3G5OA

The crystal structure of the toxin-antitoxin complex relbe2 (rv2865-2866) from mycobacterium tuberculosis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
LMRILPISTIKGKLNEFVDAVSSTQDQITITKNGAPAAVLVGADEWESLQETLYWLAQPGIRESIAEADADIASGRTYGEDEIRAEFGVPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the toxin-antitoxin complex RelBE2 (Rv2865-2866) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Toxin/antitoxin
molecule keywords Uncharacterized protein Rv2865
total genus 26
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02604 PhdYeFM_antitox Antitoxin Phd_YefM, type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3g5oA02
3.40.1620.10 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like domain 3g5oA01
3HS2A 2ODKA 3OEIA 3OEIE 4ZM0A 3CTOA 3HRYA 3G5OA 3D55A 4ZM2A 3KH2E 2A6QA 3K33B 3K6QA 4ZLXA
chains in the Genus database with same CATH superfamily
3H5YA 4MJWA 1QTGA 4QPXA 2H1OE 4UI4C 4HLMC 1OHNA 2ODKA 1P94A 5C5RC 4L0IC 2UUTA 4L2KC 3LJPA 4L34C 2BJ3A 1B28A 3D55A 3HJ6A 4KZUC 4L32C 5C5PC 4HLFC 1U9PA 2K1OA 2WVEA 2BJ7A 2CA9A 4UI3C 3H87C 2CKWA 4HL5C 1B01A 3VEBA 3HRYA 4D8JA 4NRUA 3SFGA 2KKEA 1SIWA 3OD2A 3HS2A 2A2BA 4HLHC 2BNWA 1BAZA 4L0VC 5FPFC 4L0TC 2BA3A 5C5QC 1Q16A 3FMTA 2BJ9A 3NAHA 1EA4A 5ADTB 2KELA 4ZM2A 2H3AA 1MNTA 2K5JA 3NNEA 4LQ3A 3QIDA 3LGHA 2BNZA 1SH2A 3IR7A 3UQSA 2CADA 4NRTA 4AAIA 4UI6C 3H5XA 4KZQC 2GPEA 3BSNA 1BDVA 4LQ9A 3VW4A 2WVCA 4LRVA 3VEAA 3K33B 4HKKB 2RBFA 2AN7A 4L2FC 4L0BC 2JXGA 3OEIE 1ARQA 4L09C 4HV0A 5ADQB 2A6QA 5ADRB 4UI5C 3G5OA 1SH3A 2BJ8A 3NO7A 3KH2E 2JXHA 3UPFA 4L33C 3GXQA 3K6QA 1MYLA 4HLGC 2HZVA 3QOQA 3SFUA 4KZLC 1PARA 4HLKC 3FT7A 4ME7E 4L0SC 4UVPB 2CAXA 2K6LA 2AY0A 2WVBA 1ARRA 2HZAA 3UR0A 1NLAA 2BSQE 2CAJA 4L2GC 2B43A 4L31C 4UI8C 5ADSB 2CPGA 4L10C 2WVDA 2UUWA 1MYKA 3BSOA 3OEIA 4ZM0A 2WVFA 4O4RA 1SH0A 2ADLA 4FXEA 2JXIA 4UI7C 4HKIC 2BJ1A 2JBVA 1BDTA 4HKNC 1Q5VA 3NAIA 3CTOA 2Q2KA 2K9IA 2WK4A 1OG7A 2KOEA 1IRQA 4HMHC 2K29A 1X93A 2ZIXB 4ZLXA
chains in the Genus database with same CATH topology
4AAIA 3H5XA 3BSNA 3UR0A 3HRYA 4NRUA 4LQ9A 4MJWA 3H5YA 2B43A 3SFGA 2KKEA 4QPXA 4LRVA 3K33B 1OHNA 1SIWA 2AN7A 2UUWA 2A2BA 3BSOA 2ODKA 3HS2A 3OEIA 3OEIE 4ZM0A 4O4RA 2UUTA 1SH0A 2ADLA 3LJPA 2A6QA 3D55A 1Q16A 2JBVA 3NAIA 3CTOA 2Q2KA 3G5OA 1SH3A 3NAHA 3NO7A 3KH2E 3UPFA 4ZM2A 3K6QA 2H3AA 3SFUA 3NNEA 4LQ3A 2WK4A 1OG7A 2KOEA 3QIDA 2CKWA 1SH2A 3IR7A 3UQSA 4ZLXA 4NRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HS2 A;  2ODK A;  3OEI A;  3OEI E;  4ZM0 A;  3CTO A;  3HRY A;  3G5O A;  3D55 A;  4ZM2 A;  3KH2 E;  2A6Q A;  3K33 B;  3K6Q A;  4ZLX A; 
#chains in the Genus database with same CATH topology
 3H5Y A;  4MJW A;  1QTG A;  4QPX A;  2H1O E;  4UI4 C;  4HLM C;  1OHN A;  2ODK A;  1P94 A;  5C5R C;  4L0I C;  2UUT A;  4L2K C;  3LJP A;  4L34 C;  2BJ3 A;  1B28 A;  3D55 A;  3HJ6 A;  4KZU C;  4L32 C;  5C5P C;  4HLF C;  1U9P A;  2K1O A;  2WVE A;  2BJ7 A;  2CA9 A;  4UI3 C;  3H87 C;  2CKW A;  4HL5 C;  1B01 A;  3VEB A;  3HRY A;  4D8J A;  4NRU A;  3SFG A;  2KKE A;  1SIW A;  3OD2 A;  3HS2 A;  2A2B A;  4HLH C;  2BNW A;  1BAZ A;  4L0V C;  5FPF C;  4L0T C;  2BA3 A;  5C5Q C;  1Q16 A;  3FMT A;  2BJ9 A;  3NAH A;  1EA4 A;  5ADT B;  2KEL A;  4ZM2 A;  2H3A A;  1MNT A;  2K5J A;  3NNE A;  4LQ3 A;  3QID A;  3LGH A;  2BNZ A;  1SH2 A;  3IR7 A;  3UQS A;  2CAD A;  4NRT A;  4AAI A;  4UI6 C;  3H5X A;  4KZQ C;  2GPE A;  3BSN A;  1BDV A;  4LQ9 A;  3VW4 A;  2WVC A;  4LRV A;  3VEA A;  3K33 B;  4HKK B;  2RBF A;  2AN7 A;  4L2F C;  4L0B C;  2JXG A;  3OEI E;  1ARQ A;  4L09 C;  4HV0 A;  5ADQ B;  2A6Q A;  5ADR B;  4UI5 C;  3G5O A;  1SH3 A;  2BJ8 A;  3NO7 A;  3KH2 E;  2JXH A;  3UPF A;  4L33 C;  3GXQ A;  3K6Q A;  1MYL A;  4HLG C;  2HZV A;  3QOQ A;  3SFU A;  4KZL C;  1PAR A;  4HLK C;  3FT7 A;  4ME7 E;  4L0S C;  4UVP B;  2CAX A;  2K6L A;  2AY0 A;  2WVB A;  1ARR A;  2HZA A;  3UR0 A;  1NLA A;  2BSQ E;  2CAJ A;  4L2G C;  2B43 A;  4L31 C;  4UI8 C;  5ADS B;  2CPG A;  4L10 C;  2WVD A;  2UUW A;  1MYK A;  3BSO A;  3OEI A;  4ZM0 A;  2WVF A;  4O4R A;  1SH0 A;  2ADL A;  4FXE A;  2JXI A;  4UI7 C;  4HKI C;  2BJ1 A;  2JBV A;  1BDT A;  4HKN C;  1Q5V A;  3NAI A;  3CTO A;  2Q2K A;  2K9I A;  2WK4 A;  1OG7 A;  2KOE A;  1IRQ A;  4HMH C;  2K29 A;  1X93 A;  2ZIX B;  4ZLX A; 
#chains in the Genus database with same CATH homology
 4AAI A;  3H5X A;  3BSN A;  3UR0 A;  3HRY A;  4NRU A;  4LQ9 A;  4MJW A;  3H5Y A;  2B43 A;  3SFG A;  2KKE A;  4QPX A;  4LRV A;  3K33 B;  1OHN A;  1SIW A;  2AN7 A;  2UUW A;  2A2B A;  3BSO A;  2ODK A;  3HS2 A;  3OEI A;  3OEI E;  4ZM0 A;  4O4R A;  2UUT A;  1SH0 A;  2ADL A;  3LJP A;  2A6Q A;  3D55 A;  1Q16 A;  2JBV A;  3NAI A;  3CTO A;  2Q2K A;  3G5O A;  1SH3 A;  3NAH A;  3NO7 A;  3KH2 E;  3UPF A;  4ZM2 A;  3K6Q A;  2H3A A;  3SFU A;  3NNE A;  4LQ3 A;  2WK4 A;  1OG7 A;  2KOE A;  3QID A;  2CKW A;  1SH2 A;  3IR7 A;  3UQS A;  4ZLX A;  4NRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...