3G5TA

Crystal structure of trans-aconitate 3-methyltransferase from yeast
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
299
structure length
299
Chain Sequence
SSTFSASDFNSERYSSSRPSYPSDFYKMIDEYHDGERKLLVDVGCGPGTATLQMAQELKPFEQIIGSDLSATMIKTAEVIKEGSPDTYKNVSFKISSSDDFKFLGADSVDKQKIDMITAVECAHWFDFEKFQRSAYANLRKDGTIAIWGYADPIFPDYPEFDDLMIEVPYGKQGLGPYWEQPGRSRLRNMLKDSHLDPELFHDIQVSYFCAEDVRDKVKLHQHTKKPLLIRKQVTLVEFADYVRTWSAYHQWKQDPKNKDKEDVADWFIKESLRRRPELSTNTKIEVVWNTFYKLGKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of trans-aconitate 3-methyltransferase from yeast
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Trans-aconitate 3-methyltransferase
total genus 110
structure length 299
sequence length 299
ec nomenclature ec 2.1.1.145: Trans-aconitate 3-methyltransferase.
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3g5tA00
1YB2A 2B9EA 2IGTA 5EHGA 3UA4A 1VQ1A 4E32A 1SUSA 1KYZA 5EHIA 2UYOA 1O9GA 4QQKA 5FQNA 3FZGA 5EGSA 4MHTA 3ME5A 1X1BA 1JTFA 3DMGA 2ZLBA 2OB1A 3KQQA 3R3HA 4GQBA 3BKXA 1ORIA 5EZSA 5CVEA 3B89A 3G89A 4HGYA 5HIIA 1SVUA 1ZHFA 2OXTA 2Y1XA 4OA5A 3I64A 3O4FA 4QDJA 1O54A 3T7RA 5K0FA 5K0BA 1QAOA 5CIYA 3UJAA 4RTNA 3BGDA 3UJ9A 2OPBA 4MWZA 2YXLA 2P1DA 4LWPA 3AWIA 2PSSA 4AX8A 5LQRA 5DSXA 2ONZA 4U7PB 3IHTA 2OKCA 4E30A 3O7WA 4RTRA 5FQOA 5KS2A 5KVAA 4PYKA 1SKMA 3DTNA 2IDKA 3OU2A 3FTFA 4E2WA 1JG4A 2CL5A 4RVFA 5CVDA 4FGZA 3DUWA 2WK1A 3LCVB 2ZBQA 3OZRA 5DXAA 5E9QA 4DCMA 4PGGA 2FK8A 3KPYA 3OFKA 3FUUA 3T7SA 1IY9A 1JR4A 4QVKA 4EQZA 4EVIA 5EVJA 3MTEA 3G8AA 3QOWA 3ID6C 3KPVA 3LBFA 3P9IA 4P7GA 1JQDA 4M38A 3FUXA 3BWYA 2NXJA 3KQOA 1WXXA 3HA5A 4CTJA 2Z6UA 2QRVA 4HSGA 2BH2A 5KYGA 3ORHA 1ZGAA 3FUWA 2PXAA 3HCAA 5GP1A 1SQFA 3G8BA 1N2XA 4ER3A 3P71T 4PCLA 2P7HA 3ELWA 4RSRA 3OE4A 5DM2A 1XJ5A 2FK7A 1IXKA 1PJZA 2H00A 2KW5A 3KU1A 2VDWA 3A27A 2XBMA 2HV9A 1D2HA 2ZZNA 2ADMA 5K8VA 1Q0TA 4PYJA 3NWEA 2GPYA 4UOEA 1EJ6A 3DMFA 5EMMA 4YV1A 3R9XB 3A25A 5P8WA 2XYQA 5EEGA 1N7JA 3SM3A 4FP9A 4F86A 2PVCA 1KPIA 3OU6A 2EX4A 1P1BA 4PCAA 4QTTB 3HVKA 2P40A 4KWCA 2I6GA 4E70A 5LQJA 2PXXA 2PT6A 2V7EA 3I58A 3M4XA 3MERA 2B3TA 4P7JA 5FUBA 2AOUB 3HA7A 5FA8A 5FWDA 4CKBA 4RV9A 4FSXA 3LX6A 3HVHA 3SXJA 3EMBA 3TQSA 3D2LA 3R6TA 4F84A 2PX8A 1NT2A 2FPOA 4PYQA 2C7RA 5DWQA 3H2BA 2N47A 4R05A 2DULA 1NW5A 4ER0A 2H11A 2EJTA 1QZZA 2O0LA 3V8VA 5BW4A 2ZBPA 4LG1A 5E2AA 1VE3A 2HNKA 4GOLD 4GC5A 2PV0A 3VYWA 4GOMD 1R6AA 4KW7A 5DXJA 1NBIA 1XCJA 3CC8A 4OBXA 2ZTHA 3KQPA 3UJDA 4RTOA 4P7KA 1SQGA 3EVAA 3K0BA 1DUSA 5HEKA 3WSTA 5DTQA 3KPJA 1P1CA 3DXZA 5JUWA 3DOUA 3DH0A 1D2GA 3LBYA 3TR6A 2BR5A 2YX1A 4CKCA 3ANXA 2C7QA 1M0EA 5FWAA 4AZVA 4C4AA 2BR4A 3IEIA 2QY6A 5ICFA 4E33A 5C9ZA 1WXWA 2PWYA 2VS1A 3BGIA 5HZMA 5GIOE 1INLA 2QM3A 2Q41A 4X1OA 3UJ7A 2P3LA 4GOOD 3ER8A 3HCDA 3VSEA 5GIPE 5EIFA 3UFBA 2HWKA 4P58A 3P9NA 3TKYA 5ICEA 2YXEA 3GWZA 1G6Q1 1NKVA 1KPHA 5EPEA 3M6XA 4BLVA 2E5WA 3EVGA 3FUVA 3FTEA 4LWOA 1O9HA 3HM2A 2NNWB 2ZWAA 3G2QA 5E9WA 5LQNA 1T43A 3C3PA 3LDFA 5DX1A 4IV8A 5FHRA 1JQEA 4C05A 3FYDA 5LQCA 1RJEA 2JHCA 3HA3A 3KR1A 4RWZA 5ICGA 2Y1WA 3DLIA 3AY0A 3EMDA 3I53A 5GWXA 2AR0A 5EG5A 3GRUA 1RI3A 1VLMA 2B78A 2AN5A 4HH4A 4O29A 3KHKA 3SSOA 3LL7A 5HIKA 3MTIA 1MHTA 3SX0A 1NBHA 1FPQA 3GDHA 2PX2A 1KP9A 3FRHA 4RX1A 3UA3A 1RJFA 4HGZA 4PGHA 3KQWA 1HNNA 1TPYA 3THRA 3CJRA 4KDCA 3GNLA 3VC2A 2VP3A 2B2CA 3BT7A 1L3CA 1Z3CA 3A7EA 2AS0A 2AVNA 3P2KA 4MTLA 5C0OE 3ELUA 4WXHA 4E2YA 5LSAA 3ER9A 5DX0A 5ICCA 2P8JA 2NXNA 1VIDA 4QQNA 3S68A 5DTRA 1UWVA 1EJ0A 2HMYB 3B3GA 3QOXA 3BWMA 4XUEA 3LDUA 2AN4A 4FZVA 2PX4A 2ZCJA 5T64A 4XUCA 2G72A 4KRGA 4OQEA 5HIJA 3G2PA 4Y30A 4C03A 3IV6A 3PTAA 1I9GA 3EVDA 2FRXA 4BP1A 3OZTA 4AZSA 3X0DA 3DXYA 4HG2A 1P91A 5EMKA 2PWPA 3B7PA 1XXLA 3LKDA 5CVUA 3NDIA 4M37A 2UZ4A 3FYCA 1EAMA 4DM3A 4HTFA 3EPPA 2NP7A 4GUAA 3KR2A 3EVBA 2K4MA 3MGGA 3DLCA 1G60A 3U81A 4PYLA 2O07A 1VP3A 5KQSA 5EOVA 2PBFA 5DSTA 3M33A 4BY9E 4X63A 4X41A 2P35A 4YV0A 1PRYA 3B3FA 5M5BA 1JSXA 3T7TA 1KPGA 2EJUA 3GCZA 1XVAA 3KR0A 4RVDA 5FULA 5CCXA 3MAGA 1WZNA 1AF7A 3LHDA 3GRVA 4LECA 2AOTB 2G8NA 3BWCA 2I62A 4RVGA 3Q87B 4GC9A 3TFWA 5K0JA 3HCFA 4GBED 3NW9A 1XTPA 5HILA 3A7DA 3KPUA 3BGVA 5K0NA 3UJ6A 4EMSA 3VC1A 1X1CA 1RI4A 4CKEA 1N7IA 4V0QA 4FS8A 4DMGA 3HP7A 2NP6A 1NW7A 3MHTA 3FPEA 4ER5A 3LGAA 4PYNA 2AOXA 1QAQA 2ZBRA 3HEMA 3PFGA 4GEKA 2HTEA 3UZUA 3NMUF 4H0NA 3DMHA 5F2NA 1RI2A 3HVJA 5HOQA 5DT2A 1NV9A 1ZG3A 2XVMA 3EVFA 3GO4A 5GOZA 5IH3A 3T0IA 7MHTA 3GRRA 2PKWA 1NE2A 5F2OA 3JWHA 3K6RA 3BUSA 5FTWA 2EG5A 2IDJA 2OO3A 4OBWA 4ZTBA 4IWNA 1R74A 3EVZA 4PINA 4XCXA 1YZHA 1JQ3A 3KPWA 3O31A 5K0GA 2G1PA 4DA4A 1DCTA 5MHTA 5LQUA 3NVKI 1R8YA 3LCCA 5FA5A 1L9KA 1RI1A 1BOOA 2VDVE 1FP1D 3C3YA 4RTLA 1ZGJA 4JXJA 3GJYA 2ZZMA 1EG2A 3HCBA 5E2BA 1DL5A 3FTDA 1VBFA 2V74B 2UYHA 5EZQA 1WS6A 4PNEA 2AN3A 2P3QA 2YVLA 4YV2A 2AOWA 5E9JA 1H1DA 3BZBA 1BKYA 3REOA 4CWAA 4HRAA 1QANA 3AXSA 1AQIA 3FUTA 1WG8A 4DZRA 4IKPA 3C0KA 3JWIA 2XYRA 4A6EA 1NV8A 1X1AA 5K05A 2YQZA 3HCEA 5H02A 3SR4A 3P2IA 5EC8A 1L3IA 2QYOA 3TPZA 2FYTA 3PLAE 1NW3A 3KQVA 4C07A 1OR8A 5CD1A 3NWBA 5C1IA 2R3SA 3ELDA 3SSNA 3RIEA 2JJQA 3EVCA 3FPGA 4GOND 3THSA 1L1EA 3MCZA 3NTVA 4NECA 2UYQA 5E1BA 4AZWA 3M6VA 3E7PA 5E8RA 2NXEA 1ZKDA 5LQAA 2P41A 3C6MA 3MQ2A 2JG3A 1FJXA 4AUKA 3TM5A 2OZVA 3M6WA 1D2CA 3NJRA 3P2EA 2JH8A 8MHTA 3QV2A 5K09A 2H1RA 5DM4A 3ERCA 3M70A 3ELYA 4DCGA 2PY6A 2YXDA 4BP3A 3PT9A 5K0EA 4QPNA 2FCAA 5K0CA 4FSDA 4FR0A 2VDUE 2ZW9A 2B25A 2ESRA 1XCLA 3UBTA 3GIWA 4P7FA 4PONA 3JWGA 3KQSA 4R8SA 4BLWA 4PWYA 4YUWA 1F38A 3BXOA 3LKZA 1M6YA 4M36A 4Y2HA 3G5TA 4C08A 5D1NA 5F2KA 4C04A 2HR1A 2IBSA 2G70A 2VZ9A 3I5UA 3GRYA 5GM2A 2PGXA 3HNRA 4CXMA 1UFKA 3FPHA 3KR9A 4R6XA 1IM8A 3CCFA 3FRIA 4BLUA 1YUBA 2CMGA 3KQYA 2ZSUA 3TLJA 4B17A 4FT2A 3OPNA 1YF3A 1QAMA 5GM1A 2CKDA 3PX3A 3LCUA 1ZQ9A 1JG1A 2PT9A 3GU3A 5EKXA 1QYRA 4Z2YA 2GS9A 4E2XA 2IBTA 5HFJA 9MHTA 4E31A 4PYIA 4X60A 3PB3A 5B1SA 1F3LA 2IIPA 2ZIEA 3CVOA 3AXTA 1R18A 3G2OA 4KIFA 4QVGA 4RYLA 4YMGA 4DKJA 2I7CA 4QPPA 3E05A 3RODA 3A4TA 5DRYA 3CKKA 1AV6A 1VP9A 2BM9A 3FPFA 2JH9A 3FTCA 3SVZA 1KYWA 1KHHA 4F85A 3CJQA 1L3BA 4R6WA 3SGLA 2ZVJA 2R6ZA 4RTSA 2IH5A 4K6MA 5D1HA 5DM0A 5FHQA 1YFJA 5EKUA 4DQ0A 5BW5A 2CWWA 1X1DA 4PYMA 4FT4A 3UJCA 3PX2A 3EGEA 3Q7EA 2GH1A 2OYRA 4V0RA 4YUZA 4RTMA 4WVLA 1NW8A 3LPMA 4QDKA 3LDGA 4RTPA 1G38A 4RTQA 1SG9A 3R0QA 1RJDA 1KR5A 4X61A 1P39A 3OU7A 4KVZA 4KDRA 2ORED 5DM1A 5DX8A 3PS9A 4ISCA 3OZSA 2O57A 3GGDA 5EIWA 2GAFA 5E1OA 2GA9A 3TMAA 5KQRA 4POOA 2XVAA 5BXYA 4A6DA 1XDZA 1MJFA 2ZIGA 3EVEA 5EMLA 1YZ3A 5DPMA 2A14A 2F8LA 2WA1A 4DF3A 2ZZKA 4IV0A 4YUYA 4U7TB 3P9KA 3LECA 3MB5A 5DLYA 2AOVA 3AJDA 5K01A 3MCTA 5CM2Z 3EEOA 2ZULA 1FP2A 3EGIA 1RI5A 3CBGA 4HC4A 3OCJA 3F4KA 3TM4A 4QTUB 2FHPA 3NVMB 3IYLW 2IH4A 2JHAA 1JG2A 3C6KA 2LD4A 3HTXA 2IP2A 3BWBA 5EEHA 3CGGA 2QE6A 1JTEA 1UIRA 4OQDA 1B42A 3E23A 2C7PA 5LR6A 1G8AA 2WA2A 3A26A 1KXZA 2O06A 5E1DA 4E2ZA 2OB2A 1RJGA 2IFTA 2PJDA 1XDSA 3M6UA 5EQJB 5ERGB 4YUVA 3TRKA 2ZFUA 3KQMA 2P3OA 4L7VA 4YMHA 3JWJA 5LQKA 1YFLA 1KIAA 3DULA 4R8RA 3GXOA 4RVHA 3TKAA 3HCCA 2Z6QA 2EFJA 3G2MA 4G56A 5T67A 3EGVA 3DR5A 4PYOA 2IPXA 2O05A 3OE5A 2GLUA 1VPTA 2I9KA 5DTMA 3FPJA 2AOUA 5BP7A 1EIZA 3G7UA 5CCBA 2P7IA 3KKZA 2NYUA 1JG3A 3GRZA 2BR3A 1U2ZA 1X19A 1R00A 1M6EX 2QRVB 2PXCA 3P97A 2PX5A 3OFJA 2C7OA 4RTJA 1BHJA 1I1NA 4MQ4A 4ER7A 3P9CA 2XYVA 5DRTA 3CJTA 3E8SA 5CUQA 4OX9Y 1FBNA 1SUIA 1XDUA 2NXCA 4RTKA 10MHA 2YR0A 3DXXA 5FCDA 1R8XA 2ONYA 2ERCA 2G71A 1G8SA 1JSZA 4MIKA 5CVVA 5HIMA 3RW9A 3PFHA 2DPMA 4CTKA 5IKMA 5E8JA 4ER6A 2AZTA 3UWPA 4EKGA 5FADA 5EMJA 3TOSA 2UYCA 4PIPA 3SSMA 1Q0SA 3G88A 2CMHA 2JHPA 4AZTA 1G55A 4PIMA 1NW6A 4HTFB 2IH2A 2YTZA 5GINE 2OY0A 2GB4A 3EEYA 4EK9A 3B5IA 4XUDA 3SMQA 4KIGA 1BC5A 2YUIA 2BM8A 3PVCA 2AOTA 4M7RA 1TW3A 4OA8A 3UJ8A 1VL5A 3R24A 3BKWA 5JR3A 5E1MA 2ZWVA 2OBFA 5CVJA 5K03A 4GF5A 3HVIA 3KQTA 3G5LA 2PLWA 1EQAA 3B3JA 5K0LA 1HMYA 1WY7A 1I4WA 5U4XA 4ATNA 2Z6AA 3NDJA 4C06A 3DP7A 1ORHA 3L8DA 1TW2A 4YUXA 2ZIFA 3UJBA 3P8ZA 5T6BA 2AVDA 1AQJA 1V39A 3I9FA 1Y8CA 3LSTA 3V97A 2BZGA 4EKIA 5G02A
chains in the Genus database with same CATH superfamily
5EHGA 5TGTA 5TVGA 4K9DA 1KORA 2G08A 5EJ6A 1U7WA 3CYFA 3VQTA 1W9MA 5KQMA 1AM4D 1XU4A 3UK1A 3A6FA 4BNLA 3N28A 4B3HA 4CM4B 1X1BA 2XRFA 3ASZA 3DA8A 1JTFA 1I94B 2ODAA 3REQA 4UEOA 1HNZB 1C2TA 5CW2A 4GXTA 5TSDA 4G9GA 1Z29A 2NO9A 3T7RA 3UJAA 1OWPA 4IKEA 4QULA 3WK8A 1SVOA 2FSIA 4YBRA 1QK3A 1EZZA 3CF4G 1OFVA 4JB8A 2Q27A 4IHKA 3VR4D 3WYAA 3TVYA 1JHVA 2P1DA 1WKBA 3EIWA 2DP4E 3KZKA 4M9XA 2OQRA 1LDNA 2N0SA 3OWHA 4RD2A 4TV9B 1SUWA 1O94D 1BE8A 1PT5A 2PSFA 1WCIA 3IULA 4LGMA 4B45A 4MLDA 1Q17A 4JLVA 3ZBQA 3AEXA 4B3DA 4PYKA 2CLMB 3LWNA 5AJXA 4JP5A 5JNTA 3RAPR 2X8BA 3MRVA 4ZO8A 1M72A 4V0LA 4HMOA 4O8ZA 1PQPA 3OQHA 1TMYA 5KNDA 5FLEX 3C98A 1K8ZB 3EARA 1JR4A 4LKRA 4DLSA 2DH5A 1ILEA 1YQWA 2L69A 2N42A 4LOAA 4P7GA 4CMEC 3BWYA 3QTBA 2HPHA 4JNKA 4MVJG 1BKSB 4EB8A 5D86A 1ZD9A 2BKLA 4JJ4A 3CW2A 4NBTA 3JQCA 1IOZA 3RTBA 1A9RA 3QITA 4LUCA 1G8HA 5C8YF 2W00A 4BB6A 3U6KA 2QU7A 4XWTA 1VJGA 1MJHA 1ZNZA 4NBVA 2VDWA 3PC4A 4EG5A 3MUFA 1YS1X 4YNBA 4NAVA 3N8GA 3OE7D 4D4LA 4YDQA 3BWXA 1NF9A 2FX5A 2IHJA 1YI1A 3SOZA 3A25A 3ED5A 2Y1KA 4D6XA 4ILEA 3L84A 1AQ6A 1VMDA 4DNOA 3E3LA 2QYTA 1Q0LA 2AE2A 4LIPD 4EFNA 3U7HB 4MRMB 5ILGA 1W35A 3N2KB 4KBGA 4TVBA 5I51A 5LQMA 1Q2UA 1Q1EA 4CHTA 4JYMA 1XWWA 2RKWA 3IKLA 4LSMA 1BE0A 3ZW8A 1IMJA 3EB9A 4KO8A 5F7XA 3OCYA 2XCSB 1YJCA 1P3Y1 1F5SA 2H7XA 2TMGA 1IM2A 4FTWA 5JATA 1EA7A 4EB0A 2IHTA 5BSWA 3V1MA 2FW8A 2O0MA 5CD9A 2QT1A 1PIWA 1W44A 2QV7A 1P9WA 1QZTA 2BRUA 2GILA 2IEDA 3E0XA 5TQ2A 3VR6H 2VQSA 5BSGA 5LJIA 1FXWF 3MMNA 4N3CA 3URKA 3PQCA 3O1LA 4JMPA 1QFXA 2GPAA 3OOEA 3M4YA 2Y1OA 1DFGA 4ZVPA 1Q7GA 1GPH1 1HEUA 4I2NA 4NBSA 3QELB 5KYUA 3I12A 3V4LA 5FLKA 2I99A 1ENYA 6AT1A 1PFVA 3CCCA 1PFQA 3U39A 2LP4Y 1M0TA 3OF3A 4XLTA 5FTLA 4GP9A 1L5GB 3DH0A 3C45A 4W1RA 3UXYA 4WV3A 5KHOC 2CB0A 3DKPA 1C80A 2GBCA 1WBDA 3H16A 3TBFA 1W6RA 3FETA 3ZWAA 2PWYA 5FP0A 4NAHA 1Q15A 2P3LA 3BJIC 1LF5A 2XQFA 3PP8A 1JH8A 2ZPTX 5MFZA 5GIPE 3JYLA 1IUNA 2J0UA 3C3KA 3E9EA 4K81B 4RANA 1NI4B 1G21B 5FPQA 1FEZA 3NT5A 3W77A 1L4BA 2C9CA 2JEOA 3KO8A 4G1BA 3VKWA 2VT2A 1UBUS 1GAJA 3GCXA 3NCHA 4LWOA 4ONEA 3EFOB 4UVEA 1U63A 3LDFA 1WL8A 3NEYA 2WYIA 4O2AB 1D4FA 2B1QA 4C05A 3LY9A 4HX9A 1OLSA 1PF7E 3EMDA 2DCUA 4UUOA 2QN3A 2BT4A 2Y05A 4FHCA 4IO0A 1SD2A 4HCJA 3GLHE 3VNBA 4OQPA 1SBZA 5C7OO 2HM7A 2VK8A 2J07A 2R1UA 4NYIR 4O29A 3ZZ1A 2PEZA 4LDRA 1QHHB 5FLXA 1MHTA 1NBHA 1C3LA 4OU5A 3ZC3A 1YHNA 5JSQA 1TM2A 3A05A 4FU0A 3ZDBA 1FU4A 2HQRA 3AUAA 3LC2O 2DT5A 4Q3LA 3X1MA 1XNQB 3TQIA 4AFNA 4MTLA 3BT7A 2QN1A 5CK5A 1T2FA 1B7GO 1J06A 4RLQA 1VECA 3REGA 3VU9A 1CJCA 5I7RA 1B2LA 2IS1A 2P9GA 1HC7A 3HJTA 1A8PA 4RIFA 4GAEA 1ETHA 5AESA 3DLHA 1H5NA 1R6UA 3ITNA 1Y42X 4DCSA 1QJ4A 4N9WA 4B09A 1PL0A 1CDZA 2J9XB 5T3UA 3TDMA 2AEEA 4AJIA 2P3SA 2AW3A 3P4YA 3ROGA 1BGXT 1R15A 2RG7A 5GONA 3T3HA 2WWXA 1FUEA 3SR3A 4C03A 1N0VC 4OQZA 2GZAA 2G67A 1ND5A 4IP0A 1SA0A 1ZUD1 4R0NA 3GFVA 3X0DA 2EQAA 3W3AH 4C0WA 1XL1A 1TJ3A 5AUPB 5LZ4A 2HLDD 3LKDA 5KNBH 1MR3F 2RKOA 2JH3A 4FFNA 1ELOA 1RQ2A 3O91A 4Y8VA 4HTFA 1GTVA 1AD2A 1LDGA 3G0BA 3HJAA 1W9HA 2FFBA 3RWOA 1QTNA 3RASA 1W4AA 4BYMA 3BFXA 4CI9A 3DW3X 3CVXA 4X64B 2VNHA 2J3MA 5EESA 4MA5A 3V6MA 2NYVA 1ADBA 3L01A 4BO6A 5EJEA 5FUWA 2Q7DA 2WKWA 3DT6A 1ORVA 3V7YA 4XQCA 4FZ3A 3FDZB 4B82A 5FOQA 1ZIOA 4R7TA 1TJ5A 1U2SA 3DE2X 2WI8A 4BRZA 2F90A 5LU9A 2QLNA 5CB4A 1BVUA 1RZUA 221PA 3ORYA 4MICA 4FE3A 3UXMA 1HYHA 4AKSA 4CN8A 4OYRA 1WF3A 4II2A 3OHPA 3HCRA 4K88A 3VZPA 2FEWB 3C1UA 4LMAA 1A7AA 1BHO1 1R12A 3VC1A 1QPGA 3W3ZB 4CG1A 4J0CA 4ALLA 4N41A 4FS8A 5JSZB 2NSLA 2A4KA 2WG2A 3L7YA 3L6DA 3DFUA 4W1PA 4DANA 3I45A 4A8JB 2QWXA 2VPTA 1O03A 2VIIA 4NPHA 1Y5MA 3K9NA 3KQNA 3RSOA 1B8PA 1KI8A 2NU7A 3K1TA 1JZTA 1BA3A 2D62A 4PZ0A 5HDBB 4WNAB 4XVCA 4Z99A 5CHYA 2JJYA 3L8EA 1SBCA 1PJAA 1V1MA 2OBLA 1VCHA 2HWYA 3GNQA 4AO7A 2FUEA 3CO0S 1U6IA 5C8YB 1DCKA 2H5JA 3AILA 2BUCA 2OHJA 3EVZA 1JHZA 1JR3E 2WFLA 2SBTA 1UK6A 4MYRA 4WDQA 4QBIA 4A1FA 3TTTA 3JYQA 1BMFA 5AVWA 3LGXA 4KR0A 2UUAB 1MPTA 3UMFA 4A0FA 3MWDA 2HXYA 4ITUA 4J0EA 1GLNA 4LDZA 3QKRB 1N6OA 1UJNA 2LVBA 4JXKA 5BY2A 1YCDA 4JC5A 2UYHA 1X94A 5TPZD 4PNEA 3PGKA 2I34A 5C8ZA 3T12A 4Y2RA 2O8VA 2GPTA 4EUSA 2BL4A 3LJKA 1P4GA 2PTHA 3PYMA 4W5WA 4X9XA 1NN3A 4I1VA 3EPHA 4MRVA 2ISQA 1N77A 4RC9A 4CQLA 2VJAA 1N6LA 2IEBA 3MHPA 4ZVRA 5JYEA 1ZONA 3O8CA 1NZFA 1ZEJA 4CLHA 4RIEA 4RHYA 5DGTA 4FOPA 2MT9A 5MDHA 3MCVA 4RDCA 4NJEB 4XIIA 2FYTA 5COQA 2WOJA 5KCMA 1DMSA 4R2JA 1RQPA 3KETA 1JAIA 3NHYA 3SSNA 4OQQA 3RC8A 4KYTA 3H1TA 1TM3E 1DKMA 1ZIYA 1AJEA 3ZDCA 4AZWA 5E8RA 3ETHA 2NXEA 2ZE7A 2P41A 3NT4A 1VE6A 2BI4A 1HDZA 3M6WA 1KYQA 1MB3A 2G9RA 3U4DA 1BE6A 2PD6A 3NWJA 2P9TA 4YMTA 1XYGA 3I4CA 3T7EA 4TQAA 1EFKA 2VHYA 1UBSB 2WYHA 3ELYA 5HBGA 3UPTA 3GEPA 1FMFA 4S1WA 2Q3EA 2C8KA 3BCUA 1J9EA 2ZTSA 1WMEA 4FR0A 1K4YA 2ZW9A 4YJFB 4YTEA 3IALA 4WL0A 1OPRA 3HJFA 1XRLA 2GJ4A 3BMNB 4H7HA 3KD3A 4XFJA 2YWGA 4QOSA 1H65A 1AV7A 1Y8ZA 4HNAA 1CW2B 2F1JA 1Z7GA 2WUEA 1M8PA 2XA9A 2CBXA 3LY8A 1MQSA 1E1DA 1T6BY 3E35A 4QRIA 3I6BA 3A4VA 3LXUX 2PGXA 4CXMA 1YS6A 2OM6A 1UFKA 2PU5A 3KJXA 3KR9A 3TLAA 4FR2A 2FVXA 4HFNA 4FZJA 3FRIA 2UAGA 1SG6A 4TKVB 2ZRMA 3M3DA 1WXFA 3FPCA 3UT0A 3LCMA 1NYQA 1T2DA 1QYRA 2WD7A 2YH2A 3QX7A 4I4NA 4LBVA 4RKQA 1GARA 3SG0A 2IBTA 3IUYA 2GN2A 2NLOA 1FE8A 3KYJB 4H7EA 3W6OA 4MEBA 4PSDA 4E1VA 3SF8A 2UYGA 3F73A 4QVGA 4GMFA 5TPWB 2QNIA 3B51X 2KBFA 3JVVA 3CKKA 4US0R 5I4CA 2N1BA 1BDJA 1SUPA 1R37A 4XZ3A 4RLSA 1RU3A 3RIYA 3EEIA 3M3HA 3WNDA 1GL7A 2EERA 4BJ6A 5IBQA 4BPRA 5C8DA 3TOZA 2R6ZA 1I3KA 3A6ZA 3UN1A 4C2AA 4FMDF 5EKUA 5A02A 2B4TO 1M54A 1X1DA 4C6RA 1Y1LA 3DT9A 5LKAA 4G0VA 1V8ZA 1ZUIA 3EPRA 3TEJA 1MFPA 4KSCA 3U26A 3ZU4A 1FLVA 1LNQA 4GOJA 5F9FA 4ZPXA 2QR3A 2B94A 4ZQIA 1B4DA 1G38A 3B1JA 3AIOA 3ENWA 4KXWA 5CFRA 2Z08A 1O08A 1TLTA 4JHLA 1PZFA 3E0QA 2XGJA 3V8RA 2GXUA 2H2FA 3ZZNA 3KSZO 5KNDH 2JFOA 1DAEA 2A9FA 3MB8A 3WICA 4WKOA 2FUNB 3ABOB 3GN2A 3DZBA 3EGWA 4FC6A 4TZKA 4WCFB 4M21A 1K8YB 5BXYA 2DR3A 3AVVA 3O2QB 2QPOA 2W2OA 2XADA 3QFSA 5F77A 4HB3A 1EFRA 3N70A 3ND8A 4LV8B 4DF3A 4UOZA 2ZEJA 4YUYA 5LA6B 4ASUD 3VVLA 4NZMA 4RHEA 1CP3A 2OMEA 3U56A 1ZL0A 1XPJA 2ZOSA 1XA4A 1NVXQ 4DMMA 2JFXA 4U4AA 5ECGC 3X3HA 3IBSA 3QTTA 3Q7QA 4IMIB 2YC2C 2Q5FA 1B42A 2CFOA 3E23A 4F7WA 1NDHA 1L7BA 1M3SA 3FIJA 5E1DA 3SIRA 3M9XA 1E94E 1V48A 4RDHA 4E5NA 1N0UA 1AT1A 3QV1A 4NNPA 2XB2A 4WBNB 5LQKA 1GZUA 3H5RA 5KSYA 1XZNA 2EC5A 3C8UA 4B7ZA 1KIAA 3DULA 4YK7A 5EUBA 5L3QA 3SC4A 5IZCA 3K73O 4R7ZA 4YRMA 3W5VA 1ZX1A 3A6LA 4PYOA 4S05A 3CLVA 1UEJA 4UTZA 2RJNA 3L0SA 1RLOA 1EDBA 4NYJQ 3L1JA 5E0KB 1Z7YA 2QPTA 2XYGA 3D1LA 1JNXX 3E2PA 1YTLA 3E6AA 3W9BA 1U2DC 3VUFA 1MVNA 3PFFA 4NZZA 4YT2A 3PJEA 2P9YA 2R6AA 4H7DA 5TC4A 1LQUA 4ZCMA 4EGJA 4YXWD 3ZW9A 5JHGB 2A9QA 1WNFA 1R00A 1Y5IA 1ZS9A 2Q5JA 4EY7A 3BGOS 4M0KA 2OO7A 3QPUA 5EJ4A 1RDFA 3GBPA 1SUIA 3OZGA 4IBOA 1EWTA 3THOA 4G0NA 2EP8A 3KKMA 2YR0A 4ESEA 4O5OA 3P2MA 3FI9A 4BZXA 2NTVA 1BWQA 5U9CA 1JT2A 4K87A 3DG9A 4S3MA 2VYFA 2XV1A 3MJCA 4ZKEA 5IKMA 5J4YA 1YJ8A 2QRQA 3ISJA 1FFGA 4RQBA 1H9AA 2AWNA 3L1KA 4R8VA 4UE6A 5E3IA 3TOSA 1D4OA 2BH9A 3WQRA 1IATA 4KE7A 3AW9A 2Y0DA 2BW0A 2JLZA 5BWCA 3UPUA 4AJ9A 2BSQA 4FDVA 2CEKA 4UCQA 3MF4A 4KXQA 4XTRA 4U6NA 3SMQA 4MR8A 1OI2A 3O8BA 1T4CB 1FFCA 2WZCA 3MWEB 1QQ5A 4GX1A 1DKPA 3ESZA 4FHFA 3R24A 1ZNYA 1K2WA 1XMJA 3M89A 3ICCA 4MVJE 1NUPA 1SG0A 3FCXA 3NIGB 5K0LA 2DKOA 2AGVA 3GDWA 4BNKA 1P0FA 3PC8A 4QPZA 3DO5A 3RM3A 4AUMA 2NX2A 1NXSA 1T9AA 3T34A 3UGQA 3UJBA 4FMDB 4HWKA 3L4EA 1JHYA 3FR8A 5KOJA 3RI3A 4AZ0A 2DERA 4DTIA 2ID4A 4FONA 3LSTA 4Q21A 1QO0A 5EGNA 3V97A 4AS2A 2CV1A 3Q2OA 2B9EA 3IEKA 4GYKA 1Y3DE 1U9YA 3T7DA 1K3UB 4D26A 1UC9A 1XYYA 3QMWA 4HT3B 5EE3A 3IBFA 1KVUA 1RKBA 5FQNA 1KZGB 1L0BA 3A6KA 4AKIA 1Y8QA 3AHEA 1XD2B 3ME5A 3OCXA 1VMEA 4G67A 1UFRA 1IHXA 3R4CA 5JOQA 3OA0A 1A8IA 3AHHA 2GN1A 3AYXB 2FFAA 4OGKA 2FMTA 4MCHA 2X4IA 3H1BA 3GEMA 5K0FA 4ALMA 1H5QA 1F20A 3ZDDA 5DK4A 1QK5A 3HZZA 1A1SA 9LDTA 4GLFA 3ZBPA 4E6PA 4KQFA 4E46A 1AMUA 1YFKA 4WOJA 1IAQA 3FZEA 4TUYB 1NYLA 3UWOA 1ZSVA 4QXMA 1NZJA 4DDUA 4HZUA 4NG5A 1EVYA 4NV0A 4PGMA 3IXQA 4WY2A 5CG1A 4I5DA 4PEVA 3CZQA 3DBRB 1RLJA 1M2VA 2V8BA 1NFFA 2ZSAA 1EINA 3GR6A 4Q00A 4E5VA 4PRZA 1XMPA 3HJUA 4G1VA 4MIYA 4UUQA 4EQZA 1OHHA 1AO3A 3O4VA 1Z26A 1SHLA 2Q2NA 1JQDA 4JVSB 4G1MB 4BP9A 2AN1A 1GZHB 5AH0A 1QH8A 4RADA 4O2LA 2QRVA 1KJWA 4UAVA 4EFMA 1NL3A 4MP6A 4ZHSA 4LHWA 2EDCA 2XRZA 1XVLA 2QK4A 4BMXA 1E3EA 2PRKA 5DM2A 1ZD3A 3N2ZB 3KU1A 1YQGA 1T1JA 4F84A 3H5IA 3U3KA 3H83A 1UEXC 3MRXA 4KQ2A 2PGAA 1IPFA 1C3EA 3KKQA 3E7WA 4MVJH 3IS3A 1IULA 2CNWA 4B4WA 4Q37A 1P5JA 3O03A 3HFGA 4HAXA 1RWVA 1LBQA 2AXQA 1F0KA 4E2FA 1KI1A 4BVBA 1EB9A 3LA6A 3ZWKA 1RWNA 3ZK9A 5LQJA 2PT6A 4P7JA 3UMSA 1GUFA 2C8VA 2WJ6A 1TQDA 3LX6A 1X9GA 5G0WA 1NAIA 3SQMA 3K0CC 4WOCA 1QU2A 4OHYA 2AN9A 3D2LA 3LUGA 5KJCA 4L76A 3R0IA 4K9RA 4QOGA 5KNBA 1QGYA 4KBYA 5ECYA 2OYCA 1GU1A 3L6OO 1UXHA 3BEOA 2J5BA 4XDYA 1ANKA 3FPKA 2HNKA 4UM9B 4D41A 3UG6A 1XCJA 4ME6A 3RQIA 2R8XA 3GELA 1GEGA 3G2LA 4R1PA 1RC8A 4HNRA 5C35A 4UBNA 3GFOA 3NPAA 1D2EA 2QYSA 5DTQA 1RYBA 2ERXA 3KSMA 2I6TA 1ZJ5A 1WXQA 3MS2A 3U4AA 2DXIA 1ORTA 1SKYB 4KXLA 1U7UA 4NDNE 1QB8A 3G9QA 5D7BA 3CKLA 4Q0MA 4CKCA 2FF7A 5JBQA 4B40A 2JANA 3F3YA 3JARB 3PL5A 1WZUA 4RESA 4UEKA 2QTZA 3IP1A 5BNTA 1OZFA 3BGIA 4AJJA 3WMWA 2Q41A 1XN1A 2ZP1A 4RPGA 5HF8A 4ZCTA 2FQWA 2PA3A 2CNDA 5FR2A 2A7QA 1Q50A 3VPSA 5AKKA 3CRRA 3LVRE 4GWKA 4B34A 1XU9A 1X7XB 3EVGA 2FN9A 3LUJA 3NKLA 3R74A 4G0WA 3R1IA 3K6KA 4WASA 3Q88A 2NNWB 1ORWA 2UXCB 2BTEA 4B8WA 3BTVA 1D2MA 3WS7A 3SXUB 3I2GA 5ICGA 2KSQA 2Y1WA 4MS3B 3VDNB 5I7FA 3Q7IA 3UT5A 1U7OA 1W8IA 3JD0A 2XQGA 4LFAB 1KVRA 1TQHA 1VLMA 7REQB 1C0EA 5BSHA 4TV9F 2H0QA 1EM8A 3EXHC 4L07A 1T3SA 1S2MA 3FRHA 1VKJA 1EGAA 2XAUA 4XVRA 2G28A 2ZKLA 3D7SA 5EZ6B 3ILXA 1ONSA 2DE0X 4ZEVA 2WPDA 4DG8A 1L7XA 4ZAYA 2ENWA 4OLHA 4PF1A 3X1WA 4LF6B 1W36B 4PHCA 2JI6A 3NX4A 1Z4PX 1UWVA 3K5WA 1MXHA 2LV8A 3LGSA 1R0BA 1MB0A 3I9JA 1CIPA 1R4NB 1CE8B 4K3UA 2FXVA 4MIEA 4U2BA 3CR8A 5AHXA 1W0CA 2FZCA 2VBIA 3HKBB 2VTKA 4OHUA 2PX4A 3E81A 4CFSA 3E8MA 5K4GA 1YNOA 1WV0A 1CLUA 3A58B 3PTAA 1NLZA 2Q99A 5K4AA 2QTAA 5HX7A 2Z0MA 4AZSA 1NBMA 1JS1X 1MC5A 3OEED 4D4GA 3LP6A 5FAKA 1OC4A 2I2WA 1BMQA 1QE0A 4M37A 4L5CA 5E2IA 3B12A 5HA5A 1K9VF 1PG5A 1R50A 2D4HA 5DV9A 2GESA 3ZX5A 3OETA 5KVCA 2VJMB 4RF2A 1X8KA 1ZNQO 4WEOA 2A5JA 5FI5A 3UAOA 2OL4A 5F3WB 5BN3A 1EXDA 3AKDA 2W98A 5EOVA 3TBKA 5KTKA 4BY9E 1Q0ZA 4X63A 5LBUA 3S1SA 2FPUA 1XG5A 2G06A 4RW0A 4C22A 3ABRB 3T4PA 3NALA 3GRPA 5LYJA 2BHRA 3Q8LA 4OP2A 3Q4GA 3K1ZA 2C3UA 1UOQA 3LHDA 4HDMA 5ER9A 4OXYA 1P3DA 2I62A 2JIRA 2TMYA 3MUOA 1UKVY 4M4SA 4YJ3F 1JDPA 4XB2A 3D2BA 5DGIA 1AMNA 3L04A 2WYUA 2IYWA 5AP9A 2OC9A 3K4QA 4RKEA 3NHPA 2XMBA 1KO1A 4CMKA 5ARBA 4V0KA 7GPBA 3OO1A 4YRDA 3QE4A 3MAAC 4ZI7F 5AVSA 5EN4A 1TIPA 1O6GA 1SKQA 1VSUA 1EUYA 3OQIA 3IAS6 4JEMA 2OCLA 4LYFA 1NNSA 2P62A 3FVVA 2V4UA 4JX8A 4YS6A 1CJKC 4EPTA 4NOLA 3HBAA 4QFMA 3EZ9A 1W5AA 4AECA 2I8LA 1RWXA 3DWIA 4ITRC 3RVDA 1UC5B 2DAPA 5FBWB 2Z98A 4TTVA 3N8KA 1IZZA 3O7MA 3TTVA 3L05A 3LF2A 5B1HA 5E95A 5CPFA 4PINA 2V6MA 2WDZA 5GVRA 1L5MA 1K2VN 1T36B 4YJGB 1UT8A 1R8YA 2JD0A 2YVKA 3O4IA 3GT7A 1C1HA 2E0IA 2IPAB 1DSSG 4ND8B 5EWJA 5CGZA 4PLFA 3DUFB 2CWDA 2B99A 2YY6A 4BVAA 1XD9A 4KE6A 1VBFA 3SZGA 3HJGA 4C6TA 2PQ2A 2V3WA 5EZQA 1C3OA 1AKUA 3K4PA 1J5EB 1GM5A 4XGKA 3L7MA 4J49A 2O9JA 4XKJA 1IN4A 2D2IA 2I6FA 4MWTA 5IAJA 5J1SB 1KJYA 3VUEA 1SCIA 3UCFA 2E1RA 1RQXA 4AUNA 1GL9B 4P9NA 2AMJA 4DXAA 4LRYA 1JAHA 4URFA 3DMTC 2Y0EA 5K6RA 2Z8ZA 3CQ9A 3MG9A 4AJPA 2B4RO 2OEPA 5KI6A 2NVWA 3D8BA 1W46A 1F8UA 4MIOA 3T9FA 3WGIA 4LTDA 4OOFA 4JNCA 4RFSA 3RFXA 4GUDA 1UFOA 5BUSA 3ORFA 4RNDB 3I0ZA 4RIIA 4D02A 2D5AA 4UHFA 1DXQA 1MX1A 2BEUA 2XUHA 3MZ0A 3UUFA 4HDOB 1SBIA 3MCZA 1ID1A 2CZGA 4FKZA 1P4AA 4DQUA 1ZRMA 3BMXA 2YHAA 3GD7A 1FYWA 4K03A 3U09A 1JHDA 4MYCA 1UMKA 8MHTA 5F78A 2ZREA 2P2ZA 1L5HB 3PXGA 1OLUB 2DHDA 5AUOB 4Z4GA 5E38A 4BP3A 4Y1GA 3ZE8A 4YRPA 2JJMA 1I3LA 5K0CA 2HR1A 3WB9A 3IUQA 2PUGA 3I9LA 4KQGA 4LYJA 1KSHA 3KKNA 1J6UA 1IQ0A 4ZVVA 2GERA 2HT6A 4HFJA 1YRBA 2W8ZA 4OP3A 4DLKA 1QGAA 3CN7A 1RP7A 2ZE6A 3IBTA 4Q82A 1V3VA 1A82A 1YVEI 4MB2A 1QIIA 1GUYA 3RRMA 3NTRA 2I2AA 5LZ8A 4BQIA 3DTVA 3IURA 5IF3A 5EIAA 1YOVA 1K5GA 3F7OA 4O4IB 3ROZA 4H1UA 4QWWA 5KKNB 3PIDA 5T5QA 2I2DA 1Y34E 4XOUA 2IS4A 4LZJA 1YF3A 3SHFA 3W9YA 4AKTA 1IK6A 3TGLA 3V2UA 1M1YE 2X7JA 4K0KB 2FFQA 3OQVA 1IY2A 1PHPA 4PYIA 4XVHA 2FR8C 1CZRA 1M6WA 1TM4E 2HZ7A 4CQLB 1E9SA 2HD4A 2E4ZA 2YFQA 1E5XA 4HXYA 1KO8A 4RF3A 4RYLA 5FL3A 2G4CA 2QF7A 3QHPA 4EJFA 4A0GA 4KGXA 1RADA 2WABA 2Y1DA 4ZO9A 3TLYA 1ZOOA 2C8LA 4E1BA 5TMPA 5F1OA 2KI5A 2ODEA 1XF1A 1DAFA 3GBVA 2WAMA 4UTRA 4HUTA 4YQFA 5I7VA 2O59A 3VNSA 5EJ5A 1RXUA 5EIOA 3LT5A 5I7WA 4XAQA 4A26A 4OX9B 3IUBA 1SU7A 4DABA 1JE1A 1MQ9A 3NV9A 4AS3A 5T8KC 1U6KA 2EGGA 2EFGA 3M1YA 1CY8A 4MAFA 5LNK1 1I6WA 4PAOA 1N4DA 2WF6A 5AW7A 4AAYA 5EXXA 3O2NA 3WHIA 4D4JA 3W5UA 2X0DA 1EQ2A 3D5TA 3KHUA 3M3PA 3CLTC 4MUKA 1EI9A 2IUUA 3TQRA 5BV1A 4ZFNA 3DC7A 1N3YA 1QH0A 3ZWPA 5IVPA 3L4KA 2VTBA 2EFHB 4D9JA 3RUPA 1TAGA 4J6FA 2PT7A 1O6FA 1O5OA 3DMNA 1XTTA 3GGDA 3OOWA 4FI3F 1SAYA 2WJHA 3DQZA 4ANFA 1Y6JA 4BLQA 3TD2A 4CQJA 3NDRA 3V8QA 2XODA 4XGRA 4ZMSA 5BSVA 5CDUA 3R3WA 1KOFA 3BXHA 4MGZR 4Q39A 3N3AC 3CLSC 4TX1A 4Y0VA 3DEFA 5AQEA 1SXJC 4IV0A 3VZDA 4F3NA 3CEAA 1QO7A 4MJXA 1L4GA 4MMZB 3MWGA 3C4JA 4MUIA 5SYMA 5KC9A 3V32A 5C5EA 1LJ8A 1P5ZB 2E49A 4CEHB 2JHAA 5KYYA 3F97A 5KTTA 1CX9B 4HWPA 1AZTA 1FQOA 1CQPA 2C7PA 3DF7A 4RE5A 5B64A 3CKMA 3EQ6A 3W6NA 1DAGA 3I2FA 3A11A 1IHUA 1SJ9A 2HPZA 5HZHA 2CYAA 1ZHHA 1DOZA 1PBNA 1F4LA 2AF3C 2OSBA 2YHIB 3GFRA 3KJEA 1UPCA 4A92A 3GAZA 1NY6A 4RVHA 2YDXA 1LGYA 1YQEA 2IL1A 3P2OA 3H42B 5SY9A 5C80A 2XMDA 2JLBA 1QCCA 3ETGA 3H2YA 4GI5A 4A15A 4PNPA 2GD1O 1LBEA 1VPTA 3Q9SA 1I8TA 4E13A 4PG8A 4V0MA 2G1JA 3KE9A 4UBMA 3G7UA 1WHSB 1M34A 2ZIUB 2VC2B 3EUWA 5IWCA 1BX0A 3OPYI 4C9BA 4AQYB 1TVCA 2O6LA 3II6X 1FLAA 2HHJA 3AUTA 3QYJA 3PC8C 4DQDA 1DGQA 3L79A 2F48A 3ASYA 2OTCA 2BN4A 2IT1A 2QDXA 3ASVA 3NR2A 3NXKA 3MS4A 2F1HA 4GKJB 5KVVA 1TK3A 3U1VA 1KOLA 5LZ7A 3RRNA 4CKCB 3INNA 5KHLB 1RSZA 1KAQA 4K9KA 4CV2A 3AF5A 4D8TA 1QO9A 2WJIA 4QDOA 2JVKA 3OWOA 3LX5A 4G86A 2UZ3A 3DM5A 1VJTA 4BX3A 2V7BA 1VIMA 5EZYA 3UWPA 1IZ9A 5JXGA 4MS1A 3H97A 4FGUA 5IHPA 1TTQB 2JBWA 4WCVA 3ZWCA 1B0UA 4ENSA 1AHHA 1NVVR 3E03A 4NE2A 4XJVA 4XUDA 4BO3A 1T4GA 2G07A 3OLCX 2VVTA 1PJQA 5LD2C 4CCAA 8AT1A 1PFWA 4OA8A 1VBMA 3V2HA 4MVJF 3ES9A 2LPMA 1G5PA 3B3JA 4BEJA 1TADA 2P1ZA 4QJ3A 1RE0A 4S2UA 3L2OB 1FUYB 4LHZA 5CCDA 4BNDA 4Z51A 2VH5R 4HDRA 1EM8B 3BEDA 2C92A 4QOIA 2J5XA 5PGMA 1SOAA 1VJ5A 2NT4A 3GDOA 2Q62A 1DRWA 3CPSA 3LRTA 4WBNA 1GA1A 3TN7A 2ORIA 5AM3A 2IPOA 3KLNA 4YCDA 1VQ1A 4EB3A 4HRXA 1JJBA 4IOJA 4K26A 2C07A 5FT9A 1PZNA 2CVQA 4ND4A 1RAFA 4F3CA 2A33A 4MHTA 2XF8A 2RSLA 5DK6A 4QTYA 1IL0A 5A62A 5EHZA 2JVJA 3BKXA 3WA7A 2EV9A 2CCKA 4EB6A 4BQPA 4DCPA 5LN1A 1FDWA 1ZVJA 3PL1A 1R88A 2ARKA 4GDFA 3O75A 2HMVA 1UKAA 1RC1A 2Q5EA 3UOGA 4UCWA 5KEIA 3LHSA 5D3KA 5ALSA 4JODA 3VVBA 5A04A 4D7AA 3OZDA 3AINA 4TMTA 3L0OA 3AB8A 5K8LA 1JHPA 2NNLD 2VP2A 4U7PB 1PR9A 4Y0AA 5IYZB 4UARA 4BAUA 2H3EA 1OLSB 3IHTA 1DFIA 1Z22A 4RTRA 1CJSA 1ZRSA 1E6EA 4CKBB 1XB2A 1XVIA 2FPSA 2XGGA 4IQFA 1UPAA 3SZMA 1EFPB 1EK6A 4DXHA 3QW4B 3OZRA 5DCYA 1EX7A 4Q6WA 3HUEA 3PFCA 4O4JA 4UHEA 1W59A 5KOHB 4MW0A 3GPDG 2FLVA 1FLDA 1L1RA 2FUG1 3OCUA 1QX4A 4QJIA 1MX5A 4WXMA 3EF1A 1C1DA 1PJ3A 4LZPA 3ZE0B 5ICSA 1PR0A 3BWEA 3R2JA 3DE3X 5ALZA 5JECA 1IH8A 1T5IA 2PBZA 2FRDC 4WADA 3Q3CA 3VU9B 4MYDA 1WB9A 1QVAA 3L0BA 3DBHB 5ALJA 1PJTA 2W6PA 2XNKA 3HCAA 1N25A 1ZCFA 1OV4A 2WLSA 1NULA 2ZYRA 3ROMA 4F0JA 5C4IA 1LWNA 4X65B 2VLIA 4DR4B 4KO3S 1I6KA 3L41A 1NRWA 4YGXB 4EJMA 5AMXA 1XJ5A 1PJZA 4A6XA 3OQIB 4QYXA 4ENRA 1PL7A 2IIVA 2QYHA 3JVDA 3LCJA 5F4BA 2VPZA 4KODA 4EPWA 3F67A 3DMFA 3AR9A 3NBZC 3DVAB 2I6QA 1AGPA 2RBEA 2ZDQA 4OKIA 2EW8A 3DNPA 4NCJA 1GA4A 2AA3A 1KKUA 1KPIA 3A9SA 3CG0A 3VR2D 1R16A 4PCAA 2I8AA 3A1NA 4AJNA 4ADSG 5BOSB 4MKGA 4E70A 1Z4KA 3HZHA 1ZQ1A 3M4XA 3MT0A 1V8FA 2OFWA 3HB0A 4WNCA 2W4IA 4RV9A 3U17A 2CVOA 2CHEA 3GA0A 1IEVA 1NQUA 4G0QA 4O2BA 3U3DA 3CPJB 3E9RA 3UXEA 3KYDB 3EXIB 3K6SB 3F6EX 2ATCA 3Q3IA 5CYOA 5B37A 3GEGA 3WISA 1P44A 4EY8A 5C8VA 1YK1A 3KVVA 4F2PA 3GLIA 1KBQA 1KZYC 4V1CA 4PS1A 4GOMD 1R6AA 3PPXA 4ZA2A 5BT8A 3GP8A 1GN8A 3MSXA 1EFCA 4IWXA 1NTRA 3HB7A 1KFJB 1TC2A 5BV0A 3L7BA 3W5AA 3FNRA 2UXBB 4NXMB 1OH6A 2LCFA 1UPTA 4NEGA 5HEKA 3M0EA 1O0CA 5JJBA 2YV5A 1LXCA 3S81A 4UPVA 2JFNA 4BO9A 3NJ4A 4XWKA 3IJRA 1MIHA 1U0NA 1OAOC 3QEMA 3ZGYA 1I3MA 5HZMA 4ZC8A 3RREA 5GIOE 1LS1A 1EKXA 1LI7A 4UDYX 3SQDA 3UHJA 5EKTA 5P21A 1NZDA 1D0SA 4NWIA 2BGGA 3KEOA 3T99A 1P4SA 2Z2ZA 4JLDA 1H4TA 3UFBA 5EXSA 3R23A 3L06A 1Y0BA 2G0AA 1DIAA 2QXUA 1E3SA 3DZGA 3BG5A 1G7TA 5LM3A 3TBHA 3TSZA 4BLVA 3CLKA 3FUVA 3HUDA 2IE0A 1S2LA 1QP7A 1YZGA 2WVGA 4LF9B 3HFRA 1PV2A 2QKYA 2WJ3A 5IVIA 3TLGB 1W48A 2QZPA 4BO5A 4AWBA 2C0CA 3F90A 3LRPA 5C7IO 4J2OA 3I53A 5FWYA 1PSDA 3UB2A 4A0RA 3QMVA 1B6TA 2Q1SA 3Q10A 2QG6A 4N7BA 4TV8B 1VL0A 4X1IB 2GBLC 3S1AB 2X0KA 4CG0A 2QTCA 3LT1A 4R2XA 2ZRGA 4QG7A 4HGZA 2B83A 5ENDA 2BSAA 2FPIB 3CJRA 3T9BA 1XD2A 3THRA 1MEEA 4OHMA 1BYUA 2A0KA 1IXZA 1ZJZA 4K1XA 1XLTA 2GYUA 2IZ6A 4IDNA 1OB5A 4JBNA 3IUMA 3U19A 3Q1KA 1X77A 3CEJA 4IJKA 5LSAA 1JAXA 4PBRA 5ANRB 5FOSA 3AF1A 3S68A 2JC3A 2QSZA 3H8VA 2UVDA 4BVHA 1UJCA 2V3CC 5LB4A 4OSOA 3AOEA 4BVKA 2QL7A 3LTNC 4D9EA 1QDEA 1M76A 3E2IA 4KRGA 1CWUA 5HZGA 1HK7A 4AG5A 3IV6A 4JLAA 4YJ3A 4Z7OB 5FO0A 2HYIC 4N40A 1ZN9A 5JVDF 2ZXUA 4QRHA 3WADA 1M2VB 2GLXA 1Z25A 2I4OA 2IPNA 1L7MA 1FXWA 1V16B 1WHTA 2Q4OA 3HFJA 1XXLA 3MINA 3L77A 4KAFA 4P36A 3WGGA 3WL3A 4IEIA 2ODBA 2FKAA 5FO1A 1M1NA 2AUMA 2NTJA 1CIJA 2WHPA 2YYAA 3EPPA 3KD2A 2JFWA 5KNLA 1MEOA 4XX1A 2C7VA 1EDOA 1EXMA 2WM8A 3BMNA 2G36A 2O07A 3LQ4A 4YONB 4Q9JA 3KWMA 3TNLA 4F6LA 5M29A 2R79A 2DLDA 5AR1A 4XWYA 3GV0A 5A5GA 2CYCA 4P53A 4WK6A 1L5OA 3ZZMA 4C7OA 1JDSA 1B8OA 1HE3A 5D5QA 2OHFA 2AOTB 5IBRA 1TYZA 3NUQA 4RVGA 1K4KA 3T7JA 5C4MA 3FBTA 1JKIA 5K0NA 3GFTA 4A0SA 2H6EA 1C4XA 1TE2A 2JCSA 4MJ3A 1Q1QA 2ZJAA 1KU0A 2HSDA 4YDSA 3KOWA 3KZVA 3HEMA 1LC3A 3K15A 3O4GA 4AG3A 4BEVA 4UEQA 3BRQA 4TLMB 2D06A 1IBRA 3Q3HA 3ZGOA 2W43A 1J97A 4YRGA 1JWLA 2ZK7A 1NJ1A 3DMTA 1RI2A 3DPUA 4INPA 3T7IA 2QRGA 3DOOA 5BVGB 4RNCA 5JS2A 8GPBA 3EVFA 5HJ5A 1PZMA 2IHVA 3NIFB 2HRCA 4JBXA 3ZGXA 4R68A 5CFOA 1F6DA 5DM70 2QD2A 1QKKA 1JGTA 4L4YA 1AZSC 1TZJA 5TRTA 3CUWA 3H3XA 3O92A 2MYUA 1PJRA 3KYIB 4Z3DA 1TZ2A 4O08A 2A9PA 3RUHA 3KPWA 1BE1A 1ZWKA 2RCYA 3LUBA 4DDMA 1DU4A 1I7LA 1SC3A 3L02A 3EPJA 3LCCA 4H6XA 1BOOA 4MW7A 5NLLA 1FP1D 2QU8A 2CXNA 2Y2UA 3X1ZA 4CM3A 5DWDA 2W6CX 4BTEA 2Q9UA 4X45A 2IYAA 2C4TA 5EIBC 5CFZA 4ZOAA 1Y9ZA 1MJGM 1N1MA 1XYVA 3FPAA 3W2EA 1FFDA 2I1LA 3W7BA 1AZWA 2FV8A 2ODPA 3EVTA 1HDXA 16PKA 3BDAA 1VL8A 4RVSA 2J9GA 3AFGA 4DR1B 1UT5A 5DE3A 2AXNA 3QLVA 4DCJA 4G5OA 2BEJA 3QVJA 1I2CA 4DLXA 1U2PA 3FUTA 5F5XA 5I9MA 1MV5A 2OUKA 4FCTA 4PS0A 3OLXA 1OILA 4QAQA 4B3JA 4YCCA 1CVLA 1DTEA 3AF6A 1NV8A 5BURA 1X1AA 2G5CA 2YQZA 4XR9A 3WLSA 5JMOA 3HCEA 2A3RA 4K6HA 4DRZA 1CUDA 1X9HA 1E6UA 4LRWA 3SR4A 3UUGA 5BSKA 3ZGZA 1F2UB 1J90A 1LPNA 2XJ9A 3N7UA 3KQVA 4MV8A 2EIHA 1SOVA 1M10A 2G0TA 2JGLA 2XKJE 3UANA 5C1IA 3JRNA 4F5EA 5DCUA 2RONA 1QGUB 1R5JA 3FF4A 4EQ6B 1C3XA 2AYXA 4TTTS 3TLEA 2G0NA 1TYCA 3E7PA 2I33A 1NI4A 4BEBA 3MQ2A 2X5OA 1UJ2A 3H4MA 4HLCA 4V3CA 3NJRA 1CQJB 2W2XA 1RBZA 1UK7A 2A30A 2ZUWA 3H8JA 1O5IA 1Z34A 4HQRA 3T61A 5K09A 5TMEA 2FR1A 1QIEA 1GGKA 3D8UA 1Q0HA 1AUOA 1X8XA 3EIEA 4XIGS 4RD0A 3L8ZA 1TD1A 3ZYZA 6ADHA 2YBEA 1P74A 4FNMA 5IG2A 5IABA 4UU0A 1PS9A 2D7CA 1MA3A 4N5MA 6Q21A 1R8SA 1X1QA 3ZHRA 2WKSA 4XEUA 2IXDA 3GLFB 4DBLE 4ECEA 1C9JA 2D5CA 1ZWLA 4ENVA 1CJVC 2I66A 3GFGA 4ZI5A 2JJ2A 5GGXA 1EDEA 2G70A 3ZE6A 2WWHA 4M1KA 1MAVA 4WJKB 4HPWA 5GM2A 3S6JA 5LIPA 1LPMA 3I3SR 3LUFA 2FHSA 1FP4B 4F5WA 1X7DA 1HE1C 2WU3A 3I8OA 2V65A 3IQEA 1YUBA 4PBSA 3TMKA 4BLUA 5A3JA 2BBOA 3ZV7A 4DC9A 4FT2A 2VJYA 5AKZA 4CKZA 2YNMA 4IS2A 3U5TA 3DV9A 5GM1A 3G7NA 2FZVA 2VAVA 2Y4NA 3OMXA 5EKXA 3C24A 4YRJA 5BSTA 3RAGA 2PBLA 2VP5A 2GNPA 4RS3A 1H1LA 1RAHA 4ZGGA 2C2XA 1I2MA 1NOJA 1I36A 3QRWA 3NGXA 4EJSC 4JJKA 1R18A 2A78A 3GWGA 2VWPA 1W36C 4E5SA 3TO5A 3A1CA 4UQPA 3RODA 4HDNB 3ML1A 4KLAA 3L4BC 5CPBA 2WIFA 2ZAYA 3GJXC 3QVTA 2JIDA 4EI9A 4EAQA 4C0AC 3GT3A 5KTOA 1V3QE 3GJ7A 4F85A 5C7YA 5CBPB 2O2ZA 3L8CA 3RABA 1PZXA 1C30A 2FWMX 4HQ0A 4KLCA 1PFYA 3X1XA 1QCDA 4XM0A 1YKGA 1MO2A 3Q3VA 4JVOA 1NIPA 2IEGA 2VCYA 3FLEA 4Y9RA 4JI1B 2P2GA 1WWKA 1ZJ4A 1JYEA 3HQ4O 4YUZA 2SKCA 1RHRA 4Q12A 4DWJA 4UTOA 5D85A 4O4JB 4X62B 1ZM4A 5BUCA 1GPYA 2VRCA 4B3CA 3H6HA 3RS9A 2RC5A 1U1IA 1GTL1 3R44A 3QX3A 1Z0ZA 2C5FA 1I2AA 1NU6A 3ICOA 4MROA 4OV6B 4UTXA 4ABYA 5LNK6 4FEGA 3U4HA 5CEJA 3ZHCA 5EMLA 4AK9A 2H54A 1GGMA 1HDRA 2WA1A 3C4QA 4AW9A 5L4LA 2QM7A 3LECA 4WECA 2IEAA 3LQ1A 5GOTA 1S8FA 1W94A 3N39C 1EP1B 3FCEA 1CUFA 4DPLA 2VR1A 2FEXA 1FOEB 3H99A 3NAZA 3PGJA 3HNOA 3KJZA 4OSPA 3O0DA 2AXPA 2ALJA 2R00C 4TVOA 3RK4A 4ALNA 5TARA 4F11A 2CVFA 5DGXA 4LPSA 1ODCA 3AERB 3C74A 3JQDA 5AOAA 5IC6A 1DG9A 3H17A 3S8YA 1J2EA 2C4MA 3OLYA 1SCQA 2DECA 1U98A 3CONA 4QXAA 3VR4A 2PD3A 4XSGA 3DEHA 5JMTA 4B6SA 1D5WA 1KI9A 2WQZA 5DN9A 3ZHZA 4NONA 4L4ZA 3HCCA 5KDLA 5HKKA 1GV1A 5JDIC 1XRMA 3UAGA 4IX1A 2HSZA 3KYDA 4IX9A 3FI0A 4RK4A 2JFYA 2H2HA 3K6SA 4GYWA 1SWVA 2WSBA 3DFFA 1A4XA 2P65A 1AXRA 2HSEA 1Q1GA 3FYHA 3OJOA 3UB3A 3UMBA 3KKZA 4LQLA 1CRZA 4EI8A 4UUPA 3I05A 2IZZA 5JH7F 5KTYA 3LYHA 2CXUA 1C81A 3T1HB 3LWZA 3BCHA 5DI9A 2WB4A 2QRVB 1ZIXA 3LP5A 4PVCA 2VYVD 3VR0A 1U4NA 4UM8B 5ENZA 1KC3A 3GLVA 2HY7A 4YO8A 4ASUA 2J3DA 1N2JA 3QKSA 2WKPA 4TWIA 4OX9Y 5HFNA 4Q34A 1JQ5A 2YNMD 4L6CA 1RXIA 1LLFA 1PHRA 3TZCA 3GLIE 2FTKE 4IRUB 1HX7A 3DWGA 4KLNA 2I7XA 3DBRA 1WCV1 1V5EA 4IMRA 3C3MA 3VJKA 3PWZA 4QDZA 4M0PA 3RARA 1DCFA 4M9ZA 2VDKB 3TW4A 4FEYA 1RHQA 3G59A 1Q7BA 1LW7A 2C61A 2JNWA 3OZFA 1N1GA 3EY9A 3EJ6A 4D3DA 4YRLA 1F48A 1UM9B 4CMBA 2ZRJA 1PEYA 3RVNA 2JJ8A 3TQFA 5GINE 1DC7A 3H8WA 4ACBA 2XLBA 3B5IA 3SS9X 3PTLA 3NB0A 1X13A 3AUXA 1ZSYA 4LGYA 4F5DA 4QOFA 1EWYA 3CNBA 2C29D 3M1IA 4BJ5A 2C2KA 2UUPA 2CK3D 4PBTA 1A4UA 4IJUA 3OPVA 1E2DA 4W5JA 1Z63A 3H2SA 3URMA 1E7MA 2BFWA 3PPVA 4BMDA 3SS7X 3ROPA 3STUA 1U31A 2YWDA 3LO8A 2H4JA 4F2GA 1OB2A 2NQ8A 1G21E 1DELA 1EVEA 5JCOC 2J9RA 5T6BA 1ACLA 2B1RA 1LPSA 1FSGA 1HDGO 1W4LA 1FNSA 3WB2A 3Q1LA 2EKPA 3TSCA 3BL5A 2C2YA 4BN0A 1AKTA 1VCIA 2WD7B 1NONA 2X0JA 3BILA 3NRBA 1H5UA 3WG9A 4ZQGA 3FNBA 4DLBA 1C8LA 4DJTA 4CDRA 4YDHB 4Z3KA 3N53A 2QJOA 5HJEA 4EABA 1JQJC 2C5BA 1BWPA 1WMAA 3IDOA 1G7CA 5L3ZA 5JV5A 3T5TA 1LTHR 3HXTA 4KFTA 3A4YA 3CRQA 2OHVA 4FJ2A 1FSPA 4J1QA 5ALOA 4DCOA 3FGZA 1QX3A 3PGLA 4ZDWA 1CUSA 2DQZA 2IKSA 5THKA 3GLSA 2PKRA 4HGOA 4MWZA 3GDFA 1JWAB 3HN7A 1DTWB 1QOPB 3JW8A 2GYWA 3R41A 5FPKA 3TPFA 1ECPA 3M5PA 1OXBB 2ZPUA 3PNYA 2A9KA 3D9QX 2QBYB 3AL0C 1SC4A 3AONB 3WGLA 4CG2A 2WWYA 1QP0A 2IX9A 2R6CA 2WV9A 2AC2A 1NM5A 2BMWA 2QMHA 2XB4A 1TPZA 2YDYA 4YLEA 5TNXA 3V1KA 4DCMA 2NXWA 4Y2SA 3PDUA 3RSHA 3ZWQA 4PCUA 4OHVA 3OG9A 1ADJA 1KI6B 1PZEA 5KSWB 3MTEA 5HFAA 1QRUA 1FPMA 3DW1X 1RXSA 1PL6A 3B1XA 3H5TA 2CXPA 4RY2A 3FUXA 4UCFA 1ISMA 1GTG1 2ZANA 4TMKA 2WZDA 2QVGA 1TKCA 1QGED 4NMWA 3ZBUA 1Z2PX 1S89A 4JU9A 2WT8A 1UPBA 5EZ5A 3W9UA 1SOUA 1U7PA 1ZM9A 4ZRDA 2O2SA 3UOWA 4HI0E 4ER3A 2A2ZA 5CDSA 2W2PA 1S8OA 1A9ZA 3TB6A 4E03A 2C7OA 2IU6A 3SR0A 2YQ4A 2BM0A 4IVNA 3OT1B 1Z74A 2ADMA 3BS4A 1DQYA 1KKMA 1X8JA 3KSUA 5EP4A 3SX4A 1ESNA 1EJ6A 2IP4A 4I8IA 5AM1A 5DNAA 1OGJA 4NESA 5EMMA 1D04A 3BA6A 4JC8A 3ETNA 3FNQA 5SZHB 2XB6A 2JD1A 1WUTA 2GFHA 3SHWA 1YDMA 2YN0A 4AURA 3GYBA 1R9MA 1CT9A 3MELA 1SXIA 4KQEA 5EHQA 3VMFA 3AI3A 3ZJ4A 2VUHB 2OV2A 2P40A 3PPYA 4PZDA 4P2GA 2EL7A 4XR4A 4F2DA 5AK4A 4CDGA 1D1TA 3EG9B 1JHAA 5FUBA 2IOFA 4ZVOA 3S2FA 4ARSA 3ORQA 2MSEB 3DCYA 4JLKA 5IAAA 2XY4A 2YXBA 4U0KA 5CYGA 1A9YA 2JLAA 3ESBA 3IMKA 2PX8A 5BSEA 3FZYA 4GMGA 3CX6A 4HF7A 2BUBA 2R8PA 4CGZA 2EL9A 4KYIB 4M99A 1CE8A 4D9IA 1IWOA 2PHZA 2YWXA 2L0XA 3IV7A 2P2NA 3VU1A 5JS1A 4TPKA 3ZHXA 2CNOA 3KQPA 3IL2A 1ISGA 1LRKA 4DRYA 4TRNA 2AFVA 1S2OA 2DC1A 2OV3A 3BL6A 3K0HA 3KNZA 3TQQA 3H5NA 1Y4ZA 1MGOA 3BD7A 4IVQA 4B3MB 3VNQA 2VF8A 4H3KB 1BXGB 4G26A 4ALIA 4ZXFA 2HHAA 5UKDA 1XOIA 4EKDA 2BR5A 4AYWA 1D07A 3UWDA 1WPGA 1U0SY 1XXHE 2DWPA 4DC0A 4DJFC 2C9ZA 4U7HA 2QENA 5H82A 1S7GA 4OUKX 3QE2A 1ZH0A 5EI5A 2VYVA 3UJHA 5KX5F 2FWAA 4NCIA 4NYMR 5SV2A 1Z07A 2ECOA 1MORA 2XVXA 3OOJA 4INOA 4F3TA 2J6HA 3FHCB 3FNHA 5JNLA 3F98A 3G2NA 2D7JA 1ZA1A 3A6EA 3DZIA 3O6VA 4FOOA 1HFWA 1XALA 2IYRA 2HDOA 5IDXA 1CY2A 5HK8A 4JX9A 4BNVA 1PLKA 2WSSA 4PR0A 4EY4A 1KF0A 3KZOA 5IT4A 4OMUA 1KQGA 2F55A 3DLIA 3GX1A 4YROA 4O1HA 2Z2YA 4BZQA 1RI3A 4HPJB 4UM9D 1E9DA 5IJXA 5ADUS 2AW5A 4G81A 3UK2A 4F92B 5A3QA 5HQJA 1GFWA 5JPCA 5E9AA 5IZ4A 1GU0A 4Q15A 3GH1A 5C53B 1YH3A 3NUZA 1DDGA 4HTAA 1C9YA 4BQOA 2B6NA 3MBOA 2AS0A 1P1JA 4W1SA 4EO9A 2PH1A 1DZIA 3DV0A 2QIOA 3WGVA 4HLQB 3P52A 2H4FA 3HSKA 3WE7A 3D4PA 3PQFA 4GE0A 2B3DA 3RVPA 4O2RA 2NMVA 4IG4A 3I6YA 4WY5A 4XASA 1RIIA 4PSAA 2WKQA 5GQSA 2QRLA 3VBCA 2WJ4A 1P17A 4DZTA 3SFVA 1N2ZA 2YCBA 4OQEA 1CZLA 2F1OA 3ZXYA 1ZI8A 4ZKDA 4GZLA 3LE8A 3GMSA 4KPYA 1NQAO 4EI7A 6GPBA 1HEYA 2L42A 3K16A 5EE1A 3BBLA 4HG2A 4HS4A 4UNSA 2EWMA 4C7JA 2FJ0A 2ZR8A 3L0DA 4MW9A 3ET4A 3AJ9A 3K71B 4MDFA 1AG9A 3F71A 3EXHA 3EVBA 5K3CA 4BO2A 4ZYWA 3PC7A 3W5HA 3H1EA 3I52A 1KY4A 4REQA 2ENUA 1MOQA 3EXEA 1EVLA 1RRKA 3AT1A 1P1KA 5EXPA 3X1KA 4FINA 2FRVA 5CM9C 4YALA 1FDSA 5ADHA 2IC5A 5K3EA 1A9OA 2MR6A 1IRXA 2GJKA 2ZKIA 2ZWMA 3FB4A 1QNFA 1J00A 3H0EA 3HV2A 4GLBA 4BE7B 1SKBA 4TXLA 2HCFA 2DQYA 2XCUA 4BEWA 2Z83A 1YS4A 1VHJA 4IDPA 5JZMA 1QE3A 4UKDA 3GRVA 3H8SA 4GLJA 3TE7A 4C0SA 2IXAA 3FSRA 1Y6FA 1QH8B 4KNYA 4M7PA 4P7BA 2HEGA 1NVMB 4H27A 5KCZA 3KPUA 3P9QA 4RM3A 1GDDA 4N5HX 4MP8A 5I3ZA 1PR5A 2QT9A 3L9XA 1JFFA 3CRMA 4FLEA 4W5HA 3ACBA 4AXBA 3HYTA 3PNLA 2GHTA 3CRVA 4L51A 1B0ZA 1S7CA 2TMKA 4HY3A 4AN4A 1Y98A 4OPMA 4N49A 3AVYA 1PNVA 1C1XA 2KLHA 3I73A 3SYMA 3IOCA 1EZ1A 5AVUA 5I7HA 2XCTB 2GSDA 3VYSB 1VJRA 3I83A 2OVFA 4C5AA 1K7SN 1PVDA 3CGWA 3R5XA 4G4GA 4MI1A 1JDNA 2O4CA 5DHTA 1MDFA 3B8EA 5FBLB 2XIQA 4ID3A 1Y8QB 1BO6A 4HX5A 2IDJA 5TXGA 3LY5A 4M8SA 5CJPA 3RJTA 2QVYX 4BB0A 1KAGA 4A36A 1F0PA 2YIMA 4I4CA 1PWHA 3GJ4A 3OC6A 4FW8A 4CQMB 3VR6A 1HUQA 1SEPA 4MVJM 1AS3A 1VKRA 4RTLA 1UBCA 3D4BA 3IMCA 1TQ4A 1WXGA 1WZIA 3N5CA 4JXJA 5DNVA 5FI1B 4DIOA 4U2KA 2RGBA 3FTDA 1PEAA 4JJIA 4RMIA 3S40A 1LTQA 5JYCA 1YVUA 2BE7A 1YSCA 4F9GA 1JU3A 4KFUA 2CYBA 4Q19A 4BRSA 1H1DA 3DDOA 4W1QA 1KDRA 2FG5A 4MARA 1X87A 3DVLA 3K0AB 2AI3A 5EJ2A 3T5AA 4L27A 1Z16A 1A88A 2Z58A 2EIXA 2ZTVA 3EZGA 1E1KA 3TEMA 1XTBA 1GLVA 1DOAA 3GA7A 1B1AA 1NRIA 4UVHA 4M86A 2XNHA 3VSDA 4YXWA 4LDNA 1ZBQA 1M1ZA 2VQDA 2XTJA 4LRTB 3TD6A 1EUCA 3VPFA 1Z5PA 2YJ4A 2VI5A 4P35A 3S27A 4A2PA 5I5EA 3CCBA 1ULZA 3QMPA 1DINA 3KELA 3RIEA 5KMGB 2HSWA 5HKLA 4K9NA 3ZEIA 2HU7A 3LXMA 3WYCA 2A7XA 4HEHA 4B6GA 1L9XA 2WNSA 1UAGA 3G68A 1D2CA 3LWDA 3DDCA 4IIUA 2ATXA 3NHFA 5JT1A 1S9DA 4BRWA 3RGWS 3GFQA 3PGMA 5DM4A 1ZFNA 2Q3JA 1GG5A 5KWVA 1HE5A 3RVJA 1CUUA 1Q84A 2FWJA 5ERYA 5D7NA 1PAUA 3TF5A 1ODJA 4G8CA 5CTJA 5FNZA 1KZ7B 4FSDA 1NYRA 5BV7A 4DV4B 2P9EA 4WUTA 4PONA 4EKEA 4DDVA 2X5XA 3NANA 2FPGB 2BVNA 2HA7A 4MKFA 4NP6A 4E5KA 2XDYA 2QTMA 2QAGA 2DPYA 3DE4X 4B5LA 3RIXA 1HQKA 1KVSA 1JNYA 3BE4A 4O4HF 2B2XA 4GGMX 1N8NA 2F67A 2EARA 4I9HA 4ZQHA 5F1KA 1LBIA 1G41A 1Q12A 1WSWA 3DGFC 4L2IB 5E0OA 4GXQA 1ITZA 2ORWA 4B81A 4HQLA 4NRDA 1W1UA 2GVDC 3HNRA 3CVJA 3IUSA 4UBJA 3A1SA 4P3YA 1R5OA 1I7PA 1YONA 2ZRIA 4R6XA 1E96A 2F3TA 1GG8A 3B9QA 1FQJA 1LRLA 1N5KA 1NVFA 1X14A 2E18A 2CMGA 3ODPA 3OIYA 4GYJA 4JMLA 4KP7A 1J0DA 4D99A 1XL0A 1II9A 1PQ4A 2NV6A 3Q2IA 4LGVA 3VHXA 4AROA 5K0SA 1T3LA 5TMBA 1A2KC 4HLUA 4OXXA 1CZNA 3O73A 3WWCA 4DCVA 1YJXA 2E4XA 2HLPA 2FOIA 2FQQA 3O2JA 1K6XA 1POWA 1AY0A 3ONNA 2PUJA 3DNMA 3QEBZ 2EU8A 4WK4B 2GEFA 3SC2B 4DSZA 3FD8A 5F7OA 3G0OA 5FOUA 4AY4A 1TUBA 2FNAA 1QCYA 3SLGA 3E05A 4W5NA 4PC2A 1M8FA 1Y4AE 1DIBA 5JG7A 5A9TA 4PC6A 4DLLA 2IXEA 5JAMA 1KDYA 4JLSA 3TRFA 1W85B 3G23A 4FMBB 1JEOA 5KDDA 5MGNA 4U7JA 2B82A 3OBIA 2XUDA 3IA7A 1W19A 2GCOA 3IXLA 3OFNA 3UENA 4D44A 2X4LA 1D6MA 3MGCA 2OESA 3FTPA 3STYA 2IH5A 4I3GA 1CFJA 2CWWA 1SCKA 5BW5A 1V1RB 4YAUA 5EYPA 1EA5A 5LYJB 1KYXA 1X86B 3NHBA 2DUNA 1SK8A 4K8RB 3T38A 4EMTA 4DIMA 1MT3A 1ZI9A 3AQ4A 1P5HA 3O8NA 2ZWPA 4LY6A 5FL7A 4Z0PA 5J63A 1O8BA 3EC7A 2JD2A 1DRKA 1IOWA 4G0MA 1WTAA 3O8RA 4HDRB 1VKOA 4IAOA 4AM8A 1R0WA 5IRCD 3PHHA 1EEHA 4RH1A 4CM9A 1WMDA 5FNVB 4BLOA 1MNAA 1L4NA 1FP6A 2J9FA 1OXUA 2PCLA 5C31A 4FBLA 2Z3WA 3ANYB 4L22A 4UQOA 1A97A 1U1GA 2R8EA 3A1VA 2J9YB 1HQYE 4Q3NA 1E4EB 1IOVA 4G37A 4J7UA 1BCSB 1VJ1A 2B4YA 2EXXA 3STVA 1OX6A 3VSAA 3CVYA 1EMDA 4OATA 3ESQA 2XNJA 3R3SA 5K0TA 1PP4A 1RZVA 3CH5A 4DIKA 1BFKA 2I9PA 1TA9A 3IDZA 1QYXA 4OB8A 1XEAA 2JAUA 4GEGA 2F59A 2WF5A 2DX7A 4X8OA 2BIFA 2PS1A 1UQUA 2H2DA 2R47A 3FKJA 1M66A 4MS4B 2HO5A 4GBJA 4Q18A 3AFHA 3F5FA 4HKTA 2H4YA 2OORA 2NVBA 2GXSA 1J5XA 3L6BA 1C0LA 3DT8A 3BWBA 3W06A 3CB4A 1PD1A 4UTPA 1Y6GA 1T36A 4YJGA 1RVDA 4C4TA 3R3YA 4FLMA 2R00A 2ZUUA 4CUZA 2IFTA 3C43A 3DUFA 5LYYA 3F5QA 2FVYA 2O3QA 5ERGB 5AOBA 3CY6A 5AKEA 3OD5A 4Y18A 3SZLA 2XCQA 2BEWA 2M9MA 2WMDA 3HMQA 1H3NA 2HT1A 3BBPA 3QY9A 4ETWA 2IZOA 4DSAA 4HRYA 3DOEA 3IOMA 1JPUA 3IO5A 4FEAA 1QHGA 4V0SA 5H59A 1X38A 2AV6A 1R0RE 4JIGA 1DKRA 2F1IA 4NATA 5D6NA 3V5NA 2WTMA 3NHAA 1I6LA 1E5VA 1J1UA 4X71A 3WQBA 2W71A 4YYEA 2ZSBA 2IELA 2BELA 2IU0A 4RMNA 3JXEA 2OMKA 4LI3X 2IY8A 2D0OB 3OKAA 5B1DA 2QTTA 3FFWA 4TLAA 3RC7A 2V0GA 1NE7A 1QH9A 5FBRB 4BWYA 3FLBA 4BKMA 4Z49A 2XNDA 3K6JA 3OFJA 1X1SA 1ZXBA 4ARZB 4Z1MD 4OYYA 5DRTA 1HR0B 4GOXA 1RHKA 3VU0A 3LPAA 4RTKA 2HZBA 2ONYA 2OHIA 2OM2A 5BMOA 3L0PA 2BF7A 3RYCB 4CTKA 1LJUA 5HW0A 2AZTA 3BFJA 3E4DA 5FADA 2DLCX 2FUG6 3SSMA 1QFSA 1EP2B 1JBEA 1UBMS 4YI3A 3PE6A 4CL8A 3SEQA 2DBYA 4OK6A 1GQQA 4DLTA 2OPHA 5G2OA 5HQ3A 3JQBC 1Z0IA 3QU7A 4W6QA 3W4JA 3NC1C 2WAXA 5AI5A 4GQIA 1S96A 2BSXA 2YXNA 4FMPA 4K6OA 5G1PA 1R9JA 1ZCJA 3THXB 3SYRA 2JLCA 3O4RA 3HBFA 4FVTA 4FDAA 3ZG6A 1NXOA 3HJNA 4G9EA 3OMLA 1WY7A 1ZGGA 2EP5A 2I0FA 3QPBA 3RVSA 4WK0B 3TSOA 3T3OA 4ED9A 1Q22A 2G88A 2P9JA 3NDJA 4R9SA 3SJ7A 5A5VA 4WOPA 3AOEC 1E2QA 1ORHA 2G04A 4HAYA 2PMFA 4QUDA 1N6IA 1ONBA 4BIIA 4YAIA 3W5BA 1T8UA 2HIMA 4HN4B 4MR7B 2NZXA 3RG8A 5KJ6A 1K7EB 4NE9A 3NDBB 2PUTA 4TL8A 2FLKA 1Q0UA 3GAAA 2YXPX 3ZCVA 4IF4A 2QJRA 1C0KA 4WTOA 1AIPA 3V1TC 2HPVA 1BN6A 3PCXA 3VJMA 1SUSA 1TCCA 1XZDA 2C7BA 2EWWA 1FQWA 2HWWA 2Y93A 5KOIA 2HJSA 3DZKA 5JJKA 2GCIA 1UK9A 3QEMB 4YAJA 1LLCA 1KK3A 2PJZA 2HMWA 1B8NA 2HFKA 3M5WA 3R3HA 4U63A 4XVQA 5ILQA 3EDMA 4XWWA 5CYFA 1L5YA 2LTAA 4HGYA 3JQGB 4IILA 5ALFA 2OCKA 421PA 5ESDA 1Z4LA 2Q1YA 2BONA 2CHQA 2ORVA 2VH2A 3NOOA 2HB6A 2QD4A 4WZBA 1QP4A 4C2TA 3UMYA 2AI1A 5IJWA 2WF7A 3IEVA 3Q40A 1YJQA 1P81A 1SKAA 4CIVA 5EUMA 1YFZA 2QN8A 4Q03A 3FBGA 1E3LA 5H80A 5LXTB 2PD4A 4DB2A 5ITWA 1TQ6A 2OOSA 2R6DA 2AD5A 2OKCA 4WVFA 4W9NA 4ZAZA 1SPXA 1SQ0A 1VLZA 5DBGA 4C88A 1FK8A 2GJSA 3T15A 4V0ME 3QE9Y 2CDNA 4IY1A 4NIMA 3H6KA 4QUGA 3RT7A 5A2QA 3U3MA 3GXBA 5D3MB 3ZXXA 5HP4A 3JATA 1ODIA 3VZBA 4EVIA 3FXAA 3L5KA 3NAQA 4GX2A 3B6ZA 2WYWA 3ID6C 1J39A 2XT9A 2UZ1B 1MU0A 3C6YA 2VSNA 4WMLA 2NACA 2HDHA 4UXJA 5DNYB 4B5KA 3SC6A 3W1WA 1BJKA 1V9LA 2GTPA 2Q3CA 1J42A 4PCVA 3ORHA 1PDVA 3GOHA 5KYGA 3IKVA 2PXAA 1VE9A 1A3CA 1C50A 3T4XA 2DQ4A 1E89A 2P7HA 3KTAB 3Q7RA 1E1NA 2IIQA 2KS6A 1E20A 4FX5A 1QVWA 2H00A 2KW5A 2OHOA 3RU3A 2YWHA 3GVPA 4UFPA 2Q8NA 2E6KA 4MXDA 2HK7A 3UGKA 1JR6A 2EZ4A 4I3FA 3PFBA 2B34A 3AKCA 1EVZA 2CFCA 2NZJA 2YWCA 2ZRDA 4KQ6A 4WXRA 1TK9A 4GNRA 5J5CA 4B48A 2PYDA 2LCQA 1IHYA 1N6NA 1EE1A 1U0OC 4E5UA 5LQRA 4PWZA 5B53A 1K8QA 2B5WA 2ZJ1A 3SXJA 3EMBA 3BSYA 4P4SB 1GN9A 1VGRA 2QVLA 4Q9NA 4BGDA 1QTQA 3GCDA 3VV3A 1UIMA 1V7CA 3S8EA 2N47A 1UJ6A 1Q3TA 3WGJA 2G63A 3Q9UA 1OKKA 2BDUA 3Q0IA 2D2FA 1U4OA 3MGAA 4KN6A 3F78A 5DEOA 3V8VA 3WMXA 2D8AA 1BW9A 2O2XA 4EYGA 4F3RA 3TUZC 3KP1A 3MWJA 1TCAA 4ZAGA 4JT4A 1OYYA 4QYWA 1U28A 3IQFA 2B30A 3DE1X 3MOGA 4M0DA 3ZHQA 1OTYA 2XUPA 3DZCA 1N4AA 2O5EA 5U4QA 3HUTA 4MCJA 4NARA 2AFIB 1V16A 1WHTB 4XSHA 5DH9A 4MWDA 4V1CI 4GZ3A 2JKYA 4CIAA 1G63A 3AFIA 4JL6A 3BGWA 3ICVA 4U2FA 3IVRA 3TX2A 3WK7A 2YV4A 3G9ZA 4WI1A 5IAOA 1JG6A 3SDSA 5EJ8A 4B1FA 4U2DA 2KLBA 2Q6OA 3C3XA 5DZSA 5EZYB 1FTYA 4KOEC 1F2TA 1BFDA 4KMMA 1RKQA 2QGZA 3DE7X 3WJAA 3AG6A 2HWKA 2VT3A 3WWOA 4YPVA 5JQGB 2ZTMA 2ACEA 1U9JA 4X66B 1J8FA 4BMNA 4H17A 1E2HA 2CUNA 5KNCH 3ZLJA 2AG1A 3CBQA 1SVIA 3HM2A 2QW8A 4BGIA 3LAWA 1XZCA 2WVJA 4LK2A 3WBBA 1M1YB 1UBHS 4PQYA 2ILVA 2BDEA 4RA6B 3DBOB 4EIWA 4N0PA 2Y9PB 3I30X 1CS4C 1DZ3A 4JA0A 2OG2A 5GWXA 4DT1B 4EG4A 7ADHA 3B2NA 2GAJA 1YDWA 4HH4A 3WJ7A 3ZWYA 4M1SA 5HOEA 5BV8A 5HIKA 2P2CA 3C8DA 3RG2A 1FPQA 1UDWA 3GDHA 2WTNA 3KFXA 4O0LA 1FC0A 4XQ0A 3TCKA 1WIWA 1F3OA 5JI2E 1P2GA 2PSEA 1BEUB 4EHHA 3VC2A 3TW0A 2P30A 4PPQA 4PM4A 2O5CA 5BVGA 1CY0A 2QQ5A 3A7EA 3HWX1 3K1JA 5C0OE 3WIBA 3F9IA 1ZK1A 1JKFA 5IJ9B 5ITZA 5JFGA 4OCZA 2ISSD 1Z7BA 4NX2A 1NR1A 3F5SA 2H4XA 3MJTA 4OMCA 3VOBA 4M9CA 5DB4A 4A73A 5B1YA 1TNDA 3EBLA 3QOXA 4PFQA 2QP3A 3BWMA 2X1HA 1DPGA 2R85A 3JCZA 4Q9DA 1UOPA 2BTQB 1CZHA 1RYMA 1Y3CE 2FZWA 3GLHB 3LZ6A 4GMDA 1DTWA 2G4VA 3QK7A 2V6GA 4UUNA 2G72A 4GPEA 1LK0A 3OP1A 3BERA 1E2IA 2ZE8A 2BFMA 1QYCA 4J6EA 3HXKA 1MABA 1E3TA 1Q7CA 2XMPA 5KAPA