV6A 2C7RA 3C3YA 3THSA 3BWBA 3KQWA 4PYQA 1X1BA 5GM2A 9MHTA 4MIKA 5KQSA 3GNLA 4FS8A 2ADMA 2PWYA 5GIPE 4K6MA 4NECA 1RJGA 4MQ4A 2UYOA 1BOOA 1Q0SA 3JWJA 3QOWA 3DXYA 3LBYA 4HTFB 3M6XA 2H11A 1P91A 3UJBA 5FHQA 4YMHA 4FT2A 3DXXA 4R05A 2G72A 3FRHA 2XYQA 3R3HA 2P3QA 3G88A 5DXJA 3CBGA 3UA4A 2ZVJA 3TQSA 2NXCA 3EVDA 2O05A 3ANXA 4RTOA 2PSSA 4BLUA 2OB2A 5F2OA 1XJ5A 5HFJA 2HR1A 5DXAA 1R8YA 1VE3A 5K03A 4U7PB 2XBMA 2OBFA 4OBWA 4X41A 5LQAA 1N2XA 2AOXA 2PV0A 2FYTA 3OE5A 1HNNA 3FPJA 4RTKA 3R24A 2CMHA 2QY6A 5HIKA 3DMGA 3M4XA 3R6TA 4PYNA 4DQ0A 3GIWA 5CD1A 4FZVA 1SUSA 2AOTA 1RI3A 2NXEA 2YX1A 2BR4A 4CTKA 1JSZA 3OPNA 3MGGA 2QM3A 1JG1A 3BZBA 3C0KA 3KQTA 3PB3A 5DRYA 4QDJA 3EVFA 4X60A 5U4XA 3T7RA 5DTRA 4E2XA 5HZMA 1MHTA 4M36A 4ER5A 2B25A 4P7JA 4C08A 4E31A 2AVNA 4IWNA 5F2NA 3LCUA 1SG9A 2GA9A 4PGGA 5DT2A 5EKUA 1ZGAA 2BH2A 3IYLW 5GP1A 3CJTA 3P9IA 3PLAE 1RJEA 4KW7A 4LWOA 2VZ9A 4BY9E 2XYRA 1H1DA 3UA3A 3NWEA 1WXWA 5DM2A 3M6VA 5EG5A 3MCZA 3NVKI 2ZIEA 3HA3A 5BW4A 2NP6A 2AN3A 2PLWA 3SMQA 2PXXA 1R8XA 2PKWA 4PINA 3S68A 4ER7A 4BLWA 2G70A 4GUAA 4HG2A 1JTEA 2YVLA 1RI4A 3I5UA 3PX3A 1WY7A 4ISCA 4R8SA 3SVZA 4CKEA 4E30A 3LCVB 1SUIA 2WA2A 3DUWA 3MTEA 5FCDA 4FGZA 2YR0A 1RJDA 4FR0A 1ZKDA 5HIJA 3V8VA 2KW5A 3MHTA 4E32A 2VS1A 5EEGA 2E5WA 2BR5A 5EMJA 5LQUA 3PX2A 5EPEA 3ELWA 5FUBA 4A6EA 4LECA 1XVAA 3L8DA 5DM4A 3BGDA 1G8AA 10MHA 3NMUF 2BZGA 2R6ZA 2GB4A 1I9GA 1XDUA 2OB1A 3ORHA 5ICGA 2VP3A 4KIFA 2CMGA 3EMDA 4E2YA 2Z6QA 2OKCA 4HGZA 2ZBRA 4F84A 3P9NA 1DCTA 1NE2A 1QANA 2JHAA 1RJFA 3FTCA 1KPGA 2OY0A 3OE4A 2PY6A 4PIMA 1WS6A 2G71A 3DULA 3M6WA 4GOOD 4QQKA 5D1HA 2VDWA 1EJ6A 1WG8A 4GEKA 1KHHA 2XVMA 2ZZKA 4KDRA 2C7OA 5GWXA 2QRVB 3OFKA 4POOA 1G55A 3KHKA 3LDUA 2NNWB 3UFBA 2A14A 2NXNA 2B3TA 2P3OA 2YTZA 5DTMA 2VDVE 3AXTA 4L7VA 4RTJA 2WA1A 2DPMA 3FPGA 5ICFA 2B2CA 3LHDA 4OX9Y 4ZTBA 5FTWA 2Z6UA 3HVIA 5CCXA 4GOMD 1AF7A 1NW8A 2PX8A 3A27A 3SXJA 5T67A 1KR5A 1XDSA 3OU2A 3AWIA 4V0QA 2NP7A 4UOEA 2HNKA 3DTNA 2GPYA 2FPOA 2Y1WA 3OZRA 4KRGA 1PJZA 1Z3CA 5E2AA 3VSEA 2ZZMA 3HCCA 3G8BA 1L1EA 3KQQA 4AZTA 4AZSA 2FCAA 1L3BA 5K05A 2JH8A 3BUSA 3M33A 4QPPA 4FSXA 2O07A 1JG3A 2ZZNA 3B7PA
chains in the Genus database with same CATH superfamily
2ZUUA 1RPJA 4FFMA 3E81A 4OA5A 4EHHA 5A1TA 3C1OA 3NCTA 5BRAA 3Q7EA 1JP7A 3V3KA 2DSTA 2MR6A 5G1PA 3UKOA 5JAZA 1KKLA 1QGDA 5F73A 3SF8A 1GJRA 5CMLA 2ECPA 3IEKA 4II2A 5ALZA 4NYJQ 3TM5A 5J2UA 4V38A 4J49A 3MTIA 5EZSA 3JYQA 4G0NA 1R8QA 4HAWA 1Y7HA 2BVNA 3UJ9A 4ARVA 4V2IA 4F04A 4JI0B 4EJMA 4JQCA 5KNCH 2FJ0A 4YWHA 5D5HA 1O8CA 2NYAA 4EX7A 2N1MA 2V59A 1YHYA 1TKRA 2A57A 3PYLA 2VJMB 2JJYA 2CL5A 3ZIAD 4LE1A 4L2IB 3IQFA 3TW8A 3NEJA 3LX5A 4KE6A 4GI2A 4MTLA 4DQVA 3NNSA 4J7UA 2G5PA 2QTCA 1QHSA 2G63A 4LC9A 2BN4A 5BUQA 1CQXA 2XGGA 3T61A 1E2DA 1MRSA 2H2GA 2OG2A 1DG1G 2IOQA 3FH0A 1E3EA 3M4ZA 1H2ZA 1EBUA 1Y34E 4CEHB 4YIKA 4FDVA 3UT6A 2H1OA 2WIDA 3E70C 2GEVA 5KMGA 1UKYA 1ICEA 5EZ6B 3EBPA 2XRZA 4G56A 3M1YA 3QI2A 3QMVA 1QE3A 4RPGA 3V33A 1SOVA 5F7OA 2R1ZA 3B6KA 1S1MA 1ZC3A 3ZKAA 4IDGA 1DKRA 2C61A 4OOEA 4PSKA 1EHYA 4NU8X 3BDVA 1H0SA 2NACA 1L5LA 3TRHA 2ZGVA 3KC2A 2CLEB 1JN0A 3ZWKA 1G7TA 2DMRA 3AR4A 1ULTA 2I4MA 3I53A 1RMTA 3NYIA 2YYSA 4QVKA 5BRNA 4KXMA 4DIDA 2W2LA 4KGZA 2GM3A 3TW8B 3K94A 3I8SA 3WNZA 5K01A 2OUIA 3FWZA 3TCXB 1SY7A 5KS2A 2PVCA 1GR1A 4P33A 1V2HE 4IAOA 1ODSA 2AEMA 3DPSA 4QATA 1ADCA 3TQHA 4BX9A 5C52B 1SXHA 1OB2A 4EJ2A 1GL6A 1TTHA 1VCHA 3DT8A 3PRJA 1KYXA 1TJYA 4K9NA 4YMIA 4Q37A 3TRKA 2GM4A 4QNNA 2IS6A 1PYOA 2XD9A 1X0VA 1U6IA 4WSOA 2VK8A 2JBAA 3L3BA 4KNWA 4E0BA 3ZJ5A 4QQNA 4KREA 4X91A 1V41E 1FDIA 5AK0A 1QRDA 2YXPX 1SZPA 1ONPA 4GR9A 2NVUB 4EG3A 3KEFA 3W5DA 1LK7A 5FF9A 1T15A 3J81A 1ZJ5A 2PD3A 1XEFA 1D0SA 4Q7JB 1JFRA 5FH9A 4E14A 5KOHB 4BNYA 3E0QA 5KMGB 3BMQB 3LQRA 4O02B 2IFTA 4FDMA 3ZV6A 4RTNA 2F1OA 4CM3A 4D43A 2WTAA 1GV0A 4FZ3A 3HCEA 3UJ3X 3G2HA 1X94A 5PGMA 5E95A 2W4MA 2XNJA 3L6BA 2DB3A 3AKCA 4XWGA 5DPMA 1BS2A 5IDVA 3JRNA 4M0EA 1RNLA 1RXUA 1ZWKA 3ESYA 3PNKA 2X7JA 4KU4A 3ZWMA 5J43A 3O1IC 3BD8A 2BM1A 2QY9A 3KEOA 3KL4A 1IG3A 2GAOA 1PW5A 4JD5A 4NG5A 5TPZA 1WKVA 3WBBA 2QLMA 1GQSA 2FUG1 4WXYB 1IG0A 4AJIA 2BELA 1EEXB 1ORDA 3KP1A 5KTNA 4PZUA 2EX4A 5B58C 4K7JA 4M55A 8ADHA 1M5UA 3KYCB 5ALJA 5PNTA 4XB2A 4CU5A 3CM0A 3U4CA 4L02A 1CDEA 5JR3A 2UVDA 1QG2A 1WX1A 3SNKA 1CNMA 1NXWA 2A1IA 4ZA2A 3V1UA 1KJZA 3CA8A 4HT3B 4Y7CA 5KJFA 2Q2OA 3NALA 5ES3A 4G5HA 3Q0EA 1LF5A 2FLKA 4I1RA 1TZCA 4KKXB 5FT9A 3HLTA 1WIWA 3STUA 4EG1A 1NNSA 2KE5A 1H6BA 2CDCA 2ISQA 3SYNA 1Z16A 4BC0A 5B5SA 5LOVA 1RLMA 3O9ZA 4EYKA 3TAHA 1LDGA 4O25A 2R6R1 5CEEA 3V8BA 4GPZA 1OT5A 1EEHA 2P4HX 3NWBA 4TTJA 1KZ1A 5FTJA 4AZ3A 2IF2A 4B09A 4QDOA 1D8TA 3OT4A 5B7NA 2OXCA 1H1TA 4IG9A 1UBOS 1UPCA 3D3KA 4RKYA 4INAA 1FEZA 3ICPA 3JQRA 5NULA 3OQMA 1XLTA 1O3YA 1JA0A 3KYCA 4GGPA 1W4AA 2B4KA 3FFWA 3KYBA 3NG1A 3LHFA 4RYDA 4AKEA 4WOBA 3EMVA 3O8OB 5E8JA 1KE1A 3EZGA 1XBTA 4KH1A 4WVFA 3QVOA 3H17A 2SKEA 3M6LA 1QGUB 4R69A 4HYYA 2C95A 1JEDA 5EGSA 3RAPR 3ZHSA 3CLVA 4ATNA 3LNCA 1W4ZA 1P77A 3HB1A 1DXHA 1Q21A 1WZCA 2OCDA 4LK3A 3OJEA 2IUEA 4OREX 4P1ZA 5TV2A 2JLXA 4CKCB 2C5FA 4DBZA 2GBGA 4P0PB 3PLAE 1HT3A 3R7LA 1LX7A 3TEJA 1RAIA 1TVKA 2RGUA 3DFMA 1XRJA 4KQ9A 4L7QA 4NAHA 5KJ6A 1KA9H 4O8CA 2AKYA 3TQOA 3EOBI 4ZJUA 5G41A 3AUJB 3D6HA 2GJKA 4HCJA 4Y1FA 4PTLA 1ZYUA 4HGYA 1OXBB 4DC9A 4V3CA 5JJBA 1M1UA 5CIYA 4IX1A 1DEXA 2C2WA 2IHYA 3JAWA 4V0ME 4MW0A 3P2IA 4UATA 3QXXA 4EW3A 1PUIA 2I3BA 1S9HA 3AVVA 2X4DA 4BVJA 2E4ZA 4M88A 3VTAA 5KNDD 5AW8A 4H15A 1ZW6A 1QGYA 1EFAA 3PHHA 5K4GA 5IM4A 3N2KB 1XRMA 1KVSA 4KAFA 1GZ5A 4PSDA 4W9NA 2GPAA 2IX9A 2VSYA 3FI9A 5K3BA 3RVQA 1K3UB 3SDZA 3EN0A 3ZW7A 4DMUB 1CU1A 4IJKA 2C4KA 1PJTA 3EFOB 4XCXA 2Y1XA 1O6ZA 3TQCA 3U13A 3LVQE 5CA0B 4IWXA 1H85A 4YCMA 4HC4A 3UXEA 2QLJA 4BJ3A 2HI0A 4QJ3A 4NQZA 4G86A 4PHFA 5BXQC 1N6RA 2B2XA 4TYMA 2VN8A 4HFMA 3K32A 4OFZA 3O8QB 2HUNA 3GUZA 2WF9A 1D0VA 4WY8A 4UTNA 5G4KB 4MUNA 5AR1A 5IAOA 2C2BA 1GNSA 1GQOA 1TUEA 3H9UA 4UBJA 3T7TA 5DNUA 2AUTA 4EYSA 4LRTB 1ZGGA 5AIBA 1CUXA 4GHWA 4LWQA 1KAGA 5KVSA 1AZSC 1PZEA 4EHFA 4Y2RA 3EG9B 2P6PA 3L1VA 1A9OA 3H4MA 4PVCA 3FUUA 4RPJA 2XRMA 3PDIB 3JWGA 3ANSA 3N8IA 1DI0A 1EVJA 2YOFA 4RCYA 4GZLA 1NVGA 2PAFA 2NAFA 2RB4A 5EZQA 1H9CA 1YBMA 4PNZA 3RU7A 2EC5A 3BHIA 2R1VB 4I5GA 4LOJA 3CVOA 5EL0A 3OECA 4AQYB 3HSSA 1BX1A 3MD9A 2PUCA 2FF7A 1B23P 4XPIA 4BQQA 3HM9A 3KBBA 2HU5A 1KMQA 1D7AA 5JMWA 5LD2B 1MB4A 2NZ8A 3EQZA 3NXSA 4QDTA 3PJDA 4DMFA 3D6JA 4W1SA 3FWYA 1D6SA 5BUSA 2VUHB 5JANA 4JWTA 2MSCB 4EB3A 1YDGA 3WLPA 1HGXA 1N8KA 4GPIB 3RGWS 4NBWA 2HF9A 4N0QA 1XDWA 1DIRA 4RF4A 1VE1A 4O6VA 5I3ZA 4G4SP 4IOMA 4N6OA 1ZW1A 1AF4A 1L5VA 2PMWB 4MW2A 4RF2A 4DRYA 4HVCA 1JMKC 4ZZ0A 1MC1A 1WUIS 3CRRA 3DL2A 1G3UA 5DI9A 1WSAA 1C80A 1G3QA 5LKAA 2VDOB 1LD3A 1XQXA 5DVZA 5BUZA 1ML3A 1D2GA 4FX5A 3RSGA 1QZZA 4ADSG 4FEAA 4LDNA 1HH4A 1PLLA 1BS9A 1D2NA 1PFGA 1XT6A 1EFDN 1Q3TA 3GA0A 1FUYB 3IP3A 3IXMA 3K2BA 4HPJB 1X7XB 4M53A 3PEWA 1JU9A 1RZ3A 2J59A 3NHPA 3HO8A 4D0LB 1NV8A 5AM0A 1EFVB 3UV6A 2AHRA 4BIMA 1VL8A 4QDZA 2G9RA 1BXKA 1IZ7A 1E9VA 1NQ5A 3QUCA 4AY3A 5I9TA 1C0LA 1LEHA 3N58A 4FEYA 1D6MA 4HX5A 1DQSA 1T43A 4QLBA 4EAAA 2YWDA 3MAGA 2WKWA 5JXIA 4KR2A 2GN9A 4FR5A 2NUAB 3E4DA 1DINA 2ZSIA 3QLJA 3T4UA 4QFMA 2JLUA 2GM9A 4LJ7A 4PYOA 1S3IA 2C4HA 1GU0A 4NARA 1Y9JA 2GHRA 1E1CA 4IIJF 5SY4A 2ZUEA 1RHUA 4R2MA 5LUBA 4ZOLB 5LDDC 1T0BA 1NN0A 2HV9A 5EE5B 3X44A 1PLJA 4OBXA 5DWDA 2GARA 3TLAA 3A9CA 2FPGB 2Z2XA 4IMJB 4KV7A 1GTRA 2AI2A 2QD4A 1XJCA 4KWEA 4OHCA 1OLSB 3LY5A 3ZDXB 4ZK6A 2YY6A 1YZUA 2M32A 1GKKA 1C1DB 2Z95A 2YL2A 2Q9UA 3OOHA 1FB5A 1V95A 3NM6B 3PV0A 2ZBUA 3QW4B 4O4JB 2NZYA 4R2IA 2VHZA 2Q5OA 1E7WA 1PR6A 3JVEA 1NMEA 4M89A 5JAOA 4PYQA 3PNBA 3ZHQA 3D54D 2QQEA 3I83A 3W90A 2JFNA 1TZJA 2YCLA 1Z2PX 1YQWA 2JLSA 1C3XA 1RJGA 4ZICA 2GBPA 2O23A 4HTFB 4CM5A 3PC4A 4L4UA 5L4LA 3ZCPA 2V7QA 4IOJA 2GKSA 4B81A 3E9MA 3ZY3A 2G72A 3DTVA 4HO1X 3ACCA 4M7OA 4OHPA 5FBZA 3WLEA 2HYDA 4DR3B 3CBGA 1Y3CE 2ORVA 2RJ3A 3CPHA 3GLSA 4RUKA 3VPCA 2WABA 3BE5A 3H5RA 1XJ5A 5CNMA 2EP5A 5SYAA 4AL4A 3CCBA 2WTUA 1GCUA 1K92A 2CXNA 3AEXA 4JR2A 3F3YA 5L45A 4RTMA 1DBSA 1U0RA 5CU7A 2VBGA 1YJ8A 1G8YA 3H4IA 4DQ0A 3LYHA 1X7WA 3DT6A 2PHZA 2BKLA 1RXYA 2R8PA 3LYAA 5ESXA 3U5ZB 4HDQB 4IJ6A 2NTYC 4P08A 5I47A 3EF0A 1M2JA 3QVMA 2F43B 2AW5A 4N7RA 2G6BA 2D7CA 1HV8A 1TEXA 3RS2A 4L78A 2BONA 4DREA 4IDPA 1S7CA 1TVEA 1XIVA 2IHBA 4HB3A 5AM5A 2C0CA 2G8LA 4BVAA 1W2GA 1EB9A 1RJEA 3B1FA 3RVOA 4AYWA 1XVUA 4FJ1A 4N39A 1DIOB 3W1EA 3EIUA 1E6KA 1H1DA 2F1RA 3BGOS 2VRNA 3JRWA 4IHKA 5G0TA 5LXTA 3R5XA 1KZ4A 1DBQA 2ZIEA 2HX1A 3P27A 4CT5A 2Z43A 1N2BA 3PPIA 4JSTA 3TZ6A 4NHOA 4JL5A 4H3KB 1M3SA 5KNLA 1P6UA 1FU7A 3KT6A 4EFDA 1GZDA 1XZEA 4IDHA 1HDZA 3PIRA 4R5MA 3W4IA 3EUWA 4Z99A 4R8SA 2HO5A 4LYEA 3VDMA 4P34A 4NR0A 4DCJA 1U3CA 5B3KA 2ZRMA 1RYEA 2QUBA 4MK4A 3SHVA 5C3UA 4A16A 1FVHA 4XVHA 1S3FA 2C29D 3DV2A 4DILA 1E2FA 2H29A 5CW2A 5C8VA 4D8YA 4LWZA 2DFLA 5JD3A 2VHXA 1B8PA 4J4TA 4MR7A 3REQB 3OWXA 2BF7A 4N54A 3V6MA 3KALA 4B73A 3K09A 2GEBA 3ORHA 4MR7B 3REQA 5GZ1A 4L1KA 3D0RA 1XEWY 2BZSA 1UINA 4GX0A 2PXHA 2OE2A 4O2LA 1ESDA 1W88A 4WERA 5AI6A 5LYJA 5D3MB 1E6CA 3T06B 1U0BB 5JH7F 1U28C 3RYHB 3Q7QA 4WZAB 1ZN2A 2A5GA 3JQPA 3I4CA 1H2EA 2IQIA 1Y81A 5E6UB 4FUTA 1FU4A 3T9EA 4UEWA 3OIGA 3R8XA 3WICA 5JRDS 3F6EX 1K4KA 4C7XA 3AY3A 1VJTA 2GERA 1KRXA 4YACA 1O4VA 1F8UA 4P3YA 3K5HA 2A14A 2PUVA 3KJIA 4IVNA 4Y3UA 2P3OA 1BWSA 3IP9A 4KYUA 4RD2A 1KKMA 1K5GA 2YTZA 4QYTA 5DTMA 4E5NA 5AUOB 5C51B 2BLNA 1QZXA 3P96A 1SG6A 4AXXA 3OWHA 1YO6A 3F0TA 5A7GA 5A9SB 1XV5A 3RVJA 4OP3A 3GGPA 3D1VA 2BTQA 4M1EA 2ZAGA 1KZHA 1P75A 5TT0A 3HHPA 2UVPB 4FC6A 4QYIA 1AM4D 1GTL1 2JFBA 3PQEA 3E35A 2PLNA 3MLAA 3SYRA 4V0QA 2ZJ4A 5DLQC 3W8EA 3NHJA 4FIZA 3NHUA 3VSEA 1PJZA 4KOEC 5CB6A 3KV1A 1TK2A 4JXXA 4RM3A 1PE0A 4PHHA 4Y2UA 4H7HA 2XQFA 1C8KA 2GZSA 2J9GA 4MCIA 3TTTA 1SHUX 2XRFA 3PQ2A 2Z2KA 3WP1B 1TLFA 1YJQA 2GVNA 1UF9A 2FPSA 3H2ZA 2AE2A 4K2HA 4N3GA 5CA1B 5I4KA 2W4QA 2AR0A 3AU8A 1C0IA 2WQZA 3LCCA 4TS3A 3N2GA 4KQCA 2UYCA 1L4LA 4QHTA 1YK1A 2ID4A 1IJKA 1XPOA 1TCAA 2W6CX 3KB1A 2VPZA 1WKBA 1AO3A 3UJCA 4ECAA 2BUAA 2RC6A 2VYVA 1F48A 3A9RA 2CE7A 4KBYA 4TV8A 3EZ7A 4KR3A 1USIA 1ZLYA 4UZEA 5DZSA 4LXTA 2HXSA 2BFDA 1MJGM 2XCSB 1O96A 1NUSA 1VLQA 4O2RA 3OHSX 4FOSA 3NI2A 4TTIA 1JILA 1OV6A 2PIAA 2PVSA 3D43A 1T24A 3AI1A 2ES4A 3ZWXA 1OXXK 5JQWA 3GMTA 3K70D 3NBUA 3T52A 1KE2A 2DQKA 2HNAA 4MUIA 3SC2A 5FAKA 4S1OA 2JGNA 1IY0A 5CR9A 5FOVA 4CEJA 3QF4A 3HP7A 2J0UA 1Z36A 2I03A 3D5EA 2OXTA 2IZZA 4HFNA 3VZCA 1Z6AA 4XIGS 2CMDA 5CDSA 2IS1A 1LPAB 4FW8A 2ZXUA 4IXTA 4Z0NA 5HKKA 1FFXA 1YTUA 3BK2A 3A06A 4Y6LA 4KPGA 1EXMA 1DIGA 3SQDA 4OMUA 2GVDC 3BGVA 4R9RA 3MJFA 4U00A 3HKDB 4M8KA 3U4GA 2TYSB 5B57C 2RC5A 3C3KA 1DNPA 1OCEA 3W5UA 1J2UA 4LXQA 2XSZA 1T8YA 2YMPA 3SZLA 1GCOA 2QUZA 4M83A 1E1YA 2LCIA 4P38A 2XMSA 3HR7A 3UV3A 1LQ2A 3JQCA 1QHGA 1T2AA 2WFLB 3N0VA 4UULA 4L72A 1WW2A 1U0EA 3BWMA 3GYGA 2J07A 1QTIA 2ZRKA 2VC2B 5C37A 1HUQA 1NY5A 1QDUA 4J6FA 3UAWA 3MMZA 2FR8A 4I7EA 4R16A 3WHKA 3ZHBA 4QT0A 4GKKB 3ZH2A 1WL8A 3ZD9A 2Y77A 3C5WP 1N0VC 3PKIA 3PR1A 4WESB 1R6UA 4X1IB 5CP8A 3BXPA 5BQOA 5LQRA 1XHFA 1X2EA 1XSEA 1MX9A 1DDOA 1SIUA 2Z98A 3C6QA 4AMBA 2FWJA 4NCKA 4RX1A 3T3OA 5I6DA 3DOUA 1SIWA 3L6RA 3HA5A 4Z4IA 3MFQA 1V11B 1EYZA 1X6VA 3QHPA 4KK3A 5KBYA 4WZAE 1SBCA 4XUCA 3LUCA 1Y8RA 3ZCVA 5CB4B 5ELXA 2XDAA 3FSJX 4RYLA 4YJ2A 1SXQA 3AKZA 1GZUA 2EKQA 2HJGA 2JRCA 2D2XA 4XASA 1VP9A 3ZE9A 3E2MA 4YO7A 1VMAA 1QHFA 3H3FA 4KO1S 1JEQB 3DS8A 2C77A 5LQKA 4DYDA 2EAUA 1XE3A 1NNI1 1NWCA 3AI3A 3HEAA 4BFSA 3JVVA 1JIVA 2C5LA 1XRNA 4A82A 2DHCA 2XQGA 1AQYA 2WAYA 4CMCA 1B73A 2C7VA 3OZFA 2CWWA 3B48A 4LX0A 4X24A 2OO3A 3C41J 3TFOA 2IXBA 4MVJG 1T9BA 3UOGA 2BGRA 4FEGA 5BOSA 1XROA 5DN9A 1XJQA 3UPTA 1NVVR 2V55B 1G6Q1 3CX6A 3F7TA 4XPIB 2AJTA 1SKQA 3COPA 4HLUC 1LVUA 2WVGA 3GUYA 3O4HA 1NXTA 4R9UC 3AM5A 1XEXB 1XRLA 2HIAA 2J08A 3AJ9A 4N1AA 2X1HA 1WOMA 4ALIA 2XTNA 4KAJA 3S81A 4ZYTA 2D5AA 5FA5A 1DQYA 4MYCA 2EW1A 4A0FA 3OZWA 1EQAA 1XGKA 3DMFA 3S3TA 3KB8A 4E2WA 1CR2A 1GR0A 4IDFA 2WMYA 3RHFA 5KNBH 1DAGA 1Y98A 1NBHA 4XIYA 1FUUA 4JL6A 2J9XB 1R5OA 2AF3C 3FZGA 5JZMA 3W5CA 2IIVA 1JVNA 2OHJA 4G07A 4E13A 3ICEA 3LQ4A 2GFQA 4ND6A 1Z38A 3GLHA 3RV3A 1SBIA 3O8QA 4B4DA 3TKYA 5LP6A 4B76A 3CLSC 4E07A 4HQ6A 3DXZA 3C3WA 2GVZC 4AI6A 2ODEA 1I01A 2R8XA 4BXOA 4REMA 5KYXA 4KR7A 1G4HA 4JDUA 1H2AS 4I4TF 4O4LF 3IOBA 1U2EA 4GVPA 4WXRA 1VJ0A 2H0RA 4ALLA 1FMLA 3KUUA 1JHPA 3N07A 3P9YA 3B6MA 2WRZA 3HDTA 4REQA 2VIIA 4MKXA 1ZDMA 3GLVA 3G2IA 3ETNA 1O5OA 1T9ZA 1LSSA 2XUGA 3MXTA 3AF1A 4ZP1A 5HYVA 5KHLB 4RTSA 1V8ZA 3IQDB 2XUDA 1VL2A 3JW8A 5J5CA 5CT5A 2RKBA 3G5LA 1WD7A 1XA3A 1MOSA 2W48A 5JXJA 1YRWA 3MYYA 3D2AA 1IDOA 2QZJA 4CT4B 2BHSA 5JFGA 5L51A 3LZCA 1SKYB 4HTAA 2G08A 4D57A 1U3UA 1Y7IA 4FE3A 4MWCA 5IEJA 1IAVA 2IXEA 2QTZA 1W73A 3NORA 2TRSB 3IOEA 4G4SO 3RQSA 5B6PA 2O54A 5TF0A 5K6AA 3W3AH 1U2SA 3ML1A 3ZE6A 2NZVG 2JFQA 3L04A 4G1CA 1C3LA 3CRVA 1HSZA 2WYWA 2A5DA 2C4MA 2P11A 5I9NA 1A9PA 4EHKA 4XDYA 4G67A 1LLFA 2ZDQA 4HOYA 4S1PA 4F5EA 5M29A 3CWQA 4M99A 1QCDA 2YH2A 5EWJB 1M2GA 1Z8NA 5BQ5A 4LWPA 2BEJA 2IUTA 2NSHA 2JFWA 3QJ5A 5EXTA 2JRLA 1IMOA 2HT6A 4RVGA 1AGXA 3X1YA 2ZE5A 2XE8A 3ED1A 1F8FA 1O03A 2R5FA 4AN4A 1TM4E 2J87A 2EYQA 3RC7A 3NHLA 3TMYA 1IXRC 2W83A 2OGWA 3K6KA 4NHEA 1IBLB 1AY0A 4G8BA 3C6XA 1WPXA 2I3AA 4HRAA 1GZHB 3VNRA 5EI5A 4Z2YA 2BSQA 3O8CA 2W2PA 2QZZA 4L75A 3GBSA 3RVSA 3OVMA 3QPWA 1YS9A 3FHCB 4FEEA 2PWAA 3EPPA 3N70A 4I50F 4U2FA 3W6ZA 2CNWA 4Z7OB 1BEUB 3NOXA 2BEKA 1OC4A 1QGAA 3U81A 5IS2A 2ACWA 2GAJA 2WC1A 4L57A 3T4XA 4B17A 1ZSNA 4I4NA 1N1DA 4DWJA 4HQKA 2QVBA 4BWYA 3KUCA 4F2GA 3OTWA 1QTRA 4ZN6A 5CD9A 1LFAA 3PJRA 3ADKA 3NIGB 1PJ4A 3ANYB 3QE2A 1GM5A 1PUJA 3LGAA 3OF2A 2IU0A 2ZI4A 3UJ7A 3ANTA 5A3SA 4YGYA 1K5HA 1V43A 2JFGA 3M6FA 4RELA 3WLIA 2XADA 3O3NB 3ST7A 5KINB 4U0KA 4YLGA 5ITWA 2PR7A 2AC7A 2I78A 1CUFA 2A3RA 3JQ7B 3OJ0A 3JSXA 3P1JA 4H6VA 4GD3Q 4OHUA 1JPJA 4HNQA 3GLHE 3LO5A 5EINA 4ZEXA 1KQFA 4OLAA 4LK2A 4COOA 2YINC 1VZ2A 1NSTA 1KAQA 2KLHA 3G79A 3PEUA 4FYWA 4H7IA 4J91A 1EK2A 4S1NA 4JI5B 4XFDA 4M1KA 1PZFA 1E66A 1XRSB 1Z12A 2O3RA 1CLUA 4HDNB 4K1LA 4OLJA 2Q6LA 2PX6A 1LNZA 4YPFA 3VO8A 3M2PA 2HK9A 5HG0A 1DHRA 3ZI4A 3N2KA 4LN1A 5LB4A 4CMEC 4AO8A 1JLHA 4NSNA 2WEKA 3OLWA 3K4PA 5DYGA 3VH2A 4D56A 1OW3B 3DSRA 4PQYA 3O7WA 2IX3A 1JJIA 3G02A 4FZJA 1N6NA 4LTMA 2R2GA 1RWXA 1H2FA 1ISGA 2JLQA 3F7NA 1ZRNA 1PYGA 4JNKA 1KIAA 1I5OA 2DUMA 4TTVA 1C1HA 1XO1A 5FTKA 5JVDB 4C06A 3AINA 4FR2A 1L4UA 2YUIA 5ALKA 3RS4A 1N9ZA 1BGVA 3VTFA 3G7UA 2GYYA 3HKCA 5JD4A 4O63O 2I6FA 4Y7DA 3L8CA 3ZGZA 1CV2A 3V4OA 3OY7A 3TQFA 4TM7A 1F3LA 1JQBA 2DSNA 2XMQA 5DCUA 3W79A 2DKOA 4WLUA 5IZCC 1KYZA 4C0SA 4DPKA 3K1AA 1ETHA 3ITKA 3LZDA 4R7ZA 5ALIA 4FYMA 3WWOA 5CFOA 2QDXA 2G1UA 2J41A 2Q0QA 2XMBA 3CUWA 3OQPA 3RTBA 5HKBA 4NDAA 4D9FA 1U5CA 4WNIA 1D04A 4IGEA 3ZCXA 1BU8A 2PRJA 4MI3A 4KLZA 1OOEA 2R66A 1RQGA 4EY5A 4ZCRA 2QUHA 2D0PB 4WA7A 3DBHA 2JGMA 1S8NA 5KHOC 3CF6R 2XPCA 4CIAA 4PBSA 3UAOA 4I4CA 2FFQA 2C9OA 2X6RA 4TSFD 5H3CA 1CY1A 5CG2A 5IKPA 4IG4A 1N77A 2NOAA 1G59A 4UVGA 3H2KA 1P4SA 3G0OA 3HNRA 4C2TA 3MCUA 4CM4A 3VU8A 1RM0A 1QKJA 5ALLA 1LK0A 1N8NA 3NYWA 4UDOA 3PUKA 1CBUA 2NMVA 5CLJA 2HSZA 2ZB8A 3IBCA 4XWTA 2GI4A 2X5NA 1A82A 3IE1A 1OBCA 4L3OA 3JASB 1X1BA 2I22A 4M0DA 1MABA 1M75A 1WEHA 1BMTA 1YKGA 4TLDA 3Q85A 4AZ0B 1AUOA 1W36B 2VZ0A 1Z45A 4BO8A 3UJBA 3M6XA 2CC2A 5FNVF 2A35A 1AHNA 1BE0A 1A9TA 3DBHB 3MILA 2I71A 5CPFA 3WQSB 1X8KA 4ZYVA 1P0PA 4YJGA 5CGQB 1WLSA 3FMVA 3QW2A 2PH1A 1WU7A 2ZSAA 2JGDB 1LPMA 4NH4A 4ZDWA 4G37A 4QM7A 3OUTA 2SECE 3AEZA 4PLTA 4MRMB 1Q50A 5K03A 5HJ5A 1HEIA 4JJ6A 1DTWA 4BAGA 4OBWA 2C1ZA 4U7DA 1VPDA 2G77B 1SA0A 2YVKA 4HAIA 5B1YA 4PLFA 1IBSA 1TRKA 1H3EA 3AF3A 1QLWA 4K9SA 3NVDA 5D8DA 1FXSA 1ZGHA 2H2DA 4ZI2A 3OT1B 2ZRCA 5EP1A 4B8YA 5E4TA 1SUWA 2NXEA 4N7MA 4Q93A 2GD6A 4MA4A 4OB7A 3LJKA 4AU1A 4C7VA 2II6A 3LA6A 2G9ZA 3HVUA 2QM3A 5GVSA 1KBOA 5DTRA 3P0JA 3U3ZA 4ER5A 2WYHA 3UB2A 4EHLA 2DFKB 1ZZEA 4E11A 3UT0A 3EPHA 1G5HA 2CFOA 3B5JA 3NH9A 2HIHA 1UXKA 2AFHB 1CUCA 1OGJA 3NH6A 2EP8A 5GP1A 1C7ZA 1CQPA 4DJEC 2YHIB 5L4NA 1WXFA 4LWOA 4JQOA 1LLQA 1Q1AA 1V45E 2OXEA 3QNMA 3HJGA 3JCZA 2DTDA 4KRYA 4KSBA 5EG5A 2PLWA 5AVXA 1LH0A 5A2GA 1VPEA 5JPCA 3TG8A 4GMHA 4ZCLA 1FXUA 4HMPA 4AMGA 2J0VA 1FTGA 2OGSA 3ZQ4A 3EIQA 2RCYA 2IYEA 4QM6A 2CVOA 3I5UA 3ROGA 5HA5A 3SVZA 4RULA 3DEKA 4FNGA 3THYB 4ZGGA 3LLVA 3DUWA 3X1JA 2Y76A 4XQ9A 2YR0A 1C3EA 5E6RA 3T41A 1RJDA 1H5QA 3QFTA 4AX4A 5KYNA 2GJ8A 4GM1A 1YDFA 2G1JA 3AF4A 1HE8B 1D1PA 4FMPA 5FNZA 1BFUA 1OWNA 1ZCBA 2I0FA 3HXQA 2D6FA 2QZ4A 1CRWG 4A6EA 3NGMA 3GLIB 1N2CE 2Z2YA 4MWOA 2RJNA 3UV7A 4UEKA 3W05A 1B1AA 1ODIA 4K28A 3MGBA 2RAVA 3V1NA 3A6DA 1UFVA 2OMEA 4TV9B 5EIEA 4GI3A 2V58A 4QBKA 4E2YA 2EW8A 4UQLA 3L82B 3S4YA 4EHDA 5D3ZA 3ZPXA 5JFTA 3U7HB 2KHZA 4B74A 5CEFA 1A76A 5LOVF 2JI8A 3L7YA 3GFSA 1EBBA 3W5BA 2BSXA 4PXYA 2VDWA 3KDPA 4R51A 1L5ZA 2L19A 5JZ9A 4ZZIA 2ZRBA 3F8SA 1O6CA 3CLTC 1CZHA 4MOWA 5HTKA 3S27A 5IFLA 4AWBA 3R5SA 3RRXA 2OZKA 4MDYA 4GKBA 4X71A 2Y67A 1XEAA 4EKDA 3GD5A 1T5TA 2GUWA 4NPHA 4RH1A 1N57A 3K2EA 1PS0A 4RLQA 5HJ2A 1IPFA 4MW6A 1UM8A 1IY1A 1ZH2A 2E48A 2PEZA 1NI4B 2HWWA 4CLHA 4GZ5A 5CFMA 4CLRB 3K0FB 5A9TA 4ZTBA 1L5OA 1MHPA 4GPTA 3ZIUA 5FTWA 4HWOA 2CUNA 3ABIA 3ZK9A 3JARB 3A04A 5FI5A 2I4TA 4DMMA 5KX5A 3HKCB 3SJAA 2B98A 4EJ0A 5HIAA 1R12A 1XPJA 2ZTMA 4ZQFA 4PHTA 3B85A 5HM6A 1T1SA 2IBMA 4LXUA 5FD8A 1AKMA 1YIDA 2OYSA 3K0HA 3O3CA 3RUDA 4AZTA 2XI4A 5JVDA 1N2CA 2W2XA 4G23A 1PT5A 2OEPA 4XM2A 5LCXA 2B1IA 3NBXX 2FPLA 1P18A 2PT6A 2Q29A 3MD0A 4TL6A 3RABA 1B15A 1V5IA 3EAFA 2BMJA 3FYHA 3K0EA 1USWA 1ONSA 3IBGA 4DLUA 5CVVA 4D9IA 5IW8A 4BKPA 4BJ5A 5H1YA 1FDVA 1WZNA 4OV6B 3WNVA 4YDQA 3A36A 2PE5A 2CXRA 5D00A 5ELMA 2WFAA 1LQUA 3T3DA 3KXDA 5DHAA 5HF6A 1KYIA 1YGYA 2JEOA 1AQ6A 3H05A 2IU6A 4BASA 1M2VA 3KT0A 4PPFA 3VUFA 2XCIA 3AV0B 4CKWA 5LMUB 3RODA 3ZWQA 3HVKA 1V7ZA 2O2SA 1P7VA 1D5WA 2OCGA 4FNOA 1HORA 2BY4A 2LDBA 4AQDA 3O4JA 2EJBA 2YXDA 2E4UA 4HB0A 3T35A 4KJXA 3HM2A 3AW9A 4C05A 3M6AA 1Y6QA 3M5PA 1K2WA 2BFBB 1E9EA 3AR8A 3JU3A 4ZCSA 1XZAA 2ILTA 4OJNA 2RG7A 3ZZ0A 1RBMA 2PGIA 1PDOA 2B34A 3PRYA 3E9ZA 4NZZA 1KQGA 3BFKA 1H22A 2O9JA 3LRXA 1AO0A 2H7VA 3HSYA 1NRJB 4CUZA 1FP4A 3ILSA 2P7IA 1Q6ZA 1I30A 4M1TA 3RUFA 4I81A 3NJRA 2JI9A 2VK1A 1KJWA 4GVLA 2QSJA 4MWSA 4KXFB 1Z4JA 1N5RA 2DQ4A 4IZOA 1QK4A 5EIAA 1KDYA 3ZGVA 4B8ZA 1XU4A 1IK6A 5BOSB 4O3FA 1NBME 2IY9A 1ZXXA 3LLSA 1UBHS 4AX8A 1PBNA 3N0WA 1QPBA 4EELA 2FN7A 2GN1A 2N47A 3OIVA 4JZYA 1HDXA 3V1YA 4C4XA 4BRWA 3R9XB 1CG6A 4EQ6A 5KQPA 3EFEA 1EUYA 2EQAA 3DD5A 3TN7A 3WLTA 4BB5A 3SXUA 5EIXA 3IAM6 1G8HA 1HC7A 2Q9AA 1YB5A 3IUQA 3CKMA 2HWUA 1KEVA 1P2VA 4RA9A 1XCOA 4RGYA 3GJ3A 1HT1E 3R41A 4GNKA 3RSCA 3VNVA 3RUAA 4Y1GA 2OLKA 2GD2A 1FPQA 2H4YA 2YWXA 3DEJA 2EL7A 4MJ3A 2I9PA 1JMVA 1QQ5A 4HVTA 3ZY2A 1YUBA 2WJ3A 3O8BA 4MV7A 3IA7A 2R68A 1VHJA 1WQ3A 2DVMA 1B0PA 2NUPA 1O0CA 1RYNA 1MF7A 5TMPA 3JQBC 1SU7A 1ZMOA 3NAMA 4TS9A 4BPRA 4LJLA 2RHJA 3VR3D 1Z0AA 3BH7A 2FQQA 4WOKA 1GRNA 1VZ3A 5A04A 2ZCJA 1DWOA 4IXMA 1VKOA 3FNEA 4HYTA 9LDTA 4HXYA 2PFSA 2J3EA 1YZYA 1N2IA 1JKJA 1Z2DA 2LR0A 2OHHA 2ZKIA 2TSYB 1HG1A 3IKJA 1RKXA 1WZUA 2PT9A 2XVYA 4I5EA 4UDNA 3VZPA 2Q41A 2WMNB 3TDNA 2R8BA 4TPKA 3TK1A 3PD0A 1X7GA 3SQNA 3HFGA 3OZVA 3D3WA 3ZLVA 1UXGA 2XTZA 4UNRA 3VJRA 1SOWA 2VYVD 1R6TA 5AKEA 5CA1A 5F3DA 3TUJC 3QGMA 4RVFA 2ZJAA 3IQWA 3MCWA 2N3ZA 2B9VA 3ETEA 1NKTA 1XAHA 3DEAA 2B0JA 4L6CA 2LP4Y 3LK6A 4U3JB 5K2OA 4RS4A 1AUPA 5IJXA 3ZXYA 4BP3A 1ELOA 2PUGA 8MHTA 4U7JA 1QWSA 3ENWA 3PK0A 1CQJB 4KX3A 2A94A 1QIFA 1T8RA 1L4MA 2V7BA 3ZY6A 4QULA 4DJ5X 1X2BA 1Z4PX 3GFOA 3HY4A 1RRVA 3K09C 3KPJA 3SQLA 2FEKA 3PFWO 3AONB 3EOAI 3L7IA 1M2FA 2XZTA 4U5QA 3MS4A 2HXYA 1RHQA 2X22A 3D0OA 2YWRA 4BMDA 4Q05A 5KTYA 3BH0A 2PT5A 3INNA 5J5VA 3W5VA 2VWGA 3DHNA 1JPNA 4FBGA 3TRFA 1EUQA 2J3IA 5HK9A 3MJ4A 1V39A 3GGOA 4S24A 1UK9A 3E9QA 2ID8A 4HWGA 3FUXA 4GEGA 2DOKA 4NFHA 4UTOA 3IKLA 3RK1A 3UMJA 2CCJA 3VDXA 4A36A 4OJKA 3RBXA 1I6KA 2EFEB 3G9TA 1X80B 2I66A 3AESA 4WOCA 1YH3A 3PQ3A 4M0CA 5A4AA 4ZALA 1C4KA 3BAZA 3KQHA 3IQHX 1R5BA 3R76A 3IVRA 3A9UA 3NOVA 4BP8A 2QB5A 1WF3A 2VDNB 2XT0A 3IP8A 2CJPA 1WRBA 3VOTA 3K5PA 5AM2A 4AUNA 1F2VA 4O2BA 2O2XA 5CW1A 1GPYA 2OD7A 3FJOA 4UHCA 2FNAA 5AW1A 5FUMA 2GZ1A 3D5QA 5HCUA 1EKXA 1J1IA 1TU3A 1QLJA 1YGPA 3KEGA 4KVAA 1KOLA 1V8DA 4B9EA 1HEYA 2NU8A 4JT9A 1L9XA 4QEZA 5L6MB 4P84A 4V03A 2PTGA 4YCAA 2YRXA 1U4OA 1Y6ZA 5DI3B 1R3UA 3AR5A 3G9ZA 1XXHB 4KNYA 3L46A 3CVYA 5ERYA 3SJ7A 1I10A 3K1ZA 5HRUA 2PJDA 1GD1O 4RZHA 1DBIA 3DAOA 5DE3A 3EVTA 2QRLA 2P90A 1GA4A 4HJXA 4K8RB 1TEVA 2JGEA 2QF7A 2Q3LA 3EXFA 4MGYR 1O95C 3V2HA 3V9AA 5DEOA 4BN0A 4EKNB 2J3KA 3SU8A 3P32A 3CB4A 3VR4H 2V74B 1NRXA 4HQRA 5L7YA 3RC2A 3DBOB 4AECA 1UDAA 2A3NA 1O5TA 4JCCA 1SHLA 3NGLA 4EIWA 2PXAA 3N75A 5CITA 1XLWA 3C1AA 4GGMX 1TIPA 4JEUA 1E0JA 3MJDA 4ZKEA 3NIWA 4FLEA 1NXSA 4D92A 1QG6A 5HUQA 3GUCA 2VDUE 5BYJA 1GYQA 2L42A 2C00A 1L5GB 4ARZB 4ESVA 1J1UA 3I8XA 4JLSA 2AK2A 3PNMA 5D5QA 4BKRA 5KSOA 3L8MA 4PG6A 2H5LA 4BBPA 1NXOA 5C1PA 3DE1X 2JCVA 4LRSB 4PIVA 2VHWA 2C5AA 4R0MA 4JI7B 4GICA 1K6JA 2CF5A 1C1XA 5BSWA 1C3VA 4DCPA 2QRHA 3UWPA 1NMQA 3EUAA 2J3JA 1NQXA 4WK0B 2NPFA 3WGLA 1H2WA 2IEZA 3IDQA 4LDZA 3HJAA 3LFHA 4JJFA 1PX0A 1P80A 1ENPA 3QUSA 5CDHA 1I2MA 3ROMA 1M2HA 5EVJA 1MA3A 4JGIA 1N2SA 1MD9A 4R1MA 3CSDA 1WB6A 4NMXB 1YR8A 4BX3A 2R4TA 3ND8A 2GETA 2I6SA 3C7KA 2P4EA 4DANA 3UCXA 4WCFA 4QTTB 1ESMA 2VQ3A 4LKOA 4YRLA 3R74A 1BRMA 4XX0A 1GGKA 3TOSA 2DGDA 1O08A 2ODAA 1NV9A 5IUJC 3NW9A 2NVBA 1EDEA 2WIBA 4FFVA 3WLFA 3TNJA 4QIHA 3CNQS 4D26A 1CUZA 4HATA 3TO5A 1TL7C 2WAXA 1QFYA 4KGDA 4TMWA 2EG5A 2RBEA 4RK7A 4HNVA 3EIHA 2PZGA 3WADA 4QTYA 1KYWA 2ZLBA 1ZU4A 3I12A 4X7BA 1TYAE 1XFAA 1D9XA 3I58A 3VYSB 1VE5A 1PR9A 2Y4NA 4Z3DA 1PV4A 1JR3A 5K9ZA 3LC0A 1Z29A 3ZK7A 3CEJA 1XJ0A 5LQJA 3A3PA 2P75A 5HNKA 1Z8FA 4YALA 2VHQA 4F8YA 1B2RA 2H2WA 1GOTA 1L3CA 1S0UA 1ZRMA 3CLRC 4R2LA 1Z4OA 2X14A 4WDRA 2ZFUA 1APBA 4NBLA 3DE7X 3G2QA 3X1XA 1ODJA 1SHKA 4JVMA 2ZTHA 3I64A 5JXGA 2W6JA 2IW3A 4WCFB 3RYTC 4UOZA 4CDMA 1IU9A 3H2SA 4XM0A 5FPSA 5G1NA 4M3NA 1KERA 5K0TA 3E05A 4DQXA 1YC5A 1PQPA 2B83A 3BTSA 3ZD8A 3N9IA 3ASUA 1PNRA 3B9RA 3L8HA 1LBSA 4ENQA 1NNEA 3G3EA 4P81A 2VWPA 1ZM2A 2MU1A 1VI6A 4QPZA 2X1LA 2XYVA 2CFIA 2ZRLA 3VVMA 2FWRA 3H65A 4ZIRB 5D84A 821PA 1L7EA 1QJ4A 2Y9MB 2B5WA 2YYYA 2W6JD 1RWBA 4YROA 1MDBA 3IB6A 3VR5H 3ZWCA 2DPGA 5ITVA 3DQQA 3QBDA 4YT2A 1F8XA 2QTLA 3I1JA 1G8JA 5F1OA 3E22B 3RW9A 2R6HA 2X0RA 5BSTA 3LRTA 1ZEJA 4B3RB 1RJWA 2IZ5A 2OYCA 3WYDA 5AFSA 4JELA 2HCBA 4H08A 5EJIA 1HE2A 1XL0A 1UC9A 2P2NA 4H7DA 3W2GA 6CHYA 3M70A 2PGXA 1VIDA 1WXHA 4F71A 1NW5A 2A92A 2DUWA 2I4NA 3KUDA 3ZXSA 5LM3A 1GSAA 3JQAD 4M37A 3R0XA 4MUBA 4W5RA 1N9KA 1XWWA 3EGDB 1FVFA 3TNDA 4HD8A 3U3MA 3UKDA 4L8LA 1QP8A 1SQ6A 3S29A 4EECA 1U7OA 2V6BA 5KEIA 4TS1A 3EY4A 2OFXA 1NVMB 2V4UA 4ND3A 4W8HA 2P0AA 2EOAA 4M86A 5EHXA 4KLAA 2AJLI 2CXHA 121PA 1RPTA 1QRRA 1KJ8A 1X9IA 3MRTA 5AK3A 3THWB 2AZMA 1EP2B 1YDWA 1H2BA 1FX0A 4N8EA 3L43A 3QVGB 4C2AA 4OH1A 1VGVA 3BWVA 3MZ0A 2REBA 3MBKA 3ZW8A 3A3NA 1HL7A 3ZJYA 2VXCA 4ARIA 4D4GA 2FWBA 3D4BA 4RKQA 5KCZA 2R1TB 3AEYA 2QJTA 2ZB3A 3WL8A 1YRBA 1M6WA 3OKPA 4L22A 2DZDA 5K6TA 2JJ1A 4Y9DA 5JNWA 1JXQA 3J80A 2P9EA 2WU8A 1UANA 4MEJA 3RWMB 2NN3C 4NIMA 4N12A 3ZXUB 2D2FA 4XOIA 4Y0NA 1JAHA 3MWJA 4CIYA 1XCBA 2O8EB 3M4XA 3R0ZA 1HDYA 2FSVA 5DTIA 2GGSA 2YZMA 4EVRA 3V34A 3H5IA 3MN1A 3RFVA 1N7GA 3M89A 4LC1A 3GZTB 5A05A 3DL0A 1NBMA 1JLLB 4V0KA 5AKLA 1MXHA 2NPIA 1ZC4A 2ZK7A 3LV8A 4JSRA 3KAQA 3H5AA 1ZPDA 2HDHA 3T7RA 3TOXA 4NFLA 4F38A 3AIIA 3DMRA 3OD1A 5JJCA 5LL6P 4ZO7A 4FFLA 3PNQA 2QW0X 4MYHA 4Y6PA 1G5RA 3ICCA 1NF3A 1U5AA 3U7IA 3S6JA 4PGGA 4LRYA 5DT2A 5A7HA 4DLWA 5KYWA 3CJTA 1T3SA 4NZMA 1P17A 4Z8XA 2Q50A 4CR6A 1IB6A 3A6LA 2JGKA 2BP7B 3H5NA 3S8EA 2CVZA 1WXWA 3USES 3M6VA 1IK4A 5CA0A 2YNMD 1BKDR 3V7WA 5BY2A 2X77A 4OQZA 3KVVA 3NBYC 4ZYYA 1ZUHA 3OQ1A 5J4VA 2IVFA 4RMGA 3KB6A 1K6EA 2Q3FA 3BORA 3RTAA 1JHUA 3OEED 3R3XA 3UGJA 2G70A 2O8DB 1RPZA 2WWIA 2X0NA 2AUMA 4MS4B 5AVYA 3A1EA 1IONA 2W2OA 1J07A 3U9TA 1RI4A 3L06A 2ZI3A 1X15A 3D6NB 3MEQA 5E4JA 4PC1A 5DNCA 3LCVB 1T26A 5TS3A 4X9XA 1KI2A 3UCEA 4EYGA 4HNTA 5F9HA 5GZ6A 2QQGA 4WKGA 5F52A 1TF5A 1BEEA 2HMUA 2YVAA 4YA6A 1T0PA 1Q74A 5EPEA 2P62A 3UHFA 3GFPA 4I1VA 3A6KA 3PDIA 5AK4A 4IKEA 4CLOB 4EP1A 3PRKE 3RS8A 4MQLA 4KIFA 4DG9A 4G0OA 4CUJA 3MOSA 3U3JA 2H06A 2ZBRA 3EWAA 3FZQA 3TRIA 2Q8NA 4J1NA 4UJ3A 3PUYA 2BHRA 2IYRA 3JRXA 1SMKA 3OE4A 3GMDA 4QBGB 1U7XA 3IVXA 2X0KA 5ALXA 3D4OA 4KQGA 1SULA 2E9SA 3JZAA 3N8GA 3HJHA 3IBFA 4ZVUA 1E5QA 1UM9A 4N4AA 3ZHYA 3PYXA 3H04A 3MJCA 3QFFA 1JIIA 5HK8A 3IAM1 1DUIA 2IHKA 3G9XA 1T5LA 1IJFA 1I1OA 2QNRA 1VKRA 3RYCB 5TR9A 3L4BA 2B4TO 1BW9B 1NYRA 2WA1A 4DAOA 3KTFA 1BDHA 5ESRA 3FIUA 1U0TA 4XVRA 3MG9A 2P6RA 2ST1A 3LF1A 4AIRA 5JSZA 5K8CA 2D7DA 4I08A 4RQAA 2W2QA 5ALRA 1CB0A 1TT5B 4HBGA 4YI5A 3V3TA 4ZJPA 3MLEA 3ZNNA 3HB9A 1U4NA 2Y1WA 5COQA 1EFUA 2GLTA 2ZVQX 3RVDA 4L6AA 3V8RA 4EUNA 3C6ZA 5CH5A 3Q7PA 1E7MA 3AFOA 3P52A 2UUPA 1H0HA 2ZSEA 4HQ0A 4XYBA 4LJYA 4YJKA 1J25A 4DRXB 2X4GA 5TLSA 2IUYA 4RV5A 4TXNA 2ZZNA 5K6AC 2H1FA 3VKWA 3Q9NA 1CR4A 1Y3DE 2AD1A 4QUAA 3UTDA 4JI4B 4QSHA 5EY5B 4K9DA 1YFZA 2ET6A 4P3KA 2HA4A 3VH4A 2HFJA 1LQTA 4MUGA 4X64B 4AYXA 2QSYA 3NDRA 1E2EA 3RH0A 2C5BA 2BGJA 4EJ6A 2ATIA 4MA0A 3DZ8A 4IDOA 1C4WA 1A9ZA 2BEWB 2J85A 2W2NA 3RAJA 3PUVA 4IIUA 1EK0A 1XYVA 1XYYA 1RWQA 2ERCA 2XMRA 3A58B 3D7RA 3FCYA 2VQDA 3GJRA 3I09A 3QX9A 4HN4B 4HQFA 3G9UA 4P4UA 4J7XA 4ZI7F 4D0SA 3GCZA 3N5CA 4E12A 3NTXA 1C2YA 3PITA 1Z63A 1RACA 2WWXA 1HT2E 1TKBA 3HV0A 4A27A 4AG6A 3K6SB 2IDMA 3T5AA 1B3BA 3HCBA 3FFAA 2WZCA 3LSTA 1E64A 1JFSA 2D00A 4HZUA 5AW9A 3ZQKA 5GAJA 1KOFA 5JAHA 3SZRA 2Z56A 5AM4A 2ZYUX 5BSUA 1DQZA 1ZFNA 2ONYA 5ITZA 4UKDA 1QS0A 5JD5A 1HT0A 3V6LA 4CL8A 4HMQA 1XELA 2SKCA 2WKSA 3CRQA 2O4UX 1W8IA 2R9VA 4OJQA 1Y9EA 5LA6A 1AKQA 4UTZA 4CMJA 4D4KA 1DO0A 1SWVA 1HF3A 2YRFA 4CXMA 4OQQA 3O83A 3LUGA 3RIHA 3TZEA 2E4XA 2FW9A 2JF0A 4KGXA 4YN3A 2CDNA 2JGRA 5A4FS 3PENA 2QIOA 2XY4A 4HWTA 3LLCA 4G97A 4TLLB 5A5FA 3RNLA 1CK4A 1DAKA 4AO7A 5T8KA 1PKEA 3KOYA 4FE7A 4HPWA 3MJTA 1YZLA 3WSTA 3ZIDA 3EXAA 4QO7A 4WN3A 1R4NA 3RFFA 5J2UF 3A9WA 1Z7BA 3AZPA 4TZTA 4DMLA 3B1VA 3KZNA 4MUYA 4O2AF 1O95A 4R7TA 1QO0D 4K86A 4X63A 5FA6A 2BEUB 3GVXA 3H3JA 1Y0BA 1GUAA 2DQYA 1Q20A 1BC5A 4BQPA 4HEJA 3FNGA 2J9ZB 4CGYA 5MFZA 1GLNA 1B6SA 4J3JA 4HB2A 1QIMA 4G3XA 2YOHA 3A6FA 4J0IA 1FNNA 2MYPA 3SEQA 4F2DA 4F60A 4RTPA 1KYYA 1WW8A 3GVIA 2YRWA 2H7XA 1U3TA 2B4RO 1ISSA 4U2BA 4UPVA 4X7MA 5AKXA 3GB9A 5KX5B 1DC3A 2EDCA 2RAFA 4RGBA 2DY0A 1WBDA 4Q1BA 3H2JA 4IP0A 3H8WA 3HBFA 4WK2B 1TVMA 2FSFA 2WSSA 3L0BA 1ISJA 4BKOA 1FU8A 3V1LA 5JMTA 1XD8A 3FYCA 4JMLA 4LVUA 4R2HA 4CKCA 3WB9A 1SUPA 3KCQA 3B36A 4LHVA 4UREA 1GVNB 4F96A 3C43A 4R2KA 2SCUA 3IAFA 2VJMA 4B3HA 4DY6A 4Z7QB 3VR6D 4MMYB 2XA9A 3NTLA 4ZU3A 3IGFA 1L5WA 3NHBA 5LU8A 3NVAA 1VKNA 4DZZA 3GCGA 1Q7RA 5D6NA 2EKBA 1O7JA 2VQFB 4JJKA 7YASA 3BTOA 4PPYA 1XK6A 1G6KA 1VPTA 1D09A 2Z1MA 4PHCA 1BDBA 1SUFA 5LJIA 4TSRA 4TLEA 1EWTA 3H19A 4JR0A 4PNPA 3BJEA 3DHWC 2M9MA 1QIHA 1FZQA 4C2UA 2EWMA 3EXG1 2ZYIA 1PEYA 2C9MA 2P77A 2YZKA 3K1TA 3KR9A 3QJGA 4G4JA 4HVAA 4S35A 5BN4B 4CL0A 1ABBA 3FOWA 4GUDA 3V1MA 1HLDA 3E5MA 5IUKC 2O2DA 3KXKA 1MA0A 4KIWA 4B33A 3JD4A 4AJHA 2Q5CA 1IUOA 3TW6A 2XUZA 1MJNA 4DSTA 4ALNA 1Z26A 2RGWA 1DGQA 4U7TB 2EX0A 1E2NA 4JGGA 4UXIA 4AP6A 3LX8A 4UM7A 2W93A 1M1NA 1YU9A 1ZESA 2YFHA 5B55A 4OH7A 2OBNA 4YRDA 5ICSA 3LHKA 2FE1A 3Q7RA 1H23A 4MR8B 2IYVA 3RHZA 1Y6JA 2NWQA 3A1VA 5KQLA 2M6LA 2WWHA 1FP2A 1XCJA 3C3CA 3EDYA 2QL7A 3EW9A 3ORFA 4IEEA 2DCUA 4M9UA 3PVCA 1CZOA 2NADA 3OIWA 1W6RA 4MS3A 4LF7B 2IIQA 2VJYA 3GX1A 2Y1LA 4TKVA 1WVGA 3FNBA 3U39A 7ADHA 1FYFA 1T4CA 1U31A 2VTEA 4LNUB 4MWBA 5FNVA 2QUKA 3MQ4A 6NULA 1UXJA 4XR4A 2OZPA 3H7IA 3M6UA 3GFTA 2OV1A 3I6YA 3DEFA 4R9NA 2EKLA 4QBIA 2VJNA 2IP2A 1U9CA 2OWDA 5J40A 2H2AA 4F3KA 1H4TA 1E1LA 1PQWA 4P5PA 4IJ5A 4PCUA 7AT1A 1DFIA 3CX7A 4IDBA 3ND6A 2CD7A 1BHO1 2JLZA 1AQJA 2A9FA 4R41A 3HNPA 2IS4A 3HVRA 1EGAA 5K3OA 2X1VA 4PGAA 2GX6A 1CEYA 2WT9A 4YRGA 1EP9A 1V9SA 1NFRA 1PNVA 5HMMA 5E38A 4AQ7A 1O9BA 5FLKA 4NBUA 1U0HC 4UEQA 5EXSA 3QKTA 5BNZA 1LKZA 3WB0A 5KOHA 4QLOA 3WA7A 4IUBS 1E3SA 3V9PA 1T4CB 1Y8AA 4K6GA 4ZT6A 1RZVA 3E3LA 4Z1OA 2YFKA 4S2EA 3ZTWA 3NGXA 3V8MA 3LIIA 3AJAA 3GDWA 3N2ZB 4YX9A 2C4NA 4BFXA 4A6DA 5BORA 5HEKA 3ZUPA 3ZU2A 4MHOA 1K88A 1MKYA 3EBOA 3UK0A 1ORTA 4CCWA 3GELA 3ZDYB 1DU4A 3DB1A 4ODIA 3ZE2B 4C78A 2CV1A 4D8XA 1CUYA 3BIFA 3LCMA 1E5VA 2DH6A 1BIFA 2NTNA 1D2MA 3UWMA 3FUVA 2O8CA 5AO9A 1NU6A 1W52X 4MJXA 1X77A 4OI1A 3I2IA 2CYCA 4I4LA 4AJ4A 4LQCA 2J3HA 3VX4A 1YI0A 2X8AA 5CRIA 4GWLA 1Z4MA 3G2JA 3W7AA 5JUWA 4ZHSA 2D3WA 1GL7A 3OM9A 3ZLTA 4HHEA 2BBSA 2HF2A 4I1OA 2ZRJA 2GR9A 2VSXA 4MVJA 4G36A 1QONA 3U3KA 4OGWA 3I9KA 1W49A 1YJAA 2ZJOA 3RI3A 4UM5A 1NLZA 4IGIA 2NSLA 1R0LA 1E58A 2ZSJA 3DVRX 4GL4A 4I5DA 1CZKA 2BFFA 2ZYSA 1NM5C 4MTCA 4NULA 1H0KA 5ALOA 4KAXA 4ZO9A 3VHQA 2E37A 4CCSA 1BH6A 1JVBA 4PAMA 3W2TA 3SGLA 3FPSA 1W1IA 2QNBA 3HJCA 3I9NA 3P9QA 3R1IA 3AF2A 2POCA 4JB2A 4NMLA 3A11A 3FPCA 1XMVA 4O8ZA 4BEJA 5K6RA 3OFJA 1V5WA 4JVSB 2O8CB 1BGXT 4ER6A 3EE6A 5DB4A 1N0UA 3IODA 5ICEA 1EVQA 4OGFA 1AGRA 2QMEA 1R4NB 2PG3A 4ENTA 1SVOA 5FEUA 4S04A 1BROA 3IO3A 3RJ5A 1ZN8A 5F9MA 2WD7A 3QPBA 3ZGYA 3VKHA 4DARA 5IBQA 1AK1A 5LA6B 3ZIAA 2HHJA 2REQB 1OFIA 4R8LA 5SYMA 3EXHB 1BVUA 1XTIA 5DSTA 1DRWA 2I7CA 1C7EA 1B4DA 4GGOA 1TGVA 3LUAA 3WTCA 4Z3KA 3X1ZA 4WGFA 3SF8B 2M6RA 3X0DA 4AVYA 2PQ2A 3V4VB 2XYGA 3NKVA 5IT5A 1PK7A 5K8VA 1Z18A 2JFYA 4DLSA 1J2EA 5AXDA 3UXHA 3G2PA 4NZ9A 2ACKA 7MHTA 2BGMA 3HPQA 5AKKA 3UW1A 2XYHA 1JQKA 2HLNA 3NT5A 2V8OA 4GS5A 3RADC 3GA5A 1FYXA 4H1UA 1JQJC 1U2ZA 4IIEA 2C7BA 4DZRA 1Y6GA 2VEDA 4LJ4A 4RZUA 4MICA 4UMDA 4TL7A 4INOA 2DLDA 4KYIB 3DOOA 4B3DA 2JIMA 3E3AA 1A9YA 3RRMA 3TINA 4DQDA 5DXFA 4AC9A 1Z2NX 4P3XA 2W6ZA 2XSZD 1WULS 3FTNA 3H1AA 1J8FA 1Q1GA 1YZ3A 2W2LD 3IE2A 2EEZA 3KOUA 2GF9A 3D6MA 2FX2A 1WMDA 3G0DA 3H9BA 4ZVMA 4B2LA 4XFJA 4DR6B 3LWDA 4TKVB 2QE7D 5T57A 5JCPA 2QU8A 3P2KA 4DHEA 3KLOA 4EJSB 1WDWB 1RRCA 2UXCB 2MWMA 1UBSB 3A9TA 2YV1A 4FVTA 2H6EA 1H69A 3GZ4A 4J0JA 3R7WA 1V1MB 2O57A 2WILA 3CF2A 3ASZA 3FKJA 4MUFA 4EO7A 5A3QA 1AK2A 1RP1A 5AVVA 5KUTA 1VC2A 3D8NA 3G8DA 4YAIA 2YY5A 4Y67A 3DZGA 2OHGA 3O75A 4OUDA 4I2VA 3Q6MA 4R1OA 1EFPA 3TSYA 1D1QA 3A26A 4H4CA 4AP9A 5DP2A 5AXBA 3RIYA 2C4VA 4WUTA 3EA4A 2VL7A 3L4BC 1GAQA 4CMIB 3T5TA 1GEEA 3ZKWB 1XTRA 3BJRA 3BHNA 1AXGA 1U2QA 3RC3A 1UKZA 5DHQA 1JDVA 1CUGA 1KNXA 2CZGA 2PO7A 1T35A 3BWBA 1F14A 3IV6A 4OXKA 1KYVA 1T34A 4R1PA 5B1DA 1USUA 5JAIA 2DBZA 3HKBA 3KYDB 5IJ0A 1IBCA 3T9AA 3K8YA 3ZHXA 1R88A 3H18A 2P6UA 3N5KA 2DFVA 3RV4A 3SZOA 1LDYA 3FOZA 3HP4A 1TM2A 2HRZA 4RY2A 2FMTA 1THTA 3QUTA 4R05A 6ABPA 3KEQA 1RQ2A 2POQX 3CT6A 2Q27A 3DGEC 1UC5B 4XDZA 3WLRA 3CMCO 3F74A 4H4DA 3QPAA 4DPMA 2SBTA 2P5SA 5DBEX 3ZCTA 1P6XA 4ZCMA 3HEBA 3SCZA 3UEOA 5LJLA 3ANXA 2B92A 4BLUA 2OB2A 4Q9KA 2X0EA 1LF0A 2LUOA 3O9MA 4FD2A 4QXRA 2W98A 4YRQA 3BOSA 4DNPA 1PNQA 1VYTA 4B46A 1JDNA 5IRCD 1NL3A 2LVBA 3F71A 3FLEA 3NP7A 1ADBA 3M1IA 2MIIA 1E77A 1HNNA 4MUAA 4P98A 5D7NA 3GA7A 3FAZA 3GJTA 5I9MA 4BZZA 5LPNA 3HYRA 3LGSA 5DT9A 5DASA 1P9OA 3IAEA 3P0EA 3RBVA 1V48A 5IAKA 1OY1A 4BNDB 2H1WA 3FUCA 3EA0A 1U11A 2EATA 1ZJWA 5FR1A 1A1SA 4X1YA 5ALVA 1RKQA 1FFYA 4G26A 1U5BB 3CMMA 1Q0HA 1WHSA 4PC6A 3T94A 1C4XA 3EVFA 1IRXA 1T1RA 3D0KA 3M5DA 4ZT4A 3TIXB 1HFJA 6GPBA 5AW6A 2D4AA 1U94A 4IXNA 2WNHA 4W7HA 3BQMB 3MSCA 1UDWA 4IM7A 2XLBA 4NBSA 1Z7YA 3IUBA 3ZJ4A 1K27A 2CBZA 2FEMA 3NTRA 3PD1A 2BHNA 3OIFA 2B1QA 4BXOB 4M9RA 3FR8A 3ZZUA 4P3OA 3F6SA 4PTYA 5DHUA 1JF8A 3ZHCA 3AERA 1Q0ZA 3L01A 3EIFA 5DM2A 2NP6A 1PWZA 3JD0A 2WTEA 3MOIA 3Q15C 4KMSA 4X3OA 4YRZA 2XTMA 4DLTA 2WHXA 4MZXA 2JJ8A 5JSQA 3D7SA 3ZG6A 5LZ4A 4ZPJA 2G83A 3VNBA 2HZBA 3B52X 2WYUA 4IOKA 4OSOA 1QX4A 5ECYA 1YZTA 3DVSX 2DFDA 3PX3A 4FNAA 2WY2D 2XXAA 2E4YA 5I48A 3N8KA 5CBPB 3TNLA 4E94A 2R79A 1KJIA 1QHEA 5EQFA 5F35A 3M7IA 3T7CA 4EYEA 1XOIA 3KHTA 4PBTA 1ZBQA 2VHYA 3PKJA 4UXJA 2IEGA 2PRSA 2VKQA 1XQVA 5CA1F 2PH7A 2IHZA 5ITZB 5L6LB 2GXAA 3QLUA 1E6EA 10MHA 4XEHA 3K9QO 2XUHA 3JD2A 2QDKA 1I9GA 2OA0A 4L16A 4DUGA 2F2TA 4MR9A 1Y63A 2ALJA 3FMIA 3WK7A 3LRPA 1FTWA 2A7QA 1S2DA 4D81A 3I32A 1DCTA 3VBEA 3FTCA 1QHNA 4D80A 2Q1SA 1WS6A 1P2GA 1YXMA 3JQGA 3NC4A 1XFDA 1N5JA 1VG1A 4TTRA 2Q2QA 1AKNA 1K06A 2WIAA 1DEAA 1JHRA 1NVUQ 1O77A 2WFLA 3HFRA 1QOPB 4J16A 4CLDA 1CERA 4HDNA 2Q9BA 1F2UB 2ZUCA 4TRMA 4QJ4A 5LMNB 3H9CA 3E7FA 2B7BA 4NXMB 1G55A 3KHKA 2F8SA 2NNWB 1Z0ZA 2R8OA 4WWHA 4BO6A 3HKDA 3IPRA 1JPVA 5JQGA 4G2NA 3QVGA 2PZBA 3OQJA 2GPTA 3OEHD 3VM6A 3LL4A 1N6KA 3URMA 2V0NA 4GOMD 3A27A 3QRWA 4D9HA 2ZJ2A 3O47A 1A3CA 5IJAA 3NBQA 4F5WA 4HUJA 3OU2A 1ZOOA 2V5UA 1G9XA 1CDOA 1UQUA 2E1PA 3W8FA 2W9XA 3AVOA 4KO8A 1GGVA 1Y5RA 3UB4A 1UBFA 1YVDA 2C2XA 3G8BA 4AZSA 3GFBA 1HDIA 2MR5A 2HRDA 2RKOA 1ECLA 1Z6TA 2JH8A 3AQIA 3PQDA 4MVXA 5A5VA 5CB0A 3D7NA 4AJEA 4B35A 4X1IA 2BCEA 2AJCA 5BT8A 3PDCA 3K31A 2QD1A 4JYAB 4DDWA 3RGGA 2HCTA 3O5AA 4ZVRA 3VFDA 1T0UA 3QELB 1JECA 3ZCRA 1PGQA 5F21A 1AVTA 5ADWA 3NDBB 4M22A 2YNMA 2H4FA 3IT1A 5D51S 2VO1A 2Z9BA 3QOYA 4D25A 3N6XA 4RTRA 5LYJF 2Z58A 4F5YA 5IVKA 1JKFA 3OPXA 3FHLA 1M2OB 1UMDA 7ABPA 3AUXA 1KEPA 1KC3A 2J32A 3SG0A 1ISRA 1V1JA 3O4FA 4O4HB 2C2MA 2XIQA 5FPYA 4D96A 2I5PO 1Z2CA 5BR1A 2XLCA 2EKZA 1ORHA 1X9HA 2IOFA 2CNNA 5BV0A 1JQ3A 3DLCA 4P31A 1PV2A 3OLQA 5KQMA 1UIMA 4Q3KA 4WTOA 2V5AA 2QJFA 2XW6A 1FTYA 1NAIA 4PTZA 2WJWA 1QFMA 2WTMA 4NMHA 1BX3A 2DF8A 4B6EA 3VJMA 5BV1A 5AVQA 3KQOA 1V3UA 3M3HA 2B21A 5IHPA 3BJIC 5L3SA 4V0SA 3GJ6A 4LTNA 1OKKD 2AK3A 2V3VA 4L5YA 1IWOA 1OVGA 2NZJA 4IJMA 2Y1DA 4FCWA 3WC4A 2FWPA 2WB2A 4EUHA 4RVHA 2QXTA 3THRA 3TSWA 3T1OA 1RAHA 1SVNA 2HB6A 2ZROA 2XDQB 3WBKA 5ENVA 3OESA 4BTLA 5EQDA 4L5IA 3O03A 4MLDA 4ZXPA 1F4PA 4JA2A 4I5FA 3I4LA 1W6UA 4DABA 3DAPA 1SXJD 4EUSA 4YJ3F 1DADA 2W2KA 3NDIA 2R6GA 3MB5A 2PMEA 4F06A 1RXWA 2VDJA 1YI1A 4M8LA 1EJBA 5FRDA 1N0HA 1NI5A 2ZT6A 1JL3A 3AIKA 3UJDA 4BUJA 4DG8A 1TYEB 1CFZA 1A77A 3KJEA 1HMPA 5C4IA 4P0QB 1TJ3A 1PYDA 5HP4A 4LBZA 1U3FA 2Q3JA 3QY9A 1UAYA 3QE0A 3U7QA 1WA5A 2VYND 1RI2A 1EP3B 1O8BA 2EZ8A 1GNLA 4KO2S 5MDHA 2J9YB 5AJZA 4JT4A 3WIDA 4ITUA 4TLCA 3HJUA 4NZPA 5ALHA 4PHGA 4EF5A 1RYZA 3L0IB 5C0OE 3KSUA 5B4VA 3TQIA 2ZE8A 1DDIA 2GSWA 1N1EA 1UJ2A 3D3QA 4PE5B 3KFXA 2WHQA 4Q3AA 1QKKA 1Y6FA 4AULA 1NZFA 1K8ZB 4W6QA 2Q4EA 1I0LA 1T5HX 3QG5A 4Q18A 3WB2A 3QPUA 1Q0RA 1BXGB 4F86A 4KNVA 1ZX1A 2OM6A 3A1UA 1FLAA 1C9EA 1AUQA 2VZEA 3AFHA 3R0VA 1AS0A 1XAJA 1CY2A 1UPUA 2GYUA 2VH1A 3L8ZA 5E6SB 3VAYA 2AD5A 3GFGA 2O2IA 4DJTA 3TVTA 1OR8A 3EVZA 2JKVA 2CYBA 4M9XA 4ED9A 1S7GA 3U3XA 2Z8XA 3VSDA 2CJWB 4IXDA 4FLFA 5CLIA 5FQNA 3DH0A 1RRGA 2GK7A 2QYSA 4GM4A 1F2UA 3PEYA 3ZGOA 3WAJA 1R9MA 2ZUTA 3G5TA 4IMRA 5BYAA 4AD8A 3PIDA 1NJSA 3V7FA 2CXXA 2Y99A 4ZVOA 4L0DA 3JQDA 2CVQA 2XAAA 1QF9A 2QRKA 2HSEA 5B3JC 3GP5A 3QEAZ 3A1TA 2P8JA 4PRLA 5BN5A 1PWXA 2MYTA 1JTFA 3DQPA 1TQ2A 1QYWA 2OZVA 2Z9DA 4LI3X 3H42B 3PC7A 1G7SA 3F67A 3JQQA 3E1KA 3T9CA 4AF8A 3QA3E 4MW1A 2DBVO 2P9QA 4PSAA 3PICA 3K1YA 1V0JA 4M0KA 4KPEC 5G4LA 2J5KA 3V4PB 3ZEAA 4Z2AA 3IURA 1THGA 1LUAA 2OYRA 5JISA 1VGQA 1WBJB 2H2FA 3Q3IA 3AVWA 4ARUA 2AZ4A 4AMZA 1ECJA 3R3YA 5CFLA 2FW1A 3TZHA 1ZIPA 1OFUA 3HBMA 3ZDEA 2GZ2A 2WAMA 4FT4A 2G9UA 3C3XA 4NABA 4HKTA 1RD4A 5CXUA 2REQA 4QVIA 2BCJQ 4I55F 2DEUA 1D2CA 1L7VC 2I4LA 1DPFA 3E9YA 3L0SA 3S2GA 4EUEA 1PG0A 1NJGA 1X7WB 2O8VA 4WKNA 3WMEA 1RI1A 1DV2A 1F1JA 2XKBA 3RF6A 3AI2A 5CDYA 4CKEB 1QE5A 2Q9CA 2ZRDA 4YJ2F 4BJHB 4XLLA 1SU4A