3G5XA

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHSSQDINSNIGWLQQKPGKSFKGLIYHGTNLDDEVPSRFSGSGSGADYSLTISSLESEDFADYYCVQYAQFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 806 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xA01
3V6OE 1V3JA 3ARED 4XH2A 1PKQB 1F4WH 1TQBB 1HHJA 1ODAA 4JB9H 2HFFA 1YN7B 3MV7D 4HWBL 4V1DA 4RQQB 4MNQA 1B0WA 1Q0YL 4L1DA 4XNXL 2VTFA 2HFEB 4XC3L 1F3JA 1YEIL 3GI9H 5GIRB 1RZIA 1EGJL 1GGCL 3WL9B 1EFXA 5F70A 5T3XL 1B4JL 3B2UC 4OLYH 2OL3A 4FZEH 1FCGA 1QBAA 4FP8H 5DJ2A 4NO5A 1I4FA 5FCUH 2AJXH 1ZT1A 4GG6B 1QLRA 1XIWB 5KS9F 1HHGB 4GRLD 4CVXA 5CEZL 2YUVA 2Z31C 5TFSH 2KH2B 4G9DB 2ZSVA 2CPCA 3H8NA 1UYWH 2ADJA 5CP7B 2FGZA 4X6FA 1KCVH 5C09D 1IQDA 3KHQA 3H6JA 3TH4T 3LV3B 5I73C 1MAKA 1IGIH 3MBED 3PHOA 3K2UL 3MMEA 3NABL 2RAMA 4MMZC 12E8L 4F3FB 4NKIH 1FZKA 3GSRA 3CH1B 3U82B 2J2ZA 4KQ3H 1UM5H 2NY5C 1IAIL 2HJLB 3LEVL 3GMQA 2JK5B 4NZUL 3WJJC 5GZNC 4DKEL 1YEJH 5KANG 4KMLB 4QRRA 4ZPVB 2AJUH 3TCLB 4X9FA 4HK3N 2ICWI 5JOEA 4XHJD 5JIPA 2FZ3B 3C5JB 4I0KA 2PTUA 2XZAH 1H15B 1IAOA 4RFNC 3RWFB 5BVJB 2J12B 4HWZA 1MCPL 3B6SA 4MQSB 5FXCH 3KNBA 4H20L 2LTQC 5IJVA 3FCTA 2ZOLB 4PLOB 4ZDHA 3TVMB 3T0VA 1FYTD 1EHLL 3IFPB 5EN2B 2XZQL 2V5MA 2ED8A 4LPUA 5HI5D 3U7AA 4JO1H 2OLDA 2DOCA 1C7TA 3DWTA 5FK9A 4BQ6A 4FRWA 2ZPKH 5DJ6A 2AERT 3BQUA 3LS5L 3P4MA 3SO3B 4PJ9A 4OZHB 3AVEA 2NXZC 2BY1A 3DTXB 5AEAA 1PZ5B 4U0RB 5LGHH 4HUXA 2P5WB 5I15H 3AM8A 1TCRA 2O5YL 1CXHA 1YMHA 1ZVSB 2AJVH 2JB5L 1HILA 5B38G 1OGTA 4XNMB 4PJHE 2YA1A 5ITFB 1KTLB 1QKZH 2DLTA 4WNQA 3MRNA 3V6ZA 4DEPC 2P8PB 1F4XL 3VXNB 2VSDA 2VE6A 3BEWB 4R2GB 3EO9L 5I30H 1ADQA 4MNGB 3AUVA 3DVNB 1X5AA 3MGOA 4M1GL 4XP9L 5J8OA 4HV8B 1PG7W 4TNWK 1BFVL 2NY6C 4MA1B 4NO0B 3MJ8B 4PJXE 2BCKB 4D0CA 4WO4A 3P9LA 2VUYA 4YX2H 3S36X 1ORQB 1C12A 3KLHC 5EORL 3GSUB 3O6FD 2J8HA 3PUCA 1XGUB 4TTDD 5D8JL 5BVPL 4RISL 2AQ3A 3HS0A 3RVWD 3MXVL 1MFNA 4P23D 5DDHB 3EJYD 3TJHC 4BUHA 3WD5H 2IPUK 3ZE0E 3S8WA 3C5ZD 1BD2B 1CFSB 5EZOL 1JIBA 5IB1A 1F6LL 3T0AA 2NYYD 2NY1D 3VJ6A 4WVRA 2R69H 3MCLH 1LO0L 3MNVA 5C71A 3BP6A 3U46A 4X7CC 4LF3B 1DQJB 1LEGB 2IBZX 1KN4L 3V5HB 2XWBB 4X4XA 4LASL 5E7BA 5ENWA 4GW5B 4TRPH 5GQBA 1KJ2B 3OZ9H 3UTZB 4Y5VC 4Z7WE 5E5MA 3D39B 4X6CF 5CD3B 3LDBB 4DZBB 4EDXA 3WFHB 1AGFA 1NFDF 2YRZA 1T0PB 4XPTH 2WWMD 4Y5YB 4OLWL 5BCAA 4I9WE 1KC5L 1F90L 3GSWA 3MRIB 3B2VH 4OD1L 2QSCH 3IDGB 4FQJH 2PTVA 3QDGE 2CRYA 4C56A 4G8FA 1U8IA 3HAEH 1MJ7H 1G0DA 2AK1H 5F1IB 2P47B 1NH6A 5AZ2L 4R96B 3MCG1 1RHHB 1FFPA 1OWWA 5T3ZL 2MHAA 3QRGH 4HMCA 4P0DA 2DQHL 5TQ2L 2GY5A 1ZGLM 5TE4H 2AV1A 2RB8A 5KSUB 3RGVC 3WUWG 2A9NL 2DYPA 3MJ9L 3QZWG 3C5SB 3RIFF 1JZ5A 2ITDA 3MLWL 3O8XC 3O0RL 1BZ9B 2OZ4H 3VFMA 1MJJA 4G42A 5JR1L 2XOTA 3OKNB 4YZFF 5KS9E 2CMRH 3IF1A 2MWCA 3V4VL 1YDPB 1P2CB 3NFNB 2YA2A 1G6RB 4NFBA 3IDXH 1XH3B 4PLKC 5CJQH 4U1HB 1I8KA 3B9VA 4WUUA 5D7LB 1IZJA 1UXWB 3QWRD 3QNZB 4HX1B 4HAGA 4NT6A 1J8KA 2DWEB 2E6JA 4EZMA 1R3IH 3T2NH 4KROB 1P4IH 5MERB 3J8F7 5EULV 1G0XA 5F7UA 5H35A 2GAZB 2Q7NA 1LP9A 3KXFA 3QCVL 1IVLA 2RCSH 3U0WL 1E6OL 3MLYH 1C5DB 1A4KB 3D18B 2V17H 4XXCC 1WT5C 4LRNL 4HJ0C 2X4NB 3FAXA 4NQDE 3ZKMC 1AXSA 1BAFL 3GHBH 2C4FT 3O45B 4M5YL 4I3RL 1KJ2L 5CSZA 1U8HA 5J6GB 3MRLB 1JNNL 5FO9B 4G80A 4O2EB 3VRIA 5IFHH 2I9LB 1F3DJ 4PD4J 5F9DC 3VFTB 3WE6A 5MHSD 1QRNB 3MV8A 4I18B 4QYOB 4H5SA 5C0CB 2ZWLT 1N59A 4HCRH 5D5MB 2CGRH 4UU9A 5FV2A 2CUIA 5LJYH 3G6AB 2HJKB 2XNAB 2FLRT 1N26A 3EJJX 2DQIH 4FXGA 4OB5L 4Y4FA 2BP3A 4POZD 1NMCC 5DHYB 5BMFH 1AO7B 1N0XH 3G04B 3JVGA 1A0QL 4AEEA 1LO4L 1UQSA 1XR8A 2XG5A 4Q6YA 3FN0H 3QO0A 4RAVB 4YDVA 1DQQA 1LILA 3W81A 3KLAA 2CXGA 4R4ND 1ZS8A 1MHPL 5TE7H 3QEHA 4PV8A 2K3TA 5CUSL 2VDNL 4XWOD 4HGKC 3QBTB 3V5KA 4MJ6A 4IRSC 1R0AL 5DJZA 1XR9B 2NXYB 4RFOH 3MRKB 1GZQA 3BZ4B 1G6RL 4FS0A 4PG2A 5K59F 2DRUA 4S1QL 3PGCB 3CVHH 4DGYL 1JWMB 2FX7L 2PCPB 3LEXA 2IPTH 4PP1D 4FQPA 2IWGA 3TWCL 4LLMA 4XGZA 2JJTC 4P5TB 5DYOB 1RMFL 3UBXA 2FD6H 5EBWB 3V0VA 2IAMD 1QRKA 4JKKA 5DRZB 1IC5L 1CZ8L 1IKNA 4M9PA 5BOPA 3QXDB 1JZ3A 2WIIA 4ZTPL 5JUEL 1UM4L 1ZWIB 4XRCB 5E6IA 5MEPB 5JZ7C 3VCLB 3PXHA 2APXA 1EH9A 1OAUH 2KZ1B 2ILLA 2GTWB 2GUOA 3PGDA 3DMMC 1R24A 1A7BA 2BVEA 5F8RC 3MRGA 1RUKH 3VXUD 2B0SH 1J9CT 3QG6A 1AFVL 2C4FU 4XNQA 1RUAH 5D7SH 3CDGB 4AIZB 1U6AL 2GJ6D 5FDWB 2HFGH 1IEAB 4Y2DA 5F6IC 4H1LB 1JV5A 4OKVA 3PV6A 3S3JA 1T21B 2D7TH 2XN9E 4OFIA 4WRLA 2VB5A 1RULH 2BNQD 2VLKA 1NDMB 2EDYA 5IHZA 2CXKA 2H9GA 1AKJD 1UWEL 1TIUA 4F9LA 1DEEA 1QD0A 3SDXA 5EOTA 3L3DB 4X6CE 5HHOD 3TO4C 1NKOA 4OGXL 2VERN 1NFDE 1XF3B 4OCYH 4I4WB 3FRUB 3RZCD 4XHQA 3D2UD 3V4PH 4WI6A 3DLQR 3UTSE 4HIEA 5F88A 5JA9A 1K3ZA 1D7FA 2FYYA 3WS6C 1I75A 6CGTA 2NY4B 5A1AA 5I9QB 3VFSB 4Q9BA 4HC1L 1JUFA 3RWIA 3WSQL 4P2QE 1LK2A 1BEYL 1BGXL 4YXKL 3RI5K 3QIUD 4MLIA 4N0CD 2EC8A 4O02L 1DBJL 3QQNA 3DSFL 5F8QC 4UDUA 2ESVA 2AQ2A 3KYNA 1N4XH 3IFLH 1KTRL 3UPRB 2EE6A 3QDJB 2NY3D 3JWDL 4OBSA 4ZNEE 3CFEA 1CK0L 1FGNH 4F8TA 1EO5A 1UKQA 1IBGH 2BXYA 2R1XA 5EU6B 2XQYG 3NCYS 5IQ7H 2CRZA 1CR9L 2YSSA 2P7TB 3RIAF 2IANB 1YEKL 2LABA 5M95B 4WY7L 3O81A 1BQLL 4WHYG 4I3GA 4EQ2A 5EO1B 1ZTXH 5E6YA 3C60A 4HPOL 2ZOKB 1ZEAH 4HG4K 3LVEA 3OKKA 1R5WB 4CGTA 4G6MH 2NW2A 4FFVC 1U8QB 1YEFL 1UB5A 4NBZB 4KRPD 3V6OC 4LARL 4TULL 4Y1AB 5KBNC 4CU6A 3TNNB 4KTDH 2BVPB 2DLFH 2VUOA 2R2EB 4EUPG 4XPAH 3W0WE 3DV4A 1F4WL 4JB9L 3MR9B 4MQ7A 3QUZA 4XC1H 5JMOC 3QFJD 2P24A 5A3IC 2AVGA 3BHBA 4IMLA 5F96H 4LL9A 3GI9L 3QNXA 1SJVA 1W0VB 4MNHA 4I2XE 1IT9H 1AC0A 1Y18B 3HPJA 5DZNA 3U9PH 2OR8A 4OLYL 3VXOA 3U36B 4FZEL 4NC1E 5EUKA 5TDNA 1N6QH 4FP8L 4YK4C 5FCUL 3I3DA 4OLVH 2AJXL 3KPQA 5IHBA 5E9DA 1CLYH 3AB0C 2APFA 3CLEH 2WSKA 5TFSL 3FOMB 3LKNA 5C0GA 1XGRB 1QR4A 4TUJA 3R06B 2BOBB 5FECB 2FO4A 3NAAL 4M02A 1HEZB 3MRRB 1UYWL 1U8PB 1A6ZB 1KCVL 3HC0A 3NFSH 2CLRA 4FNLH 2FL5A 3G5YA 1IGIL 3WHE0 2IADA 5JW3H 5I1JH 3FRPA 4NKIL 5BJTB 1WWAX 5K59E 1UM5L 1JYVA 1U95A 5DFVD 4NKDB 4UNTA 1YEJL 3KJ4B 4J3WA 2AJUL 3P0YH 4R7NA 2W0FA 5ICXB 5F7HA 4DKFH 5L2KB 3IDNA 2XQBH 5IG7A 4K3EH 4UT7H 3VWJC 2AXGA 5J11B 2WLYA 2WBJD 5FOBA 4KJWD 2XZAL 2JTDA 3QT2A 5F21B 1N7ML 5ABDE 3RJDA 3U0TA 4P57B 5HDBF 2VOTA 4RGND 1G7HB 4JDZA 4PRPE 2UUDK 2Y7QA 2WINB 4RNRA 4YWGH 2VXTH 2R1WB 3BD3A 4N8CH 5GGTA 4QRSB 1JNHA 4EN3D 2GCYB 4TPRH 2NZ9D 4P2YA 4JO1L 2CH8A 4R7DA 3D25A 3U4BH 3N0PB 2LV4A 2ZPKL 1T7YA 2YBRA 3C6SA 1KELH 4LKXB 1RK1A 4XVJH 4LCCB 4KJPC 2YC1A 5FAAA 4KI5D 3LQMA 5LGHL 3EYVB 5I15L 4NNYA 1I8LA 2AJVL 2ORBH 5HGDB 3VWKB 3PHQA 4E41A 3HAEB 1QKZL 3VXRD 4AL8H 5MENB 3RVTC 4KK9D 1V5JA 1YZZA 5J3HD 3RWDA 3RPKA 2X1PA 3QI9B 1CBVH 3NCJH 1CFVH 4HZLB 3HE6A 4P48A 3RX8A 3SKNA 1MLBB 3WEXB 1UM6H 3CFBA 3F65A 4CMHC 4YX2L 2FNBA 4RBPH 3ZT6A 3AMLA 1KPRB 2ZCKH 1RUMH 1D5BB 3O3AA 5CD5C 4OCLC 5KANI 3G08A 4M6AA 2OCFD 1XGPA 2AEIT 4R4BA 3FN3A 1SEBB 5GRVK 1U92A 3WD5L 3NMEA 4WTZG 3BP5A 3G9AB 4W68A 5CHNB 5I8EA 4HKJA 4XP1H 1U3HD 3EO1A 3FHAA 3GMRA 2X9XA 5GS1B 3BZDA 5IESH 2R69L 3MCLL 3TBWA 1MWAH 5IMKA 1O0VA 4K07A 1FZJA 4CW1B 4RGMC 1OGAD 5CGMA 1WFTA 3QEQB 3IDYC 3BIKA 2NY0C 2CLVB 3U2SB 3P0GB 1T0NA 1E4KC 4BKLA 4TRPL 1PVHA 3OZ9L 1QFOA 3SDDA 4P46A 1LWRA 1PDKA 3BXNB 3BWUC 3K8MA 2F5AH 4L9DA 4XPTL 4OZIF 1B0RA 2Q87A 3VDCA 3PABA 3B2VL 1MCIA 3WYRA 4M6NH 2QSCL 3GRWH 3HRPA 3K81A 2HVJA 4FQJL 4LLWA 4R0LA 4I5BA 4PRHE 1MJ7L 3HR6A 1CU4H 1A9EA 2AK1L 4M7ZB 4K9EC 1MVUA 2NMSA 1EHNA 2DI7A 4L4VD 5LWYH 3QRGL 4I0PA 5I2IA 4PREA 4WDIB 3RWJA 5IFJA 5TE4L 1EO8H 1R3JB 3SDAC 1ZT4B 2F5BH 4ONOA 1WCBB 4U1NB 5C9JA 3GK8H 4LP4A 4QHMB 5F7MC 5T1LA 4LLUB 1JBJA 1KT2B 3FTGB 4LSUL 1M05B 1QSEA 2ADIA 4KMQA 4NYLA 4XI5C 4GBXC 2OZ4L 4AENA 5GSRA 4FQXD 1T5WB 2CMRL 4LVNC 1U8OA 1INEH 2C3VA 1KXQE 1ZHLB 3IDXL 3JV0A 1GXEA 5CJQL 5FF6B 1OTUD 3MRFA 5F7LB 4ZOBA 3CVHB 1CDUA 1J0YA 2H32A 3C9NA 4NUJB 5D1QB 3BEVA 2N56A 3BVNA 4V1DD 1DVFC 2EDWA 3RGVA 5DMKB 4MNQD 1R3IL 3T2NL 4NN7B 2BHYA 1P4IL 3OKMA 3UTTE 2FGWH 2EC9T 4JLRB 1MFCH 1KG0B 3DECA 3FL7A 3DURB 4R9HA 2RCSL 1EFXD 4JZJB 3W39B 4PJFA 3MLYL 4JQVC 2H6PA 3D3VE 2FECI 3QXAA 4ZFGH 2FEEL 2V17L 2ZUQB 2PR4H 3NCBB 4YFEA 1E4WH 5CEZD 3ARGB 3HZKB 4D0BB 1UH3A 3GHBL 5SWQB 5LCVH 4ZXBA 4MDJB 4WU5B 1J0KA 1A1OA 3BN9D 4HEPG 2M2DA 5DUBB 1NGYA 4ISVB 4UOW1 1IGTB 1I1YA 5IFHL 3RVVC 3TZVA 3LQAC 5H8DA 3LKRB 4AMKH 1M7IA 1HOCB 1AGBA 1DBBH 5IJKC 5JO5A 4HUVB 2AK4E 5HDBE 2CGRL 4S2SA 5DTFB 1BVKB 1EUTA 4YHPB 1A7PH 1YNLH 4ORGA 1VENA 2A77H 5IVXF 2DQIL 3FT3B 1UB6A 4L3AA 2FH6A 5BMFL 4Q74A 1QTYT 3L3IB 4GG8A 4TNWF 4F33B 5IB4A 1K2DB 3SKOA 1DLHA 3FN0L 3VGGA 1TNMA 3RWGA 4QRRD 3H3KA 1MCKA 5EC2A 1AQDB 1TTUA 5TE7L 2DMKA 3QQ9D 4OFPA 3PWPE 5I8CB 4PJCF 5CJXC 5DMYA 1TMCB 4RFOL 4B0MM 1S9XB 3JWOH 4YHLH 3DBXB 1FFNA 1YN6B 1RJYB 3MFFB 1BX2B 5DHVH 5L88H 3CVHL 2IPTL 1VESA 5ID1B 2Q20A 2BDNH 2FBJL 1P4BL 3B9KB 2FD6L 1PBYA 4M00A 1VKXB 3MLSH 1PQZA 5CGTA 1E4XI 3BQUD 4XZUA 2XG4A 2ICWJ 3IS0X 4NO2B 4PJ9D 4IRSA 4FQQA 4QHUA 2OP4H 4F2MA 3GMMB 4LPYA 4M4RA 5KSBF 4MZ2A 3TPUB 4ETQA 3BE1L 1IC1A 3NIFF 1FJ1B 3QIBB 5JHDA 4GMSL 1OAUL 2EC9U 4QOKE 4YBQC 1F3DH 3FB8A 5EUOF 2V9RA 1EHAA 4QHKI 3OJMB 2I60H 3OB8A 1RUKL 2B0SL 4HUUA 3V0AC 3T65A 4OSUH 1RZFH 5HPMA 1ZAGA 1RUAL 4NHCH 2GJZA 5D7SL 1HN1A 5C0BE 3IDMB 3DETC 2DKUA 2HFGL 4JE4B 4JFDE 1K4DB 1SJHB 2D7TL 4PJ7B 4WO4D 1RULL 4JM2B 1BBJA 4EIGB 4HWUA 2IPKB 3CFDA 3MRBB 5KJRH 2W0LA 3CX5K 3NZHH 4OCYL 1HWHB 3NGBB 3V4PL 2JIXB 4OZIE 1MVFA 3T8XA 4NQXB 3QDMD 1OB1B 1FFOA 4Z5RA 5KSAC 1RSFA 3FO2B 3EDEA 4M6MH 4ODXA 3UYRH 4JPIA 4XBPA 2KPNA 1FYHB 4WW2C 4JZOB 1MCRA 2KQMA 3TVMD 4YHYB 3CXHK 2FATH 1NLDH 1H3GA 2CDGB 5KN5B 5BRZB 2XZZA 1BBDH 2BY3A 4NQCA 4CDGC 3CDYA 3BX7C 2YPVH 4JY4A 4GKNB 4ZYKA 3IFLL 1UWXK 1FGNL 1IBGL 1P1ZA 4PV9B 4GS7C 4AEIL 1RZJC 3MRQA 4BFIA 5JPMA 5IQ7L 2NX5B 4OFYA 4Z7VF 5DEFB 4G8GE 4PRIB 5DQ9B 4C56D 3BPLB 4PJBF 2CDEB 2Q86A 1ZTXL 4JFOB 3U6RB 1IAII 3T0EE 1F3RB 1H8SA 3OAYH 4V2CB 1ZEAL 4M93C 3AGVA 1SYSB 1D5MA 2DICA 1G1CA 3QFDB 1M7DA 5IF0A 3Q5YA 5K9JH 1IE5A 3EYQC 1QLEH 2DYPD 4M7LH 5FM4A 4H0HB 4OFVA 4LSVH 4KTDL 2DLFL 2YD8A 3IXAA 3Q6FA 3Q0HA 4XPAL 3MA7A 1OT1A 4Y5XC 1QP1A 4FZ8H 1Z9OA 4NSKA 3MZGB 4XC1L 3DROB 1LEIA 5HGAA 4O58H 4Y4KC 1UKSA 1A4JB 2GK0A 4ZAKC 3QUYB 5F96L 3IDJB 5I17B 3OXRB 3DV6A 4LSRH 3MRPA 3QHFH 3BT2H 1J11A 3O2DH 3HMXA 4Z18A 1IT9L 5IEKA 4JFPA 3V6OA 2NPLX 4YNYB 1GGTA 4Y16C 1ONQB 2R8SH 1D9KA 4YDIH 1N6QL 4HKXB 8FABA 4OLVL 3KXFD 4LCYA 4XCNB 5DJ2B 5F89A 4OT1H 1CLYL 1XGTB 2G5BB 4H8WH 4P5KB 3CLEL 5IVXE 4ZFZB 1I4FB 3LRHA 4L8SB 1KIPB 1PFCA 1ZT1B 2MOVA 3HAEG 2GW5A 4CVXB 1T89C 2XWTB 1S78D 3D39D 4K94H 5HTSA 3GSXB 3HR5B 5D6DC 4BH8A 4KZDL 2HLFD 3MUY1 4PJDB 1BWMA 4U1KB 4KKAD 3NFSL 3Q1SH 4FNLL 5E8PB 2AXJA 2F19H 4JG0H 3WIIH 5ACMA 3IJYA 4CN1A 1CT8A 3FT4B 3EOTH 2KDGA 5H94A 4HS8H 3V0WH 3IAGC 4PJCE 3MV8D 5JW3L 3F8UB 5I1JL 4QRPB 1U36A 1ZLUH 3INUH 4HZAA 1JGEA 1NL0H 3QEUB 4G9FB 4HFWB 5FYLH 3HB3C 4Y4FD 1X5JA 3U7WL 3P0YL 1U8JB 4DKFL 4HUNB 2XQBL 5A16A 4K3EL 3IU3A 4D0DA 5C0AE 4XTRC 2EECA 1MWAB 1U8NB 4IMKA 4S1DD 3QAZC 2O93L 1WLHA 5D7KD 5KSBE 3NIFE 2VQUA 1T1YA 4YWGL 4MCYB 4N8CL 2DLEA 5D7JC 4B7LA 2JJSA 2MKWA 5IJVB 4HS3A 5EUOE 3X12A 4C83B 4TPRL 3RKDD 2EKSA 3T77B 1FYTE 2BVYA 3C09C 5M7QA 1F2XK 4YDJB 3I3BA 2NW3A 3U4BL 3WO3B 2NTFB 5LGKA 1KELL 5F7EH 3L9RA 4MJIA 4XVJL 3ARDA 3HUJB 4MAYA 3SDCC 5BQ7B 3FQTA 4P2OA 7CGTA 5EDXA 3ZYJA 1YYLH 2ORBL 3RI5F 4HIHA 5TDOA 4QTIL 3P73A 4Z6AT 2XIDA 3H7BA 4JFFE 5E6ID 4AL8L 5IWLC 1OGTB 2YS4A 4LDOB 4K8RC 1GGUA 1JI2A 1ZLWH 5TQ0L 2KQNA 4M5ZH 2PN5A 4N5ED 2D4DA 5ISZE 2MQ0A 4UMGA 1CBVL 3QUXC 3NCJL 1JYWA 4KRNA 1CFVL 2BC4B 4J1UA 3SCMC 4PJHA 5FO8B 1UM6L 3PL6A 3QJHB 2APBA 4QRQA 1BWWA 1YECL 4G6FD 2ZCKL 4D0CB 1RUML 1R5VA 4W6XB 4Y2DD 2VXQH 2MPAH 1MIMH 2VLKD 1YMMB 3IXTA 1BOGB 4HFUH 1OOAA 1GAFH 5IKCB 2FIKB 3OGCA 3KPSB 4PJXA 1I1AB 1ZA6B 4MS8C 4XP1L 3IFOB 5EU3A 1R3HA 4WWKB 1MAJA 3EOYG 5IESL 1YEHL 2IGFH 4QRTB 4AH2B 4N0UB 1MWAL 2FSEA 2XY2A 4Z7VE 3R0MA 1OP5H 5E99H 3WS3A 4DK3A 3HG1D 3ESVF 5IBUB 1Z3GH 4PJBE 1OVZA 2WW8A 3K1KC 3P40A 3RWEB 3TT1H 1MHCA 2QL1A 4IEFB 4YFDB 3TEUA 4M6OH 4X4XB 5B8CB 5C0DB 4PJEF 1WCQA 1ETZB 1VFOA 1CFQA 4YR6A 3TT3H 2F5AL 1ZT7A 3O4LE 2QQKH 2ESVD 4ELKB 3WKNA 3ROLA 4N0FA 1RY7B 2XA8H 4M6NL 3DIFA 3K8KA 3GRWL 4U1IB 1II4E 2IH3A 4JO3H 4Z7WA 3KYOB 1CU4L 3O4OC 1Q9LA 2VITB 5AAMA 1JPGB 4APQA 4G8IA 4Q2ZA 1WBZA 4RAUB 3UMTA 3A6BH 1NUGA 3G5ZA 1ITBB 2BVTA 4U0QB 2P48B 4I77L 3V8CA 3AU1B 1Q0XH 3C60D 4EIZC 4QXTA 1EO8L 3VG9C 2F5BL 5JPNB 5BS0B 5BW7A 3QDGA 3GK8L 4N9GA 5ESVA 4A6YA 5IHUH 2VAJA 2VZOA 1FLTX 2AXHA 2ITDB 5E56A 4G5ZH 3IAPA 3VXSE 5J06A 1QO3A 3DX7A 3CDFA 2HFTA 4LOUD 4IJ3C 5D9SA 3VFMB 1INEL 4LIQE 3L7EA 4KJQD 1DL7H 3RVXD 1OTTD 5DHVB 3T0BA 2BXZA 3ARPA 3QUZD 4AY0A 3DRQA 3SDAA 5DJ8A 1ES0B 3T2OA 4LVHC 5ITBH 4WUUB 3QHTC 3O6MH 2FGWL 4BQBA 1MFCL 5DF0A 5KS9A 4DJMA 2BSSB 1SJXA 3MRDA 1C16B 1A02N 4E0RA 1QLFB 1IGMH 4WHDA 5AUMA 1YEEH 4ZFGL 2OJEB 3DUSA 2PR4L 1E4WL 2V2XB 3CSBA 2DI8A 4P3DA 5E9DD 3L3JB 5LCVL 4YGAB 1JWUA 1IILE 1VGEL 1T66D 1ZA3A 3G9VA 5TH2B 2VAAA 4P59H 5CSZB 4ZNCD 2EDEA 3ARRA 5DD1L 4NOBA 4AMKL 2GTZA 1KIRA 2A6KA 2X42A 3U30B 1DBBL 2YA0A 3FQNB 5MHSE 1N3NA 3WE6B 3RNQA 4NQDA 1X4XA 2B20A 3RBSA 4N0YH 5C08E 1FVEA 2IQ9H 1A7PL 1U9KA 3ARFC 1YNLL 5I1AA 1FNSH 2A77L 4YFLI 3VH8A 3ARXA 1YUHA 2HP4A 3B43A 4NN5C 1S5HA 2ICES 5EG6C 4FXGB 4PGCA 4PJ8C 5D1XA 3W82A 2J8UF 3HCVA 1KN2H 2GSGB 3OKEB 2BNRB 3DUUB 2X4RB 2W9DH 4YBLB 4JFHE 1Y6KR 5SX5H 3MYJB 5D7IB 3ZKXC 1P7QA 1KJMA 4Y1AD 4MZ3A 4PV8B 1AHWB 2X41A 4LPTA 1KYOJ 3ARBD 3JWOL 3TA3A 4YHLL 3AY4A 5AD0A 3OJDB 4Y4HB 5L88L 1IGYA 3V6FA 1A14H 2A83B 1G9MC 1LDSA 4KPHH 2AKRA 2BDNL 4GMTH 1OAZL 3PDOB 5E95B 4B50A 3MLSL 4OF6A 3W9EB 1PG7H 3ABZA 5KVEH 3FQWA 3BIBX 1JN6B 5EB9A 5I1GL 4M8QB 4YQXH 1N2RB 4Q9CA 1CGVA 1VFMA 4NQVB 5A40E 1ZHNB 1QEWA 1OL0A 4QTHA 3X14B 1CFTA 4E41D 3V7MA 4TUOA 5E94B 1JTPA 1VSCA 2I60L 3MBXH 4NZRH 4LSPL 1AP2A 2DKMA 1DQTA 3VXUE 1FSKB 4OSUL 1RZFL 5JW5B 1D6VH 3HE6D 3I9GH 4NHCL 1T4KA 4BZ2H 3NPZB 4QRUA 3SGKC 1L6XA 3MGTB 4X99B 2BNQE 4OKVB 2W9EH 1AXIB 3MUZ1 4KK5C 2AEWA 4HH9A 4PJEE 1X5XA 1LK3H 4YHIB 5KJRL 1PGRB 1OCWH 4CKVX 5AG9A 3NZHL 5ICZA 1C08A 2GFBB 4JFXB 5D1ZC 2XN9A 2I5YL 4DFIA 2F54B 1FNAA 3L3OB 5C07E 5I1KH 4OLZH 4M6ML 1OF2B 4BSWA 3UYRL 2OQJA 4X6CA 2ICEA 1RFDH 5D2NB 4NZDA 5D96B 5E8NB 3KPPA 5CBEA 1NFDA 5DLMH 4FQHA 2FATL 1NLDL 3V8OA 5IROA 1BBDL 4XCYB 3UTSA 5D4QA 5JOFB 3SDDD 2YPVL 4P46D 1MHHB 2EYRA 2ARWA 4PLJC 1T6VN 2VZ3A 2IFGA 1UJ3B 4MA3A 2XFXB 3GJFH 3KYNB 5F1NB 4LRIC 4P2QA 1EVTC 4K3DL 3DO3A 5CGYD 3FO0H 4YDKH 2G5RA 2A0LC 3I84A 1VERA 1TJIH 1KBGH 1S8DB 5DJXA 3VRLF 2YUXA 1LO3H 4ZNEA 4Q58C 1MCSA 4I0PD 5FKPB 1A7RH 4IRJC 1F4HA 4JHBA 5K9JL 5FGCE 3CXDH 1QLEL 4PTUA 2DF3A 4EI6B 5EIVA 4M7LL 5C7XL 3SGJC 5T1LD 3AREC 4LSVL 4NO3B 1QSED 3UXFA 3G6JF 5T33L 4FZ8L 4RGOH 3FZUD 4ZUTB 4O58L 3DV4B 3I75B 3DYMA 3WJLA 5GRUH 5T5FH 2P24B 1DTUA 4LSRL 4L3CA 3QHFL 3BT2L 4KXZH 3O2DL 3MTRA 2LVCA 5GSVB 1FNEB 5E03A 1H5BC 5CJOH 2WIMA 3RPIA 2ED9A 4M4PA 3MNZA 4XWGH 1NJ9A 3W0WA 2R8SL 3HPJB 4YDIL 4U1JB 1B0GA 5F6HI 4MQXD 1MCNA 2P8MA 4K7PY 2HTLD 4GRLC 5EUKB 4OT1L 2VYRE 3KS0J 4H8WL 4ETYA 3FOLA 3QDAA 4LFHD 3VMNA 1DANT 2D31B 4LDLB 4I2XA 1E6JH 3RQ3A 5D93C 4K94L 3TCXA 3HI1B 4ZXBD 3I85A 1U93A 2EYSB 2J8UE 1MH5B 4U49A 3HFMH 1QBMH 3Q1SL 2JB6A 2F19L 4JG0L 1EEZA 3WIIL 3MCKA 3MBEC 3P4NB 3TZVD 5IM7B 2IQAA 5J1AB 4YO0A 3GO1L 3EOTL 2ZNXA 3G5YB 3E6HA 4LBEA 2G2RB 4HS8L 4IHOB 1AGCB 4GOSA 2IADB 4OCSH 1I3VA 3INUL 1KFAL 1B4RA 1LO5A 1HH6B 2Z31B 1G7IA 2PYFA 1NL0L 5FYLL 1XZ0B 2DAVA 3FFCB 3GSVA 4JKMA 3FT2B 5ESAA 4MA8H 1RZKH 5F7YC 3ES6A 4XHJC 5KOMC 1KTDB 1W8NA 3SQOH 4HKBA 3IGAB 2W0FB 5IG7B 5I73B 3F7PC 3P4OA 3HZYA 3KLSA 3FQUA 3TBSA 3L7FA 3F7YB 4RGNE 1Z5LA 4QY8B 3VFNA 3GI8H 2B4CC 5HI5C 2Y7QB 4ODWA 3UPAA 5IBUG 4I0CC 3B4NA 2VIRB 3B9AA 3DNKA 1ITCA 3MRCB 3ULVD 1SVZA 5F7EL 5HYSB 3TESA 3B9EA 5C0IB 2A73B 2YBRB 4YH6A 3ZHLA 3A67H 1YYLL 4RFNB 2V5TA 2DD8H 1CGSL 2O61A 4O4YH 2LTQB 1VFAA 3PJSA 4XP5H 3HZVB 5GS2H 5HYQA 2OTUB 4FFYH 4M5ZL 4IIQA 3ULSA 4U7SA 1UVQB 1KLGB 3RNKB 2EIDA 3TIDB 4FTVB 4X8JA 3BH9B 1SY6A 3CCHA 3AS0A 3KPRB 2NXZB 4N5UA 1QSVA 5I1DB 2VLLA 2C3XA 4WI3A 1PD6A 1T22B 5EC1B 4M8VA 5D2LB 2APWA 3O6FC 1WGOA 4X9IA 2VXQL 3OR7B 2MPAL 3C6LA 3RVWC 1MIML 4GG6F 4DEPB 4HFUL 3EJYC 2X7LB 1GAFL 1VB9A 4PY8I 4GKSB 5J0BA 3VGEA 4D9RE 4AQOA 3C5ZC 3BOVA 5DI8A 3SCMA 2CJUH 1MHEA 5C3LD 1U92B 3SKMB 2NYYC 2NY1C 3BP5B 2IGFL 3TV3H 5J57B 1FCCA 1ZGLB 3GMRB 1FAKT 2NY6B 4HJJH 5I0ZA 3LPGA 5E4EC 5E99L 1OTSD 2D2OA 2QKIB 4KDTC 4IOIB 1Z3GL 2FEEI 5E4IA 2XT1B 1KB5A 4GAJH 4LHQB 3TT1L 2EICA 3VRLE 4R3SB 2VZVA 3QXTA 4M6OL 3SGDH 1KB5L 3H0TA 1VFBA 3TT3L 2I07A 4H88H 4JY6A 2K1MA 3SOBH 2WWMC 5DRWA 3B9KD 1GYAA 4NQCD 4GH7B 2QQKL 5IIEB 5ADOH 2NTSP 1PW3A 3DX9B 2A6IB 3L5JA 4L4TB 2XA8L 4BH7A 5J13C 5J6HA 4JO3L 5ACZA 3G5XA 1FVCA 4ZFOB 1Q9WA 2OXGA 3G6JE 1W2KT 2EYTA 3DX6A 5I71C 5DQDH 1TJHH 4MJ5B 3A6BL 1WBXA 4Y5VB 2DQFA 1T83C 2I27N 4L4VE 2DLGA 3AAZA 1FL5B 1MRFL 4HKZB 5JDSA 1FVDA 1Q0XL 3ELAT 5T1KB 4C54A 2MQCA 5I66B 1NGWB 5IFJB 4X5LA 4PRHA 5IHUL 4OZHF 1EDQA 3TP4A 3BMVA 1NBZB 5JIHA 4YEFA 1HE7A 1OSPH 3H9SE 4G5ZL 4LNRA 1AGEA 1I1FA 3EZJB 3OR6A 1J8HE 1S7QB 4AENB 1BM3H 1OD7A 2C7UA 2W07A 1DL7L 3PNWA 2PYEB 3CX5J 3RWCA 3HZMA 1UEMA 2BK8A 3MRFB 2DQJL 5ITBL 2A1WH 1NAMH 4KVNH 3O6ML 3MUGB 3LN5B 3BDXA 1KJVA 3O8XB 3NN8B 5C6TH 5T3XE 4WJ5A 4FA8A 2DJUA 3VG0H 4POYA 3UBXG 1IGML 1YEEL 4CN4A 1VCAA 1D9KD 1FZOA 1FC1A 3B5TA 5FKAA 2CLZA 3WDJA 3O3EB 1VACA 3I6LD 3UTTA 1Q9KB 4K7FA 3CVIH 2J3SA 2BRQA 1D5ZA 4LLVB 3CU7A 5IOPA 3K74B 2DTSA 2H3NA 3TGXA 1YYMH 3WDHA 4CMMA 3D3VA 5DK0B 2D4FA 5I0DA 4W6YB 1RJZA 1EFQA 4N0YL 5F93C 4ZFOL 2GKIA 3BO8A 2IQ9L 1QSFD 3GSNH 1FNSL 3MNWB 5ERWB 5EPMB 4YGVA 4POZC 4LAQH 1VADB 3ZYZA 3SY0A 4OFDA 4CN6A 1HQ4A 5IUSA 2W60A 3TIEA 1WUNT 2HKHH 4TUKH 5MP6H 4NKMB 1KN2L 1BZ7A 4F58H 2AK4A 5HHNB 4R4NC 2W9DL 1EPFA 4C59B 4XWOC 3BI9X 4UTAH 32C2B 2Y6SD 3LSOB 3F12B 4WI2A 5KVGL 1H0DA 4C4KO 1GZPA 4I48A 4ZO6A 1PKQE 3UDWC 1MFEH 1A14L 4PJ8A 4IS6B 4PP1C 1G7JA 1NMCB 4PGDA 2X9YA 5CCKL 1TZGH 4KPHL 2EDHA 4G7YH 1DE4B 2IAMC 1MCFA 5BO1H 2IBBA 3CFCH 4GMTL 1CLZH 5C0ND 1CFNB 1OAKH 2F58H 3NFPB 1PG7L 3BP7A 5KVEL 4RFEA 4UUJB 3GJFB 1FNGB 4L1HA 5E5UB 2LFGA 4MJID 4YQXL 3ARDD 4MAYD 1HQRB 1PQZB 4QXGH 4P2OD 5EFIB 4IRSB 2OTWB 3KDMA 3AXLB 3O3BA 3TNMB 4F2MB 4GG6E 3EYOA 4O51A 1HDMA 5JHDB 1RUPH 4X8XA 3WBDA 3F6IA 3EOBB 3MBXL 3L95B 2BVQB 4NZRL 1ACYH 1MQKH 4Z0XB 1HYRC 4OF0A 3GMPA 3U4EB 5E6ZA 1D6VL 5HJ3A 3I9GL 4HUUB 1T03H 4NRZA 4X80H 2YEZA 1O5DT 2P4AB 3SKJH 4QOKA 4IOFD 4BZ2L 3DXAB 2AEPH 1YJDC 3OKLA 1X5YA 3TN0A 5IB3A 3STLA 1U58B 2W9EL 3SHSA 4HGWB 2A2QT 5INCB 4KY1H 1I1RA 5FCSH 3I6KA 1DFBH 1LK3L 3DMMB 43CAA 4TVSa 4X4ZA 2X4PB 1OCWL 5C0BA 3RZCC 1EK3A 1G7LB 4J8RA 3CUPB 3CFDB 2R29H 3CFJB 3LQAH 1S7UB 5IV2A 2VLRA 1IM9A 1JPFA 5JHLH 4KDWA 4FQ1H 2NZIA 4OLZL 3QDME 3SKUD 5I1KL 1M1SA 1F8TH 3M1BA 5F6IB 1Q8MA 5D5MF 3TBTA 3T4AB 1RFDL 3MJ7A 5IQ9A 5DLML 3QIUC 4YFLF 4JRXB 3K0WA 3BZFA 4HIIB 4KTEH 2UYLA 4OZIA 1OW0C 3TO4B 1A7QH 4OD3H 5C0EA 1Z9MA 2MJWA 1OAQH 2NY3C 1DUYB 1FG9C 2F53B 1A3RH 2X4UA 4OZHE 1JE6A 1MREH 3MV9D 3EOAA 4HK0A 4PB0L 3ZSSA 1T20A 3SPVA 4MVBD 3ZKQD 4JQIH 2P5WE 3O6LH 4YEEA 3S96B 3FO0L 1N8ZA 3LQZB 4OCNC 5GPRA 1TJGH 4MJ2A 1TJIL 4XPGH 4APQD 3P77A 1S7VB 1LO3L 2R0LH 1WSST 5T3ZE 4ZMAT 4Q6IC 4ODSL 3FRPG 4MNGE 1A7RL 4DGIH 3PQYB 4GW1A 1MCCA 1PYWA 4MAUH 4CNIB 4H26A 4EVNA 1D5MB 3O3DA 3CXDL 1EEQA 4G8GA 1ZHBA 4KRPC 4QXWA 1TQCC 3T0EA 4DFHA 5HYEA 2ZSWA 5GGVY 4RGOL 4GLRH 5A2IH 5L8KB 2JLLA 2ZUUA 3ILPA 4RBPK 2XZCH 5GRUL 5T5FL 1LEIB 3D69A 2XPGB 3OWEA 4OD2B 1G7MB 1BD2E 5CJOL 3FQRA 3ISWA 3U0PA 1QFPA 4XWGL 3EZ8A 5IW1A 4M9OA 4LKCB 3LKPB 3QB7C 5IR1B 4YUEH 4AM0A 1LP9E 3N9GH 4OM0H 1P7KA 2X4OA 1T1XB 2DDQH 4HS6B 5F89B 3BGAA 4OAWB 2ZNWA 1E6JL 1YEDA 4X7TA 1F6AA 1AR1D 3VE0A 3RUGB 3D39E 3HFML 1UFUA 1JGDB 3WIHA 4P2CG 3ARTA 4U31A 5DEZA 2HMID 5IVXA 5B39A 3O9WA 4YK4B 4NQDD 3MLZH 3DYOA 3NZ8A 3RKPA 4JJ5A 1TNNA 2XXCB 4OCSL 3AB0B 1JJUA 2JJWA 5DFVC 4QWWD 4X83A 2QBWA 3MV01 4FXKB 1S7XA 3BESR 3RJQB 1OAXH 3BISA 3A0OA 1RZKL 4D8PA 4UILH 3MBEA 4L29B 4MXVF 5D1XD 2WBJC 3SQOL 4PJCA 5BS0D 4KJWC 4ELMB 1P7HL 1SYVA 1CXLA 4LK4A 2GT9A 3G6DH 3OV6A 4D0DB 5B3NA 3M17A 4RGNC 4W4NA 1KPVB 1P6FA 5F3BA 5ESQB 4JZNB 1P7QD 4MB3A 4EN3C 5IP4A 1UH4A 3CFKA 3DUHA 4IOSD 2NZ9C 4FN0A 4TTGA 3TA3D 1T2JA 5C0AA 4U3CA 5CILH 1U8MA 4HS3B 2AJ3A 5D7LE 1GGIH 5SWSB 3I02A 5GRWA 5KSBA 3STZB 4KI5C 5D70H 3VWJB 3CZFA 1T5XA 3RFZC 3PWVA 3VFWB 5D72H 1SQ2N 1XF2A 5DJCA 5F7DA 5HHMB 4X6EB 2DD8L 5EUOA 1H3VA 2Z93A 5EU7E 4O4YL 4LHUB 4KK9C 4XP5L 2DQUH 3O11A 3BDBA 4FFYL 1E27B 4LSQH 5J3HC 3LRSB 2EIEA 4Z7QF 4HT1H 3QNYB 1T7XA 2X4QA 2R2HA 3L3KA 2IEPA 4NNXB 1HKFA 1XEDA 2Q7YB 2VDOH 1R3KA 1P9MC 5GZOD 1NCCH 2AEQH 1WVZA 4JFFA 2D0FA 2FX8H 5HI3D 1DP0A 4FQIH 1A6UH 4RWHA 1QRNE 4ODVH 3QA3A 1T1ZA 1ZSDA 4Z77A 2AXFA 2F15A 2VL4A 4WCYH 5F71A 3PDGA 5HGBA 2JCCB 5GGRB 5IB5A 1M71A 3D0LA 5ISZA 3V5DA 1I8IA 3JXAA 3LN4B 4NDMB 4ODTH 4Z7OE 3WN5A 1U3HC 3SE3C 2HVKB 1RJLB 2CJUL 4JY5H 1NAMB 1NCTA 3QQ4B 5H37G 4LDEB 3TV3L 4WI9A 4XX1E 4JR9H 5DS8B 3GSQA 4WIQA 4HJJL 2XN9D 1YEGH 1WBYA 3MYZA 5DJDA 4CMHB 4P4RA 4KH2A 2HJFA 4PJ5B 2G9HA 2ZCHH 1ED3B 4P23A 4PJGF 3HG1E 3T1FA 4GAJL 2B39A 3D87B 5SV4A 2R9HD 4X5XB 2EXYD 2YWZA 4Y4HD 3IVKA 1BIIA 4P4KA 4U1MA 4NQSA 3RL2A 5K9OB 4H88L 2BVOB 3OKYA 2VDMH 3SOBL 5C2BH 2Q76B 4D9LH 5H2BA 4Z7VA 4GW4A 5ADOL 1ZT7B 4UQ2B 1QA9B 3D85B 1L9NA 5EZLB 4PJBA 4XCEA 4GRMB 4KDTA 4P2QD 1TVHB 4RGMB 2C1PB 3GMOA 1L6ZA 3IDYB 5IMMA 2IH3B 2NY0B 1C1EH 5DQDL 1TJHL 3O4LA 5HDQH 2J6EH 1I3RA 3QIWA 2X2YA 3DI2B 3S5LA 1KENH 3IJHB 5FB8B 1TENA 2WWKO 1BF2A 4G7VH 3SN6N 1E4XH 1X5GA 2GSIA 5A2KH 4ACPA 3P9MB 1JRHH 2DM2A 4PD4K 1KTKE 3QDGB 1OSPL 4A6YB 4FQXC 3TO2A 3KPMA 5LGJA 3WFZA 1BM3L 1XFPA 5EOQH 2H41A 1OTUC 1QO3B 2C1OB 3S4SB 3GMNA 3L7EB 2QR0B 4HUKB 5DVMA 3DGGB 3WLBA 1AE6H 2A1WL 1NAML 3KHOA 4KVNL 3VXPA 5FOJA 2R0KH 3SDAB 1VGKA 3VXSA 4NHUA 4LCIL 1JYNA 2DTMH 3FB6A 3GEWB 43C9B 5FYKU 3NA4A 1H3UA 5C6TL 3WFBH 2B1HH 3VG0L 4AT6B 4GBXB 3W0WD 3MRJB 3QP3A 1BQHA 3OXSB 3IKKA 4LVNB 3BN9C 2YD3A 3CVIL 1O7VA 5IW6A 1DVFB 1SBSH 4MXVE 5FA3B 1YYML 2CIIA 1QBBA 4NWTH 3BUYB 4EI5B 3CLFH 2ZCLH 3P3YA 3GSNA 2A6KB 5JW4N 2COQA 1QHPA 5JW4M 3GSNL 3KYMA 5F6HJ 1P4LB 3MXWH 4LAQL 2ZP0T 2Q6WA 3P0VH 5ID0B 4BFGA 2HKHL 4TUKL 4WGVB 5MP6L 3GDBA 4F58L 4JRYB 4ZS6D 1AIFB 4UBDD 4PGCB 3T0WA 4F7TA 5JMRA 4Z78A 5JQ6H 5C08A 5IVNA 3HI5H 3GBNH 1OSZB 4P3WA 3QQ9C 4UTAL 2XKNA 3OAYK 3QQ3B 3TH3T 4Y1AE 3S7GA 2CUHA 2V5RA 2ZUTA 3SE9H 5F3HB 1JCKA 1ZMYA 4OTXH 4Y0GA 4Z7QE 1TZGL 3MLTB 1KIQA 1KNOA 4G7YL 4POUB 5EOCJ 5BO1L 3HE7A 3CFCL 1CLZL 1ZHKA 5C92A 1OAKL 2AW2A 2F58L 3BQUC 1M7XA 4PJ9C 5LAXB 3UBXI 2A6DA 3BN3B 2ITCA 4PP2B 4QXGL 3AM8C 1T3FB 1N0LA 1ERNA 4UIKH 4MD5B 1OPGH 4XNYH 4J3XA 4JKLA 3QO1A 3IJSB 4JKPH 1RUPL 1CFTB 4C4KT 1FG2B 2UZIH 1ACYL 5DRXB 1MQKL 3WMSA 3P2TA 4OLUH 3RY5A 3V6BR 1CF8H 4EOWH 3ZHKA 1T03L 1GIGH 1R5IB 5HI4D 4X80L 4KHTH 3VMOA 3SKJL 1YA5A 4WO4C 2AEPL 1JWSA 5FO7A 3LPWA 3WFDL 4X4ME 4PJGE 5TGBB 3TBVA 3RWHA 4KY1L 3VXUA 3C6LD 3EYFB 1DFBL 2Z35A 3DRTB 5HY9A 1VEMA 1CXKA 4F7PA 1J5OH 1NGXA 4X4YA 1IMHC 1ZLUK 1VEPA 4ZFFB 5L2KE 3LQAL 4OF7A 5L2JB 3B8YA 4XAWH 2BNQA 5JHLL 4FQ1L 1CIUA 4P2RB 1F8TL 5BXFB 1NC4A 4NRXA 4PTTA 1ORSA 4PJEA 4ZS7H 4UDTA 4GSDH 2OQJB 5DC0A 1JHTB 2EO9A 2ICEB 3LKSA 4KTEL 5DD5H 1MEXH 4M62L 1X4ZA 3KPPB 1NFDB 4WU7A 1A7QL 2QADD 4OD3L 3GIVB 4GUPB 3U79A 4PGEB 5MEOB 4PY8J 5JLZA 1YNTA 5EO9B 2D3VA 2CDFB 3BD5A 5C07A 1CLCA 3CMOH 5CBAA 1JGLH 1A3RL 4N1CA 1MREL 5FYJH 4EUPH 4JQIL 3O6LL 5KSAB 1CS6A 4EKXA 4LAJH 2D7PA 3UJJH 1ZV5A 3HLAA 4F7EA 2ADFH 4YHNA 1TJGL 4R90H 5IMLA 4WW2B 4XPGL 5MENE 3GGWB 2EEBA 5CLWA 2R0LL 1QVOB 5I76A 3LKQA 3EDJA 3W2DH 5GISH 1TCMA 4DGIL 4MAUL 2BY0A 4OQTH 2CKBA 4YXLH 1ZLWK 4CRPA 3RAJH 2P43B 4BM7A 4GS7B 5TPWH 4F7CA 2IBGA 2P46B 4P5MA 1M6OA 4CADA 4MDIB 3H9YA 3CPLA 4OGYH 2XZCL 5TDPB 2YD6A 2LQRA 4BQ9A 4M93B 5EU4B 2E3VA 1G7QA 3MRMA 1S7WB 2JJVA 4Y19B 1I3GL 5AYUH 4K3GA 2AV7B 3EFFB 4CL7A 4PJ7F 3N9GL 4OM0L 4Y5XB 4CBPA 2DDQL 4HIJB 3T04D 4LCUB 1S78C 4Y4KB 3N1MC 4LHUG 2E7CA 4E5XB 4ZAKB 4QHLA 1OP5K 2HLFC 2WANA 4Y89A 4RIRA 3UTTD 3GIZH 2Z9TA 1WWWX 2N7AA 2VDPH 4MXWH 5HGHB 1FFRA 4LGPB 1QFWM 1VFUA 4PRBB 2JB6B 3D3VD 2V6HA 4J23A 4M3KB 4Y16B 5JORA 1HXMA 2BZDA 3NCMA 4NWUH 1S9VA 3TF7C 4G43B 4YO0B 3MLZL 2QSQA 4HULB 5HHVH 1A64A 2J8UA 5FEBA 2WV3A 4PGBA 4YLQT 2MNUA 1I7ZA 2UV3A 4Y4FC 4DUVA 1FZMA 1OAXL 2VR5A 5HHQA 2P5EB 2CRIA 1BVLB 2UZYB 5B38A 4L4JA 4YHOH 4UILL 3BWAB 5DJYA 5ESAB 4PBWD 3VDAA 3REWA 3JUYA 2AK4D 2F74A 2YPLD 3BPCA 4S1DC 3DVGA 3G6DL 1DQLH 4GKZA 1I8MB 5HYJB 1R3LB 1LE5B 4O2CA 2H2PD 1A47A 5IEHA 4UINH 4X98B 4OUOA 3TBSB 1CICA 2DQGH 1IC4H 3RKDC 5DJ0A 4PG2C 3WUWB 1I1CA 2BOCB 1EAPB 5CILL 5B3JF 1GGIL 5F9JA 5K9QG 1FL3A 4P9HC 4LEOA 1IEBB 1PKOA 3JTTB 5D70L 5BZDA 3D9AH 4YIQB 3MODH 3NIGF 4L8BA 4FQ2H 5CMAB 2PW2A 3QAZB 4PRPB 3HRZA 2J5LC 5E6IC 1NDGA 4EN3A 2QHLA 2W1NA 3RX7A 1T1WA 2DQUL 2ADGB 4KHXH 1KV3A 5TE6H 4DCQB 5D7JB 1KXVC 4LSQL 1IAKA 1WEJH 4N5EC 1JL8A 4JVWA 4N0RA 3C09B 4HT1L 2P8LA 1RIHH 1I7UA 4YAQB 5FDYA 1QUNA 1S9WB 4X6DB 3K3QA 2VDOL 1UCBH 2ARJB 3RDTA 1CDCA 1NCCL 3SDCB 4GJTB 4YHMH 1SJEA 2AEQL 2FX8L 3IETA 3TBYB 4AZ8A 5C0FB 4FQIL 1A6UL 2FECL 3HA0A 3U1SH 5HVFB 4Y2DC 4WCYL 2VLLB 4QOKD 2FWOA 1CXFA 3B3IB 3TN0D 4NBYB 4CVZB 2MTPA 4F9LC 2X4TA 4ODTL 5ADPH 1MI5B 3O2VH 3QUXB 3S4SG 4JY5L 1JF1A 4HEME 5C0BD 4PJDF 2FHCA 5DI8B 2YKLH 4HBCH 3SCMB 4X5WA 5J7CC 4JR9L 5F9AC 3T3ME 3U4AA 1TZIA 4X7DC 1YEGL 5E8EB 5K9KB 1XF5A 2VLRD 1IM9D 1YY9D 2FDBP 2ZCHL 3MFGB 1TTGA 3VXQA 3QZWA 2HLAA 1P5VA 1L9MA 4WTXA 1KGCE 1T2XA 1G7PB 4OIAA 5SX5K 4NRYA 4PJAB 4ZOCA 3UEZA 1A5FH 2MQ3A 5EO0A 1S3KH 3S35X 3N1GC 1CL7I 5LKNA 2VDML 2PNDA 5C2BL 4D9LL 3SJVB 4L8CB 1FAIH 4CU7A 3SGEI 1CE6B 3UZQA 4GAFB 4NZJA 1K4CB 3DVFA 4JFYB 4PG9B 2YXFA 3PWJA 1E28A 4OUUA 5CZKA 5DO2D 1T04B 1TZHB 1C1EL 2B4CH 5HDQL 1J10A 2J6EL 1XGQA 2OR7A 4IRZH 4HJGB 4WI7A 3C60C 1KENL 1Y0LA 5CIPA 5F7NC 4XMPH 5C0JA 4QCIB 4G7VL 1E4XL 3QPQD 1KEMH 3ILQD 2IBZY 1NGZA 3G6JA 1JRHL 2R2BB 4JFQA 35C8H 3HUJF 3SQBA 5A2JH 1I85A 2X4SA 4KKCD 4PRHB 4G8GD 3NBNA 4JPKH 1JYXA 1KB9J 4LOUC 2EH7H 4AYFA 4PJ7E 1BFSA 3O4OB 4L4VA 5DQJB 4ZUSA 1FV1B 4KJQC 3RVXC 1CQYA 1YY8B 1OTTC 3T0ED 3BP4A 1NFIA 3QUZC 2VDLH 5DURD 3EYUH 5J9PA 4OZGB 4X6BA 3FFDA 2SEBA 2KZWA 1AE6L 2C3WA 3KR3H 1M4KA 4EXKA 2FR4B 3RWCB 3LIZH 3H9SA 2R0KL 3VG9B 1JTTA 2IC2A 3U9UA 1J8HA 1FO0H 2NY2D 3QUKA 4MSWB 3WFBL 2WWKT 4PJIB 1MY7A 2B1HL 2PXYA 3ZYOA 5EH1A 4MCZB 5LG1A 4HWBA 1SVCP 4UQ3A 2UZXB 2J4WH 4IJ3B 5DD3L 1WTGT 2UY6A 1T66C 1KXTB 4DZ8A 5DT1L 3I6LE 1EGJA 4UI2A 5BRZE 3C8KA 4LVHB 1SBSL 4NKOB 4U6HA 3FONA 2UVEA 4NWTL 5E8OB 3VFRB 2VDKH 1XCQA 5K33A 4B5EA 1RHFA 3E3QE 3CLFL 2ZCLL 1A1NA 4CMMB 2ATKB 2ZUYA 3KPLB 5DVOA 3VFVA 5MEQB 1NEZA 1RJZB 2NX5E 5DC9B 4L3EB 4JFED 4QF1B 1QSFE 3MXWL 1F11B 3O9WD 3VW3H 4Y2OA 4PRIE 3GJFK 3U83A 3LCYA 4X9GA 1EEYA 4M61B 1W72H 4R26H 2OM5A 3ZDYF 2H45A 5GJTH 1IQWH 5B3JE 1V8HA 5D6CB 1JHLH 3JTSA 4WV1A 5EU5B 4UIMB 2WUCH 4GAGL 4JN2B 5JQ6L 1JPTH 3HNTH 5C70A 4JVUA 5ALCH 3WNLA 1EVUA 3GBNL 3HI5L 4WHTA 2A74B 3NIGE 4S1SH 1NC2A 5KZCB 1EXUB 1OLLA 3ARBC 3ARFB 4OCWH 2EDFA 1WV7T 3SE9L 2DIAA 5A2FA 4OTXL 1QR1A 5C8JB 4NN5B 5HYIA 4KJYA 5GRJH 4PJ8B 5C0AD 2GYSA 2BX5A 2RBLA 2Z91A 5EZJB 1AD9B 5IK3A 2W65A 4ALAH 3VXMB 4EUPB 4LLQB 4ERSL 3PWPB 1YPZB 1PKQA 4MJIE 5EA0H 3ZKXB 3RTQB 2YUZA 1I8LC 1YN7A 5FUOH 4UIKL 4RQQA 2WNGA 2FJGA 2EE3A 1OPGL 4XNYL 5GS2D 1WISA 3KPOB 4JKPL 5GIRA 1AY1H 5A3ID 4KVCH 3VFGH 1HDMB 2UZIL 4JM4H 3WL9A 2PF6A 4OLUL 1OQOA 3HE6C 1JZ2A 4PJDE 4EOWL 1GIGL 4O2FB 5CZVH 4KHTL 2VL5B 2GITA 4GG6A 1XIWA 5INDB 4LCWB 1HHGA 5LVEA 4BUGA 1A3QA 4JFFD 4CVUA 25C8H 1DCLA 1LE9B 1A6AB 2DM7A 4QRPE 3EO0B 1RZGB 2HYMA 1PAMA 3WXVH 5ISZD 1WK0A 5CP7A 4JAMB 3W5MA 5CZXD 4G9FE 2VZTA 1G84A 2YRLA 3W11D 1J5OL 3HTLX 2R15A 4KXZI 2I9TB 3QG7H 4JFDB 4P9MH 4XAWL 2X5PA 1DEDA 2HT4D 5ANMB 4F3FA 3VD9A 3CH1A 4M03A 1DJSA 5FV1L 2JK5A 4JPVH 1DDHA 3G5VA 5EOCH 4GSDL 3TBTB 1GOGA 5DD5L 4ZPVA 1MEXL 3MJ7B 3TCLA 4ZUVB 5A43C 3SDDC 4P46C 5KOVC 3EJZD 3QULB 2FZ3A 4P4KD 3QDMA 3CMOL 1H15A 4NPYB 2E5EA 3E2HC 4NOFA 4QLRA 3RWFA 4WFEE 3JV6B 5D1ZB 5BVJA 1JGLL 1S7RB 5FYJL 3HUJE 4UOJA 3MV9E 3T4YB 3WNOA 5CGYC 2ZUVA 2ZOLA 3TVMA 5D7IF 3KYAA 3T3PF 4OF5A 3UJJL 3GNMH 2D9QB 4R0LC 3IFPA 2ADFL 5EN2A 4R90L 4J7RA 1UG9A 3HPLB 1AQKH 1ULVA 5DFWH 4KK6D 3W2DL 4OZHA 5C9KA 3O4LD 4I0PC 3DTXA 3P77B 3R1GL 5GISL 1PZ5A 4F57H 3QIWD 4NUGH 2P5WA 4OQTL 4PRDB 3EFDH 1ZVSA 4YXLL 4KJPD 4XNMA 2E9JA 2XICA 2EDRA 1PYWB 3RAJL 5ITFA 1KTLA 5TPWL 1VEOA 4EVNB 1F58H 3WXWH 2QJDA 2P8PA 3VXNA 4JKWA 2Y36H 3QRFM 1LNUA 3FZUC 2MCPH 2OR9H 3KYKH 4MNGA 1QFHA 2ZSWB 1MRDH 2VABB 4OGYL 1YMME 3AC0A 3DVNA 2ZJSH 3MJ9A 4HV8A 3LH2H 4ESKA 3KPSE 2NLJB 4MWFB 4NO0A 2AGJH 3MJ8A 2BCKA 4IRJB 5DD0H 5AYUL 4MGXA 5IFAH 1ORQA 2C4XA 3VXSD 3QJFB 4MQXC 4N0UE 5FUCE 4W70A 3EUUA 1XGUA 2HTLC 1DQDH 1YJDH 3AREB 4PJ5D 1Q72H 1TETH 1GH7A 4FG6D 3LZFH 3MV7B 2IH1B 4AM0B 1CD1B 3FO9B 3K2MC 1BD2A 2B2XH 1CFSA 4ZXBC 3ZDYE 4IM8A 1NBYB 1HNGA 3ESUF 1IJ9A 1J86A 1H9VA 1YEDB 2RR3A 1A6TA 1F6AB 3GIZL 4LF3A 1DQJA 1LEGA 1TTFA 3VE0B 1H5BB 2VDPL 3TZVC 4MXWL 3BZEA 2OSLA 3D85D 3V5HA 1WFOA 1FDLH 2G75B 2XWBA 1CI5A 4EJ1C 2FB4H 4GW5A 4GRLB 1KJ2A 3UTZA 5HHVL 2OTPA 3D39A 1A9BB 5CD3A 2VZSA 4DZBA 3WFHA 5FA4B 1QBLH 3L5WA 4XCCH 5CSGA 2R23A 1SMAA 3H7LA 3KPNB 3OHXB 4M1CD 5D93B 3WO4C 4Y5YA 5I16B 4YHOL 2FLBT 5C09B 1CD0A 4KGLA 3IDGA 5BS0E 1RK0B 3MBEB 1DQLL 2IALB 5C08D 5M94B 1NUDA 4CAGA 5F1IA 4LEXH 1RHHA 1HXYB 3N1FC 2Z92B 1INQA 2VZ1A 4UINL 2EKJA 2X9WA 5KSVB 2DQGL 1IC4L 3GM8A 3EW3B 1KLUB 3SGDI 2B5IC 3CFKB 3V52H 3C5SA 3ULVC 5FGRA 1CGTA 2BHZA 3IAQA 1EJ6A 5L8LB 1PY4A 1Y6MR 2UY7A 1BZ9A 4JFHD 1N6VA 3HE7D 3D9AL 3OKNA 3BKYH 3MODL 1BQSA 5KSBB 4FQ2L 1YDPA 3NFNA 1G6RA 4X0KB 1XH3A 4DKDC 1QOKA 2HRPH 4U1HA 1XF2B 4KHXL 5D7LA 1UXWA 3T0XA 1FYTB 3QNZA 4HX1A 3E6FB 1WEJL 3EYSH 5GHWH 2DWEA 1A1MB 3Q48A 5HSFA 1HSBA 4NCDA 3HHRB 5MERA 3OG6B 1RIHL 3BIAX 3IDUA 5CJ5A 2GAZA 1QPXA 4N9OB 1UCBL 3L3KB 2YN3A 4YHML 1W8OA 4EI5D 4WW1A 1D5XB 1GHFH 4C58B 1C5DA 1A4KA 2I25N 2WK2A 3D18A 3PWUA 3DPBA 7FABH 5GS0L 1DN0B 3OKOA 2X4NA 1K8DB 3O45A 1O7SA 3M8OH 5DA0B 2AXFB 3MRLA 5ADPL 5FO9A 1GL4B 4BJLA 4O2EA 2I9LA 3VFTA 3O2VL 5I1CH 1QRNA 4I18A 4QYOA 1XF4B 3RVVD 2YKLL 2BNRE 4HBCL 5D5MA 5JDJA 5JXEA 5CP3H 1FO0B 3G6AA 4LP5A 2HJKA 2HT2D 4H25B 5D7IE 3T3PE 3O6FB 3TLRA 3BKMH 5DHYA 1WAAF 1NC4D 4Q9RH 2G9HB 1X7QB 1UENA 1QSZA 3G04A 1CVRA 3BRFA 5K9QI 1A5FL 1S3KL 3UROR 3AS2A 4M48H 3C5ZB 1BLNB 3QWOB 4U1MB 2YD2A 1FAIL 3OQ3B 4OJFH 5EBGA 2NY1B 2D0GA 2V7HA 3MACH 1XT5A 1Q9OB 5C07D 2F8XC 2BMKB 3HG1A 1XR9A 2DN7A 3EHBD 4HC1A 3O2WL 1RPQA 5E4EB 3J7HA 2Y06H 4XCEB 3JZ7A 3PGCA 1IL1B 2X44D 1JWMA 2PCPA 3CK0H 5FYJU 2B4CL 4P5TA 5DYOA 3F5WB 5EBWA 4IRZL 1W72B 2Q1EA 1RZ8B 5I1HH 3K4ZA 4XMPL 5DRZA 2XWJA 1XCTA 5GGSB 1LD9B 1KEML 3QXDA 3DX8B 4PR5B 4XRCA 3Q3GB 4ZSOB 5MEPA 35C8L 3VCLA 3TJEH 2Z4QB 4YDLC 5J13B 4YZFE 4JPKL 2EH7L 4RDQG 2GTWA 1J87A 1V3KA 5I71B 1ZVHA 2VDLL 3EYUL 3LB6D 1MCLA 1T80A 1JGVH 3KR3L 5IT2H 4OZFH 5IVZA 3WHE1 3CDGA 3RY6C 4AIZA 2G60H 5FDWA 1IEAA 4H1LA 4EBQH 4QGTA 1T21A 3CH8A 1FO0L 4GKOA 2FCBA 2F54E 1BFOB 1NDMA 3V79C 3LMJL 4NHUB 4N8VA 1D9KC 4UAOC 3GSOB 1FRGH 3OGOE 3ZTJH 3C8HA 5D2LF 2OYPA 3L3DA 4YHYC 2HN7B 3P4LA 1KYOK 5D2NE 1IGJA 1U0QA 3P11H 4I4WA 3I6GB 2PO6D 3K80A 5A2LH 5DXWA 5IW6B 3VGDA 1LDPH 2VDKL 3CSGA 3HMWH 2AJSH 3VFSA 2A6JA 3DARA 3AS3A 4XNUH 5IMOA 1QQDB 4OKDA 5L9DH 5EBLB 3VW3L 4PBXA 3R8QA 1KPUB 1SEQH 4C55A 5SWZD 2YMXH 4R26L 1W72L 3BGMB 4N90E 5GJTL 1IQWL 5FYLE 3QDJA 1JHLL 5C0RH 2WUCL 1JPTL 3HNTL 5ETUB 2P7TA 4K3HA 3K4DA 2IANA 3JUZA 4S1SL 5GGUB 4LLDA 2Y6SC 4IMKC 4RMRA 5EO1A 1IC7H 4OCWL 4KQ3L 4HDIB 3N1QC 2GQHA 2HT3D 1S9YA 5BZWB 4BSVB 2JJSC 1CICD 1QZ1A 1R5WA 4NQUA 4RSVA 4MA7H 5GRJL 2X70B 3EGSB 5C0NC 4AEFA 1U8QA 1TVDA 2FX9H 4Y1AA 3BH8B 1I7TB 4ALAL 3ARDC 4MAYC 1HHKB 3TNNA 6FABH 2BVPA 4PRAB 2R2EA 4P2OC 3ARBA 2E9BA 5EA0L 5EWIH 2V2WB 2M1KA 3KWWB 3MR9A 4RMSA 2A6DB 5FUOL 2VISB 3U48A 5E08H 1N5AB 3VXTB 4CUCA 4U6YB 3DO7B 3ULUH 1AY1L 1EERB 4U4BA 2QQNH 1A3LH 1V7NH 4KVCL 2DB8A 1U8LB 3VFGL 1Y18A 4JM4L 5F44A 2IAMB 5FHBH 3DVIA 2WBKA 3U36A 2R1YB 2OX5A 5CZVL 1NGPH 4IOFC 4Z76B 3PL6C 3RDTD 2K7QA 4G8EA 2OL3H 2V9QA 25C8L 3FOMA 4XT1C 2APTA 1XGRA 1JWSB 2BOBA 2RFXB 3PHSA 5FECA 3GFUA 3V9FA 3WXVL 3UO1H 4GLRI 1HEZA 3MRRA 1U8PA 3CAFA 5I30L 2BNUB 3FFCE 3VXUB 3ALPA 4F7MB 2EDLA 4A2LA 2DWDB 3GKWH 1Q38A 1URLA 4L9LC 2V7NB 3QG7L 4P9ML 5DZOA 4X4MA 4PJGA 3RA7H 1JMZA 5I1LA 2GJ6B 4YPGB 2YRPA 2BNQB 3IS1X 4UB0H 4OV6F 4JDVB 4JO2H 1AKJB 4NKDA 1RU9H 2Z8WC 5EOCL 2FJFA 4LGSB 4J4PA 1JNLH 2E9WA 4D9RD 4XB8A 5HHOB 5ICXA 5L2KA 3MA9H 3H3PH 3GUTB 1BHGA 3RZCB 2ZUSA 8CGTA 3D2UB 4GO6B 5CKAA 3LN9A 1YQ2A 5DSCB 3I3EA 4P57A 1YNTB 4XMLH 4MVBC 1J0IA 1G7HA 1K8IB 5CBAB 1TPXC 3NCCB 4QHNB 2FHBA 3KPTA 1MOEA 3L3HA 4QO1A 4QRSA 2GCYA 2OI9C 4APQC 3EDKA 3QIUB 1AQKL 2X89A 1KSRA 3FO1B 1S7TB 2FJHB 3QUMB 5E1AB 4HIXH 4LKXA 5B39G 4LCCA 3L6FB 1ZOXA 3SE4A 4F57L 4U1SB 4NUGL 3EYVA 4PYGA 2NY3B 4FTVE 4U3HA 3EFDL 3OJVC 5HGDA 3VWKA 3KPRE 5BW7C 3I2CH 2D0HA 4RCAA 1WC7B 3HAEA 2O5YH 1F58L 3BKJH 4WEBH 3WXWL 5MENA 2Y36L 1KCSH 5D2LE 3KLDA 2MCPL 2OR9L 3KYKL 1NUFA 3QI9A 2IPUG 4HZLA 5IVOA 1TVBB 1AXTH 2ZJSL 3E0GA 3LH2L 3CPLB 4OLXH 4Q6IB 3DSNA 2DQCH 1MLBA 2AGJL 1ADQH 1HHHB 2LAGB 4J12A 3WEXA 3JSSA 5FGCB 4RWYH 1HHIB 1A22B 5DD0L 1BFVH 2OZ4A 1KPRA 5IFAL 3H9SD 4OFKA 1D5BA 1G7QB 4KRPB 4MX7B 2IFFH 1UXSB 3H9HB 3OKDA 1J8HD 2B8OT 1DQDL 1YJDL 1Q72L 1TQCB 1TETL 2E8ZA 1SEBA 2PXYD 3LZFL 1REIA 5I74C 3QFJB 5CHNA 3CJJA 2B2XL 2XTJD 1AR1C 4G6JH 1J18A 3WLWD 5GS1A 1FL6A 5EZOH 3SJVD 2OXHA 3BPNC 2AAVA 2HMIC 5T3XD 4CW1A 2VLJB 1FDLL 1Z2KA 3QEQA 5EZIH 2CLVA 4L4TE 4LSDA 3REVB 3U2SA 4U6VH 5DJAB 2OMBA 5JORB 4MD4B 4L5FH 3BXNA 4QWWC 3WNPA 4HXAH 4GRWH 3VFPB 4XCCL 3WHXB 2FRGP 2IF7A 3ARYA 1CGWA 3FB7A 1I7ZB 3BPOB 3NH7H 1FGVH 3UC0H 5D1XC 1PSKH 3UYOD 4HCRA 1EO7A 3OPZH 3UTOA 1I9EA 2YPLE 1U91B 4HCRL 3B5GA 5ICYB 4LEXL 1BJ1J 4HH8A 3DVGB 1DZBA 4ODUB 3JWOC 1NC2D 1QFWH 4O2CB 1UACH 1VPOH 1W0WB 3TA3C 4WDIA 4ZPTB 1N0XL 1XGYH 2EZ0D 3AY4C 4KWUA 1R3JA 1ZT4A 2PYEE 3QYCA 1WCBA 3V52L 4U1NA 1A2YB 2CIKB 4OI7A 1IM3A 4LLUA 1KT2A 3FTGA 1M05A 2WBJB 3WIFB 2QEJA 3BKYL 1T5WA 2DQTH 4RGNB 3GJEB 4MYWB 3FQXB 2AJYH 2EDJA 1ZHLA 5JIIA 5J4MA 2HRPL 3L1OH 5FF6A 3CVHA 4NUJA 5D1QA 2JJUA 3IDIB 4EN3B 3PWNB 1J1OH 5DMKA 3EYSL 5GHWL 4N8PA 1T1WB 4JLRA 1I7RB 2WP3O 4S0SD 5IHLB 5CKGA 5K93A 5EIIB 3DURA 4KMTH 5FGSA 1CG9A 3NPSC 4KV5F 3S3SA 3W39A 5HI3C 1GHFL 5LQBH 3BW9B 1JRHI 2H26B 2VKXA 7FABL 4JHWH 3ZKND 3ARGA 3HZKA 1AD0A 4D0BA 5SWQA 2ATPB 4EEEA 1XIWD 4MDJA 1BECA 4WU5A 5DVLA 3VXRB 4TSCH 3ZSTA 3M8OL 3CSYB 3NIDF 4M5YH 5DUBA 4ISVA 5EBMB 1J05B 4LLYB 2V2TB 2LE9A 4Z7UB 1LO2H 3LKRA 1HOCA 4OZFB 1PLGH 2HAZA 5I1CL 1QACA 3RUGF 2GIYA 5DTFA 1BVKA 1JF1B 4YHPA 3D0VB 2ENYA 3TM6A 2VLRE 2PTTB 2HG5B 3OX8B 1UZ8B 5JNYA 3BKML 1F00I 4XXDB 2R9HC 3L3IA 2EXYC 4F33A 1BOYA 1U8KB 4NNPH 5DEGB 2FIRT 3VXQB 2GJJA 5IBLD 4M48L 5IROC 1U3HB 1AQDA 4OJFL 3MO1B 3MACL 2RHEA 3RY4A 2VXSH 2YOCA 5I8CA 4ELMF 3ORJA 3OTTA 2QTEA 1DUZA 1S9XA 2EDXA 2DS4A 3RTQD 3L5IA 1OGAB 3DBXA 1YN6A 1RJYA 2Y06L 1BX2A 3MFFA 4Y8DC 2UWEB 3CK0L 3FHQA 5E00B 1E28B 3B9KA 3VFUB 3MPCA 1VKXA 4ORZC 2Y72A 1JFQH 2VSCA 2P44B 3CC5B 1N4XL 1K5NB 4NQEB 4NO2A 4P9HH 1KUMA 3GMMA 5C6WH 1CYGA 2P5WD 5HHPB 3TPUA 1OP3H 1C8PA 3TJEL 1FJ1A 1CD9B 1Q94B 1UM4H 3QIBA 3G6JB 4QT5B 4OV5B 4JFQB 3DXAE 5LBSH 2R2CA 3UTQB 1A21A 4OZ4B 1JZ4A 2MCG1 5T3ZD 2F9BT 5HBBA 4R2GD 1JGVL 4PY7B 3A6OA 5IT2L 3WJLC 1I9RH 4X6BB 2SEBB 1X5ZA 3IDMA 2G60L 4G6ML 2X1OA 4NO0D 1K4DA 4EBQL 1SJHA 4PJ7A 4ZQKB 3W9DB 4IDLA 2XQYK 4FQXB 3C2SA 1FRGL 2H8PB 2PW1A 2IPKA 1NFKA 1UWEH 2JCCF 4XH2B 3T2PA 3MRBA 2AP2A 4KK5D 4MXQD 4UQ3B 5E2JA 1RV6X 1HHJB 4JRXE 2HFFB 3P11L 4V1DB 2JIXA 1CDJA 4X7FC 1BD2D 4MNQB 3RY6A 3X17A 3M07A 4KKNA 4NQXA 1F3JB 2LU3A 1OB1A 1RZIB 4NC1C 3U9PL 1OM3H 3C8KB 3FO2A 4U6HB 2AJSL 5DR5H 2F53E 1EFXB 4XNUL 4JZOA 2OL3B 5L9DL 5GGQH 1OP9A 5KN5A 5BRZA 4TOYH 4NO5B 3VFVB 4JFEE 1NEZB 1QLRB 2YMXL 2ZSVB 5C0RL 3K1DA 4PS4H 4ZS6C 4UBDC 4XCFH 2EDNA 4PV9A 1P5UA 5J1TC 2ADJB 3PQYE 3V4UH 2F8VA 4X6FB 1CK0H 2NX5A 1F5WA 1IQDB 5DEFA 1QSFA 4PRIA 1K6QH 5DQ9A 3PHOB 2I26N 2CDEA 3MMEB 3VGAC 5MI0C 1IC7L 4KFZC 4JFOA 3U6RA 3C08H 2QQLH 1FZKB 4HMEA 3GSRB 5J1SC 1SYSA 3TYGH 4V2BA 1HSAA 3QFDA 3GMQB 4MA7L 5DZLA 5F1OB 3FJTA 4QRRB 3V95A 4UT7L 4KV5E 3LOWA 2FX9L 3KAAA 2M26A 6FABL 1A8JH 2VLME 1IAOB 2ERJC 3DROA 2N7BA 1U42A 2VXTL 4HWZB 5E08L 2Z8SA 1A4JA 3NIDE 3B6SB 4PLNC 4LVEA 3QUYA 3KNBB 2WMPA 3IDJA 5I17A 3OXRA 3FCTB 3ULUL 4ZDHB 4MHHG 2FJGB 5IB2A 3PF2A 2QQNL 5D7LD 1A3LL 1V7NL 4IIQC 1A6WH 3RUGE 4YNYA 4KROD 5FHBL 1WWBX 5HXMA 1ONQA 5FK9B 5DJ6B 4RMVA 5HI4C 1V3MA 3BQUB 3QEGH 4HKXA 3P4MB 4PJ9B 1NGPL 1B88A 1WZLA 1JZ6A 4XCNA 3VGBA 4O5LH 2G5BA 1XGTA 4P99A 2OL3L 4HUXB 4P5KA 4ZFZA 5GS0D 2P45B 1TCRB 4L8SA 1KIPA 2W9LA 1YMHB 2GITB 1T6WA 1HILB 5JXAH 2XWTA 2W0PA 3UO1L 3C6LC 4WNQB 3MRNB 3GSXA 3V6ZB 3HR5A 2X1WL 4PJDA 4Z9KB 2VE6B 4U1KA 3NAAH 4XVTH 4IBLT 1E0OB 3C8DA 5E8PA 2E7HA 3SBWA 3GKWL 1JPST 3FT4A 5T1DH 4JHAH 3RA7L 3MGOB 4PPTA 1NMAH 4ELME 1QRND 2YZ8A 3MLXH 4QRPA 5C0CD 5JXED 4WO4B 3P9LB 4UB0L 4UZGA 4JO2L 3QEUA 1C12B 4G9FA 1RU9L 4HFWA 4LNVA 1X5IA 1JNLL 3R4DA 1AO7D 1U8JA 2H1PH 2QADC 1DDHB 4W6WB 3G5VB 3HS0B 3OMZA 4FOMA 1WICA 2ZUXA 3MA9L 3H3PL 1FE8H 4L9LA 1CCZA 4D9QE 1QNZH 1MWAA 5C86A 1U8NA 3F7VA 2Z0BA 3PG2A 5SWSE 4ONFH 5C6PB 5I8OH 4XMLL 5GRZA 5IB1B 3QDMB 5DK2A 1N7MH 3VJ6B 3MNVB 3PXJA 4MCYA 3BP6B 1GGYA 3U46B 4JN1H 2OMNA 2NXYD 5HHME 4C83A 1BIHA 3T77A 4YDJA 4LQ1A 2NY5H 4GRWB 5GGTH 2NTFA 5HVWA 5ENWB 4HIXL 1DQMH 4P5TD 3HUJA 5BQ7A 1K9TA 5E5MB 3MV9A 5DHXB 4EDXB 2QV2A 1AGFB 3GRWA 3HNSH 5AWNH 3I2CL 3HI6H 3GSWB 2WBWB 3S6CA 3BKJL 4WEBL 4A2MA 1FNHA 1KCSL 1NEUA 4C56B 4G8FB 2JCCE 1U8IB 4LU5H 5ACLA 4PGJA 1LNUB 5LWYL 5DUPH 2BC4A 2O5XH 2XXMB 3IT8D 4XBGA 1FFPB 1AXTL 3MLUH 4KZEH 4OLXL 2MHAB 5FO8A 2DQCL 1ADQL 3QJHA 3VDBA 3CGTA 3N85H 4RWYL 1TXKA 2AV1B 3BFOA 1IAMA 2DYPB 3DOSA 4K23H 2EE9A 2IFFL 2Y9RT 1YMMA 1BOGA 1MJJB 2OJZH 4G42B 4PJ5E 2FIKA 5IKCA 3S34H 3KPSA 3IF1B 4JVPA 3ARVA 1I1AA 1ZA6A 3IFOA 4G6JL 4WWKA 4NFDA 1C5BH 1ZXQA 1WZKA 1I8KB 1MQ8A 4AH2A 4QRTA 4N0UA 1VHPA 4NT6B 2GHWB 2EXWD 5LXGH 2E7LA 1A6TB 5EZIL 2NY4D 5H35B 1OAYH 4U6VL 3BZEB 2OSLB 5TF1H 1LP9B 3KXFB 5FM5M 3RWEA 4L5FL 5C0DA 5B8CA 4GAYA 1ETZA 2VRAA 2IMNA 4HXAL 4HPYH 3ZLQC 1CL7H 1AXSB 3L5WB 4ELKA 1X4YA 1W0YT 3SGEH 2DBLH 3WFCH 3NH7L 1FGVL 2R23B 3UC0L 1U8HB 1PSKL 2YD1A 4J3TA 3QDJD 2Q3AA 4G80B 4U1IA 3VRIB 1F45A 2L0DA 3L5XH 4OZFG 5EU6D 3OPZL 3KYOA 3UAJD 2VITA 1FC2D 1FNFA 1JPGA 2H2PC 4RAUA 3MV8B 4H5SB 1N59B 2IAND 1QFWL 4UU9B 1UACL 1VPOL 1WIPA 1GGBH 1INQB 1X6NA 3AU1A 4WW2F 1XGYL 3ZTJG 4Y4FB 1NBQA 5BS0A 5JPNA 1S5IH 1UQSB 1XR8B 3QO0B 4YDVB 1DQQB 2MFNA 4LSUH 3KLAB 2DQTL 1MELA 1ZS8B 2AJYL 3QEHB 3V5KB 3L1OL 5CINH 5DHVA 4MJ6B 2CQVA 5DJZB 1GZQB 5ILTH 1J1OL 1ES0A 4TVPH 4HMDA 5H37H 5I8KH 4F37K 2H32H 5SV3A 3LEXB 5GJSH 4LLMB 1HSBB 2BSSA 2CD0A 4XGZB 4KMTL 3UBXB 1C16A 3V0VB 5L6YH 1L7TH 1QLFA 5LQBL 3S97C 1MAMH 1CTNA 3X13A 2OJEA 2OP4L 2CO7B 3DI3B 4JHWL 1FBIH 2V2XA 4WW1B 3L3JA 2WIIB 2J5LB 3PWUB 5E6IB 3TN0C 4TSCL 3OKOB 1CGUA 2GY7B 5TH2A 2N4IA 1CE1H 1NGQH 4ENED 2EO1A 3LEYH 3UP1A 1LO2L 1IRAY 2GUOB 3PGDB 3DHJA 1R24B 1PLGL 5FFLA 1ROWA 3FQNA 1BJ1H 3UJIH 3MRGB 4YE4H 4JRYE 3WUZA 3A6CH 1G9NC 3QG6B 2WP3T 3QDHA 5CJBA 4XNQB 1YY9C 3BAEH 4G6FB 4X7SH 4FABH 3E1F1 4Y2DB 1JV5B 3PV6B 1T7VA 2VWEE 2VLKB 3PP4H 5IHZB 4NNPL 2H9GB 1DEEB 3VRJA 3SDXB 2GSGA 3OKEA 2BNRA 4J4PD 3DUUA 3BD4A 5EOTB 2X4RA 1ZLSH 3OB0H 5L2KD 5FM8A 3MYJA 5D7IA 4BQ8A 2VXSL 2AABH 3F6LA 1AHWA 4HIEB 5F88B 2V7HB 2FYYB 1DSFH 1NCNA 3B8SA 3HG1B 3OJDA 4Y4HA 4NZTH 5DO2C 4OI8A 1BJ8A 2A83A 1JUFB 2P49B 3RWIB 1LK2B 3PDOA 1JFQL 5I19H 2X89D 3W9EA 1NEZG 2FBJH 3ULVH 1P4BH 3QPQC 1JN6A 4UDUB 2ESVB 4M8QA 4P9HL 3ILQC 1I9JH 1N2RA 3VGFA 2XWJB 4NQVA 1TFHA 1XCTB 4KQ4H 1ZHNA 2GEEA 4KKCC 3CFEB 4JREC 5E2VH 3X14A 3VWKD 2R1XB 4ODBD 3BE1H 5LBSL 1J88A 2YSSB 4U6TA 4GMSH 5MEND 3T0EC 2BSRA 5E94A 3VFOA 4OIBA 4PUBH 1LHZA 4AK1A 4XNZC 3QI9D 5JW5A 3C60B 1I9RL 5C3TA 5HD8D 4E42A 4X6DF 2NY2C 3OKKB 5T1MA 1UEYA 3BSZH 5IVZB 3MGTA 3GKZA 2NW2B 4X99A 4LMQI 2CR6A 1UB5B 4P2RE 1BPVA 3OAZH 4CU8A 4N8VB 4YHIA 4MLSA 4MQ7B 3QUZB 2X1XR 3O2DA 5FYKH 3O6KH 2GFBA 4JFXA 4WFFD 5D71H 1IGJB 2XY1A 1S7SA 2F54A 3BHBB 4IMLB 3LS4H 1CGYA 3QNXB 2YD5A 3L3OA 1OM3L 4MNHB 1OF2A 4KUZH 5DR5L 4WFHE 1U2HA 5CJ8A 5D2NA 5E8NA 3ZL4H 5GGQL 3VXOB 5TDNB 3QEQD 2A6JB 3O9WC 4TOYL 5IMOB 4BZ1H 4U3XA 1U2CA 4XCYA 3KPQB 5E9DB 1FIGH 5JOFA 3ME0A 4TNVK 1G9EA 1MHHA 3LKNB 5C0GB 5SWZE 4TUJB 1RZKC 3HC4H 4PJAF 1UJ3A 2FO4B 4PS4L 2L7UA 2CKNA 4XCFL 2XFXA 5F1NA 2APVA 4E9LA 4BA8A 3V4UL 2HH0H 3HC0B 2CLRB 1FHGA 4AEIH 2FL5B 3V0WL 3ZYIA 1K6QL 1RIVH 4LLDB 1S8DA 4HUWA 4HAFA 3C08L 2LU4A 2QQLL 2XKSA 4KKLD 5FKPA 3TYGL 3GBLA 1S9YB 1U95B 2VZUA 4EI6A 4R7NB 4W81A 3IDNB 4JGUA 1X6LA 4Y19E 1N5YH 4NO3A 2AXGB 1LEKA 5FOBB 3S88H 3TC9A 4ZUTA 2Z8VC 1AGDA 3U0TB 4DK6A