3G5XA

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
DILMTQSPSSMSVSLGDTVSITCHSSQDINSNIGWLQQKPGKSFKGLIYHGTNLDDEVPSRFSGSGSGADYSLTISSLESEDFADYYCVQYAQFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 806 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xA01
3HNVL 2NY0C 4TSCH 35C8H 1QFWL 5IMKB 4FA8A 5I8KL 2X1XR 5FB8A 3B2VL 2CRYA 4P5TB 3ARDC 4KJYB 1JF1B 1GZQB 1KT2A 5GQBA 1OP3H 2HMID 1IGCH 3OZ9H 2CLRA 1K8IB 5GIRB 4JFDA 4MS8D 3QWRD 4OAWA 3CAFA 3STBA 3QR2A 2UWEE 4LMQI 5FO8B 3RUGB 1ORQA 3QQ3B 2JCCF 2JJSC 3TBWB 3F58L 1S7TA 4QRPA 2UV3A 3RGVA 1U8NA 4XBEL 3PWLA 3NFPA 2BSSB 4G6KL 4RMUA 4JVPA 1PKQA 1MFCH 3SO5A 3NFSL 1NGPH 5IFJB 4G8EB 3M8OL 4WGWB 2X4PB 3LEXA 1FNFA 5D70H 5HHPA 3HPLA 1HEZB 4LKXB 5LKNA 3NTCL 4NYLA 1XR9B 2DDQL 3W0WE 5EBWA 4MWFB 2ZUWA 5HGGS 3D0LA 4ZOEA 4E0RB 3VXQA 4AL8L 3K1KC 5TE6L 3O6KH 1L0XA 3D18B 2VZVA 3WSQH 5HHOE 1YEJH 4OCWL 5F9AC 4CJ1A 2DKMA 4MAUL 2RB8A 2D7QA 1RK0A 3VFTB 5EOQH 3QUKA 4IJ3B 5JZ7C 1FO0H 5C08A 1FH5H 4PJDF 5HDBE 5JXEA 3SGJA 2R69L 4MNHA 1KLGA 2M8XA 4K94L 3UCRA 1JGUH 1A3RL 5DD1L 1ZV5A 2AEIT 3EZJB 1AIFB 2DD8L 4LASH 3NGBC 3NCYP 1P7QB 3P4OB 5CKGA 4OD2B 2CIKB 1IC7L 1HQ4A 3E3QE 1EK3A 4LCWA 1OY3B 5TH2B 4KKAD 5JOPD 1FZOB 4M93B 3OV6A 3OHXA 3BPNC 4N8VA 1QG3A 3LIZH 3P4MA 1Q8MA 4LCIL 5SX4H 3S4SB 3HC4H 3EHBC 1J0KA 1FFOA 1V7MH 4MNGA 1KYOJ 5KSBB 5HHQB 4X7EC 5C09B 4PY7A 1K4CA 2Y4SA 5DD6B 2E7BA 4XZUA 1Q1JL 2GUOB 4YIQB 3U9UA 3JWNC 2YPVH 1NPUA 3UJTH 5I2IB 5JLZB 1S7SA 4OIIL 2A73B 4PJIF 3LN4A 4XWGH 5ENWA 4YHOH 3AM8C 5CSZA 1WF5A 5IQ7L 2JELH 5T3XE 2R0KH 1MREH 3BFOA 1I9RL 4M61B 3DI3B 5IMOB 3TEUA 2B2XL 4MX7B 3BDBA 1ROWA 4BKLA 2NW3A 2BHZA 2NX5D 5ERWB 2WMPA 4HUVA 3VFSA 3O41B 2YA2A 4ZPVA 4ZSOB 3S5LA 1KPUB 1R3HA 4OB5L 4NP4H 1NEZA 3ILPA 2EYTA 5FKAA 1NDGB 4Y4FC 2R15A 1BVKA 4Z0BH 1PJ9A 4EUPA 2X1PA 4Q2ZB 5JOEA 3IDJB 4KUZL 5ESQB 1LMKA 3MYZA 4PRIA 3BYTA 5DRNA 2XPGB 3LQMA 3KYAA 3WNPA 1ZGLA 4WHYH 4CMMA 4YXLH 1FFQA 4PLJC 1R3IL 3G5YA 3QG7H 1DVFD 3WIFA 1TZIA 1CICB 1BGXL 1IARB 3MA7A 5HYIA 3S34L 2ZNWA 4HJ0D 3VXSA 3IVKA 2VL5A 4JO2L 1OAXL 4PV8B 4S1DD 4XRCA 5A16B 5BW7C 3P30L 3W39B 5DJCA 2FATL 5D7SH 1AJ7H 1IVLA 3NFNB 3RAJH 4PJ7F 5D1QC 4ZNCD 1TNNA 1TXKA 4GKNA 2B7DT 1XF4B 5DURD 2QTEA 3U30B 4F57L 3QO0B 1AR2A 3QWOA 1NCWH 3L1OL 1J1OH 1KEGL 1HOCA 4M7JH 4L4JA 4XPBL 3CFBB 3MLUL 1DQML 5IB5A 2DICA 3BWAA 3CUPB 4K3EH 4L5FL 4H1LG 2QHLA 4R4NC 3WXVL 1CQYA 4PLNC 5JQ6H 1QA9B 3BH8A 4M6OH 1E6OL 2J2ZA 1A1OA 5KANG 5ESAB 4WTZG 1RFDL 1OF2A 5IB2A 3C60A 2VR4A 3U83A 3S88L 3SDXB 4M8QA 4MA1C 2AQ2A 1Q72L 1YEIL 3ELAT 5DDHB 5E8PA 3LRGA 1FYHB 4N0FA 3MJ9A 3QIWD 1QLRB 1RU9L 2ATPB 2Q6WB 5IFHH 2E5EA 4EQ3A 1ZK9A 1T0PB 1X5KA 4Y4HB 3VD5A 5HXMA 2XKSA 3K8MA 5CP3H 4B41A 4XXCC 1L4IA 3LQAH 1SY6H 4QNPF 1FYTA 2G60H 2YD6A 1DBMH 3MRFA 4KK9D 4JPWH 5E5MB 3BPCA 4H20L 2VUYA 1YN7B 3NH7L 3D3VB 3JZ7A 4L9DA 4NSKB 5L88L 2ITCA 2FJHB 4UT9L 4FQ1H 5E9DA 5GGSA 2FGWL 3KYOB 3CMOL 4D9LL 4QHKI 2NY4D 1Q0XL 2OBGA 1EMTL 5EC1A 2DQEH 2YUZA 5EUKA 4DVRL 5D4QA 4GUPB 3DTXB 2VL4A 2C3HA 4JANB 4P59L 5C0AD 4LCYB 1JNHA 1INDH 1C5CL 5C6PB 5I1HH 5MP6L 2P8LB 4L3CB 3HMXA 4OLUL 1A5FL 4GAGH 5HGBA 4MMXC 2A83B 4P57A 2GAZA 3PWJA 4O2CA 5J1AA 4YNYB 5CEZD 5KVFL 2BOCA 4TVSa 43C9B 2WUBH 1U2CA 1PY9A 4BSVB 4F33B 3KLHD 1YMMB 4KKLD 1J8KA 1OW0C 2CSPA 3HZKA 1KPVA 3NZHL 2ZSVA 1AHWA 5EZJB 2BJMH 1YJDH 1S9WA 3B9AA 3NZ8A 4JPKL 1J1XH 3PDOB 4MMZC 3ES6B 3HG1A 4Q6IB 2MQ3A 2IPUK 4UIKL 5C0IB 1EEQA 3WNNA 1KCUL 2F58L 2O5YH 4IOIA 4LVNB 5TE7L 4LSRL 2XNAA 3EO9L 5SWSB 3LSOA 1JTPA 3E6HA 2XZAH 4HIXH 2E9IA 5DFVC 1H3XA 1EFXD 1CDJA 4MJ2A 2BDNL 1DSFH 4RNRA 3DHJA 4U1HA 1JZ8A 3CFJB 4C58B 2I26N 5CHNB 2EIZB 3QCUH 5F96L 3QI9C 4WV1A 2A6KA 3RL2A 3HRPA 5TGBA 2VZ3A 1OTUD 4R0LC 4YUEL 2PXYA 1L6XA 3ULVE 1Z5LB 5DQJA 2DQJL 3L6FB 1LEIB 2DKSA 3JBG7 1AD9A 4G7VH 3B5TA 2VXQL 2H41A 3TPUA 4HIHA 3S96B 2QSCH 2LAGB 1Q9WB 4Q9BA 2R1YB 4HMDA 1K5NB 1IM3B 4KV5F 4JHAL 4RDQF 1XF2A 3ZHDA 4JREB 5EN2B 3EJYD 1A1MA 3T2PA 5DUML 1NUFA 2IADA 2VZOA 1BZ7A 3IU3A 3WIHL 1HXYB 1YC7A 3VI4F 4O5LH 1MFBH 4X7CC 2O5XH 4GRLB 1V5JA 4MLSA 3O2DH 4L8CB 5J13B 1ITCA 3CX5J 1PYWA 4HBCH 5I16A 3EAKA 4WIQA 4JQXC 1XCTA 5DEZA 1LD9A 5FAAA 4MCYA 1YNTB 1IMHC 5ID0A 4BELD 3GMMA 3MRQB 4QYOA 5DEFB 2I60L 5BRZA 4X99A 5C0BE 1BJ1H 2FWOA 3DMMC 2G75A 3REVA 3T0EC 4HQQH 3TBSA 3INUH 3O3AA 3GM8A 5J12C 4DKFL 1S9XB 4XNUH 1WCBB 4PB9H 1DLHA 3VFWA 1QPPA 3OG4B 4QKXB 3GBLA 2VXTH 4G3YL 3T3MF 1V3MA 4BH8A 2GJ6D 3GDBA 3CX2A 4FXGA 5I74B 4CVXA 2PF6A 5C0JA 3ARTA 1IQWH 4NZDA 1XGPA 2YBRB 1BLNB 1KTDA 1BX2A 4MA7L 3TZVB 5IIEB 4KQ3H 5I1CH 1F3DH 2ED8A 3EYFB 5JUEL 1GC1L 1QBBA 1TNMA 3PGFH 2DS4A 1J05B 5EZIL 1UWEL 3KPQA 3DO7A 5I1EL 4O02H 3WXWL 3QUZD 2YC1B 3X3FH 5MEPA 1EHAA 2X89D 3PWVA 4JFOA 4J23A 3L9RA 3LPFA 1B88A 1HKFA 4PJ5E 2GY7B 5D6CB 1ZT4A 2PNDA 4RAUA 1NMBL 4LEOA 4CNIA 5HD8D 4OCXL 4O2FB 2R1XB 1ZAGA 4PJFF 3GHEL 4KMLB 2VNCA 3P2TA 4PJXA 2IF7A 4UU9A 5HI5C 3VFPA 5H94B 4IHOB 5F9WB 3P11H 5D1ZC 1IBGL 3RWIA 4PRAB 1CLYL 5EOTA 2DQTL 3BQUD 5L9DH 3HI1A 4HHAA 2P5EE 1MHPH 1FFRA 3MRNA 4NNYB 4WW2C 4D9QD 3DUSA 5GS1A 2APXA 3VDAA 4MQ7A 5I71B 4YDLB 1JTOA 4F7EA 2D4DA 1II4E 5BQ7B 2AJXH 5GZND 5C86A 3S97C 5SX4I 4HDIB 5EBMA 5E24E 3GMLB 4PJEA 5MEND 4N0UE 5CGMA 4CBPA 4O2EB 3DOSA 4UNVA 5MERB 5SWZE 3DETD 2QR0B 4LPWA 4P4KB 5IWLA 1SEBB 3WFCH 4AM0B 3GBNH 2DIJA 3DRQB 4MXVF 5F93C 3GZKA 3P0GB 4XPHL 2VYRE 1I9JL 3GJEA 5E7FA 5TPWL 1UVQB 4ZTPH 4P3WA 2AI0L 4QGTA 5ISZD 3GSNL 4JN2B 3PGDA 3TVMA 2IJ0C 4L4VD 3VXNB 3V4VL 1BAFL 2M26A 4H25B 5EFIB 3B3IA 2NY0D 3LKQB 1KXVC 4Y4KB 1A6TA 4YBLC 1A9EA 3HPJA 4F7CA 5TE4H 4NBZB 3ARDD 1QFOA 1QNZH 3MRDB 4X7FC 4PBXA 5JIPA 1OAZH 3IJHA 3NCFB 1VFUA 1VGKA 1UGNA 3QG6A 3CIQA 3C9NB 3TWCL 4IMKC 1NFDE 3M07A 4KRNA 4WUUE 1F00I 1Z3GL 4XMKH 4ODHH 3X14B 1LO0H 5DVOA 3VDCA 4HFWB 5GSRB 2EE3A 3OJDB 4LCCB 4OM0L 2GITB 4YPJA 1FV1B 3DI2B 4FQLH 2J4WH 4OFIA 3WUWG 5DEGB 4QOKA 3TN0B 2P1YA 4ODWA 5HHNB 2FYYB 1NCNA 3FFCE 4NRZA 4GSDL 1OLLA 1TJHH 2VZ1A 1NAML 2R23B 4NO5B 4NT6A 4LLMA 3QQ4B 4J1UA 3B9KC 1Y6MR 5I76A 4G8GE 4RGNB 4KK5C 3JWOL 4WHDA 4YHIA 2J6EL 3LV3B 3QIBB 1T22A 1MLBB 3OX8B 4H0IA 4NUJA 5FYJU 1OPGH 1A6PA 3PL6B 5EU7C 1A6UH 2BHYA 2NNAA 4CN1A 1IGMH 5ADPH 4AEHL 1U95B 1K85A 4WTXA 5JPMA 3OAYH 5IROA 3MJ7B 4X7TA 2YEZB 5INDA 5JZ7D 3OKKB 3VG0H 5IK3B 3O45B 4IMLB 4U1JB 5E6IA 3P9LB 4NQCD 1G6RA 2BSRB 5DT1L 1MI5D 3KPTA 3WNLA 4JKLA 4RSVA 4K7FA 4N5UA 2AK4D 1YPZE 2OR7A 4LDOB 4Z6AT 1ZEAH 1YY9D 2IANA 3KXFB 1CFTA 1XGYL 1A6AA 4JQVC 2DQCH 4JFXA 2IGFH 4G42B 3N0PB 4FN0A 2EDRA 3FO2B 3EOAB 3ZZ1A 2KUTA 1M71B 2VDMH 5DS8B 4J4PC 2IBZY 3GSQA 5F7NC 5IW1A 3TT3L 3GKWL 2OK0H 1F6AA 3BUYB 4GKZA 5KN5B 4FG6C 1MCJA 2NY6C 1G9ML 4ELKB 3RTQC 3ZKXB 5HHOB 1A7OL 4D0BA 3DX9A 4U33A 5FGBC 4C83B 4D0CA 1H3TA 1QLFB 2AV1A 3MBXL 5IUSA 1CR9H 3LRHA 5FUCC 4X6DA 4OFYA 4UDTA 3TA3C 4GG6B 2Z8WC 3DSNA 1A4KA 2VB5A 3DSFH 3ZMRA 3QFDB 3TM6A 1CXEA 3EDKA 3PUCA 4ONOA 3MBEA 5IFAH 5GRWA 3MCKA 2CK0L 1B0GA 4BZ2L 4QHMA 4D94A 1KB5A 4ZFOA 2NXZB 5F6HJ 3EYVB 1IGTB 3D2UA 3CD4A 2EDNA 1JPSH 4PLJD 4MJ6B 1T20B 3BP6A 1I9IH 2X4RB 3T2NH 1OAKL 3L3DA 1U8HB 3KS0J 3WFBH 5ADOL 2YN3A 4PJ9B 5JOPE 4EBQH 3C6LC 1KPRA 4PJ8C 2BNQD 4XX1G 5F89B 4Z7UF 3ARGA 3GBML 3LN5A 5D1QD 3MRHA 1PVHA 2ICES 3ZDZF 3EOBB 1WFUA 3RWHB 4NO0B 3G6JA 3PWUB 1U3JA 4ONHB 1QBAA 5IJVB 5TDPB 4G6MH 2Q20A 4LSUL 5JDSB 3H9YA 4NZJA 4M5YL 4OSUH 3IKCA 4IOSD 4TNWF 5F7HA 4JEGB 4R4ND 3QDJA 1BZQK 4WDIA 1NBVH 4GH7B 1FDLL 2VITA 1H3GA 1JGLH 2GT9A 2W65B 3O6MH 2BSTA 4QXGL 2XG5A 2BVUA 4NWTH 5EO1B 4YJZL 4Z7WA 4AENB 3L3HB 4RWYL 4XCCL 3QJFA 5KJRL 2Z35B 2ZCHH 4H8WH 2WSKA 3ZDYF 1J12A 2GQHA 4M7ZB 1XF1A 2NX5E 1M6OB 1DQJA 1QQDB 4XNYL 3ARVA 1X9QA 4H0GA 2VC2L 4DKEL 4FQCH 5CBEB 1S7XA 1CS6A 2IEPA 4J3XA 4LARH 2XQBH 3G04B 3MRLA 2WINB 1CGSH 4Y5YC 4FTVB 1KC5L 2O5ZL 4X6BB 4XAWL 4CU8A 3T0WA 2X6MA 3VU2A 3RKPA 1QRKA 1P6FA 1RIVH 3WN5B 2YK1H 1RZFH 1PD6A 2V2WB 3V7AG 1KGCD 4U1SB 4I1NB 3LD8C 4RFOL 5SV4A 3D69B 4N9GA 4ZFZA 5KOMC 4Y1AA 4HK0B 4JFED 3VXRA 1BEYH 5F72S 2GTWB 4OZGA 4FFYL 3G08B 2A1WH 3HE6A 1D6EA 2PCPA 3KPMB 2PYEA 4ELMF 1KNOB 4YDVA 3F5WA 3RHWK 2VDKH 2GCYB 1N4XL 4I2XB 4QRRB 4JRYA 1JNJA 4MJ5B 3N50A 3UYPA 5DMIL 4NQED 3U2SB 1HCFX 2ZOLA 4FXKA 2X4OA 3UTSD 5E5RB 2OSLA 5I17B 3GHBL 1G7IA 3VXMA 2VLRA 4F3FB 1RIHH 3DO3A 3WKML 2J5LB 2V2XA 4M6NH 2DLFH 1QSED 1R3LB 3GMOB 4XPGL 3LHPH 1EV2E 3GJFB 1A4JB 4KMTH 1JF1A 4OFPA 1TCRB 5DFVD 5E8OA 3A6BL 3QPXL 3BE1H 3UPRA 3UZQA 2F8VA 4PB0L 3VFUB 3REWA 1FCGA 1K8IA 2W92A 1KN4L 5IGXL 1INQB 4KXZH 3EO1B 2C3XA 2F53A 4WI8A 3HZVB 3GK8H 2VDNL 1KBGL 5ICXB 5FO8A 4O51A 1OL0A 3RUGA 2ZP0T 3QQ3A 1MPAL 2ICEA 1MEXH 1TJIH 4KUCD 1FVCB 4M6ML 5KVMC 4AMKH 3AS3A 1HIMH 1RIUL 4YHKH 4Y88A 3QRGH 1F4YH 1NUNB 1QVOB 3RZCC 2VLMD 3LY6A 5FDWB 5C0AE 2HVKB 5B4MC 1KXTB 2Z31C 4K2UH 3SDAB 2VZUA 2V5RA 1I7UA 3SJVB 3X11B 1VACB 2Y5EA 1HEZA 4LKXA 4Z95L 1NJ9B 3T3PE 3GSXB 1AE6H 3UYRH 1CGWA 5CEZE 3D18A 4UAOC 4RZCB 2QQNH 5BV7L 3MYJA 5DUPH 5E00B 1FL5B 3LKPB 3ARFA 4RWHA 1PY4A 5D7LA 1MIML 4IRZL 5F44A 2D7OA 1P53A 2YZ1A 4Q0XL 3DMMD 2HRPL 4OGYL 5TQ0L 3T0ED 5BMFL 4FZEL 1UEMA 1W72B 1YMHA 4GMTH 4DTGL 3GJFH 1QBLL 5IESL 1CD0A 4TOYL 3M45A 1BQHB 4Z8FL 3MOAH 4JG1H 2CIKA 4OD2A 3RNKB 1TJGH 3H9SD 5FHBL 3I9GH 5DXWA 2A9NH 4JY4B 4P3CL 1FZOA 3UC0L 4JGJA 1A7NH 1G1CA 5KS9E 2PW1B 5M94B 1UXSB 1QEWA 5DJAB 1EGJL 3U0TB 4U1NA 1T0MA 3WJLC 5IVXE 2WNGA 1IGJA 3N85L 4XC1L 4ODBD 1LO2H 1KELH 5DZNA 4I5BA 5J06A 1T03H 3TV3H 3FONA 2R56L 2AJ3A 1MCKA 5KSBA 5HHQA 2VQTA 5AYQA 5C09A 5EH1A 4Q9RH 3O9WB 3WS6C 1NCTA 3P4NA 4ODSH 4JJHA 1IGIH 5I2IA 1KCRL 5JLZA 2CO7B 5C2BH 4LVOC 1X7QA 1VDGA 4RCAA 3GSRA 4PJBF 3QCVL 3ZDXF 4U1KA 1YQ2A 2WWKO 4N8CL 3QUML 3QAZC 3S6CA 2CRZA 4TNVK 3QDGB 4PGCB 4JDTH 4YHZL 1QBMH 2YA1A 3CVIL 4MX7A 15C8L 4DGIL 5HI5D 5L6YL 4S10A 3AREA 3GEWB 4X7DC 5IHUL 1CU4H 4R2GB 2AJZB 2HFFB 2CGRH 4PYHA 3A6CL 3BW9B 1FG9C 1DCLA 1YC8A 4HEPG 2HTLC 3AFLA 1KPUA 1TPXB 1ZT1B 2C3WA 4HS8H 5INCA 2VO5A 1HILB 1NDGA 1MRCH 4GRWF 3I85A 5C92A 3N1PC 4C4KO 2HG5B 4IIQA 2HT2D 4P9ML 1CLOL 4Q2ZA 5GRYA 1EBPA 1WSST 4X5XA 4MCZB 1Z9SA 1D5MB 1VGEL 2XXMB 1BFSA 3ETBF 1XIWD 1BQLL 1H9VA 5CLTA 3D39B 3KLSA 5I8KH 2DJSA 3QUXB 2I9LA 5H37H 3WYRA 3KYKL 4U2YA 5FIEA 1CICA 2ICWJ 4NJ9L 3HZMA 1NC4A 4S11A 1UJ3C 2BVEA 4EI5C 1VFOA 4PV8A 5A16A 3W39A 2R39A 1KJ2L 4MD0A 4KI1A 2PETA 5LG1A 1IM9A 2GJ6E 3MV8D 2W38A 4PGBA 4JGUA 3FRUA 1GHFH 3NFNA 1R24B 5CEYB 3MNZB 2IAMB 2CDFB 3AB0B 1ES0B 4YHPB 1XF4A 4LSQL 2ORBL 4KZDH 2VE6A 3DXAD 4R0LB 1WZMA 3SGEH 4DFHA 5KSAC 2QKIB 3NCCB 3IFNL 1RUAL 2X4NA 3CFBA 1LP9A 1H5BC 4U1GB 4HUUA 2MSPA 4F58H 3WL9B 4Z5RB 3EYOB 5IM7A 1CFQA 4PJ7E 3M8OH 1QR4A 4KK6C 1MHCA 1LE5A 1QA9A 1HZHH 2NTFB 2BCKB 4R4FL 3FFDB 3LRSA 2WBJD 4HSQA 1FC2D 1AFVL 2R4SL 3PHQA 4NO3A 3GSWA 3OR7B 1JRHL 3QJHA 3SDXA 3OGCA 4DW2L 4M62L 2MPAH 1B2WH 2P5WA 3H9HB 4NKQB 2Q6WA 2ATPA 3ABZA 5LAXB 4L4TB 4UT7H 3NCJL 3QNYA 5JMRA 4D9QE 2Q76B 4Z7QF 2PYFA 4X4ME 3PP3K 1CFNA 2XN9D 2ADFL 3B9KD 3FB8B 2OL3L 4KK5D 4W4OA 3T0BA 3VRLF 1YN7A 4PP1C 2DD8H 3FB5B 5B3JE 3D3VA 3QIUA 3SOBL 5MENE 3WO4B 2MNUA 3KYOA 1WT5A 5HYQA 1Q9OB 4Y7MA 1ZLVH 3RGVC 3GRWH 5D93B 4JLRA 4P2CG 2VXVL 3HMXL 4AK1A 1WAAA 1WZ1L 4UTAH 4JZNA 3ULSB 1MFAL 4GUPA 3MV9B 5ANMA 4OZIA 3MACH 5J9PA 4LCYA 5JHDB 2M2DA 1UH3A 2RCSL 3BH9B 5ISZE 1GYAA 4KHTL 2P8LA 4L3CA 4WU5A 2W1NA 3HE7A 4L4VE 5DF0A 5C07B 1JNNH 3W81A 5CSBA 4XP4L 3R1GH 2WIIB 5D7IB 1QACA 5CSGA 1KLUB 5EORH 3TNNB 5DQDH 4X80H 3MRIB 43C9A 1NFKA 4XH2B 3ARBB 1YEEL 4F33A 5HYJD 4K3DL 4FQPA 1YMMA 4MB4A 1CXFA 1F90L 3U6RA 1D5IH 4GAJL 5EZJA 2B4CL 5JXEC 3VGGA 4R9HA 4HCRL 5DC9B 2E7CA 3BKYH 1LEKB 4J6RH 5D1ZB 3QQNA 5DWUH 2P46B 5ACZB 3UTTD 4J4PD 1ED3B 4KJWC 4FG6D 3CH8A 1SEQH 2NY6D 5F7EH 5DQ9B 5SWSA 3OJVC 1GGCL 4KDTA 2VUOA 2E9BA 4NQUA 4U7MA 3MRRA 1RZJL 5GGUB 3QXWA 5E0QA 3ZTJG 4Z0XB 4ZAKC 3EDDA 4ZNEE 3TA3D 1S3KL 2BRRH 2MTPA 3CFJA 5CHNA 4X6CB 2EIZA 1NCBL 3S9DB 1K9TA 2EDYA 2CMRH 1IEBA 3TYFB 4Z7VE 4PTTA 2XT1B 3O4LD 4KVNL 3KHOA 4POYA 1U8IA 1CT8B 3SBWA 3BRDA 3MLSH 4OF0A 3S96A 1UB6B 2R1YA 3W9DB 4L1DA 2EDLA 2X4UB 4HS6B 1A6VH 3L1OH 3U46A 1I7TA 4CDHA 2FB4L 4HLZH 4KROC 3BGMB 4RRPG 1CXHA 4C57C 1TFHA 4XNMB 3BYYA 1HXYA 2PTVA 4NQCE 4WVRA 4P2OC 1MI5E 2LVEA 4K3HA 2VJXA 3OPZH 1QO3B 2RIKA 4GRLA 4L8CA 2VN7A 3C6LD 2ZPKL 1CF8H 4PJ8D 2AK4E 3QDMB 4R7NB 1HH9A 4I9WD 4HPOL 5CJBA 1FZJB 4JHWH 3S37X 1YNTA 5I18L 5ESVA 4OKDA 3MRQA 1CE1L 5JW5B 2UYLA 4DWHA 2O93L 3BX7C 4KXZI 3VI4E 1G7QB 4HFUL 5J6HB 1YEIH 3BP7B 1SVZA 1QOKA 1OVZA 1S9XA 3PWPD 5D5MB 1RU9H 3X13A 1IL1B 3BKCL 5H35B 2CLVB 2V2TB 4YDJB 4FQJL 4J3WA 1B6DA 4MDIB 3OJMB 5EU6E 4U7SA 5GZOC 1J86A 4ZYKB 2OZ4L 5FKPB 3RWFB 5FYLL 3NH7H 5BS0B 3O2VH 4GS7B 1OGAB 3TZVA 1ZHBB 3FQUB 5IIEA 4D9LH 1U3HB 2IQAA 5CS7A 3SE9L 1EO7A 4GW1A 4XBPB 2FO1A 2OXHA 3S37H 2YC1A 3WD5L 4DVRH 1OB1B 4PJHE 1NUGA 2K1MA 5MP6H 3FN9A 1IFHL 1H8SA 4J2XA 1KCLA 5L2JB 2R0WH 4ZQKA 3C60C 2ESVB 1LK3H 1FVDB 1E4KC 4PRPB 5H94A 2H1PH 4QXTB 3GMQA 1RZ8B 4PRAA 5LBSL 1LDPH 4XCFH 1MJ7L 1SBSL 4Y2OA 1XGRB 4U1MA 5KSVB 4NDMB 1ZHLA 3A0OA 5D2NE 4P2RB 2NR6C 4QHKJ 5GRZA 2H45A 4HWBA 4JKMA 4YDIL 4F7TB 5BQ7A 5DK2B 2BNQE 4KJQC 4TPRL 4KKBC 4HDIA 4U7KA 3HS0B 1PX4A 1L7TL 1FFPA 2DI9A 3CXHK 1TMCB 1KCUH 4P23C 4KK8C 4PY8I 5MERA 2W0LA 4JZOB 4P4KA 5E08L 4YHYC 2DQFB 5DJXA 3RTQB 1DEDA 3DRQA 1IAIL 3L5XH 2MCG1 3QNZB 3QHZH 3WJJA 1UVQA 2X4TB 4U1IA 4FABH 1I8KA 4D0DB 2F74B 3SDCB 1NSNH 4B50A 1D9KB 1FZMA 4LP5A 3AAZA 3VXNA 5KVDH 3C5SB 4PGJA 2NY2C 4H25A 5EFIA 1F11B 1KTLB 1SYVA 1S5HA 3ULUC 3GNML 5IHZB 5BZWB 4Y4KA 1LP9F 4GXVH 4LPVA 4MNQD 5EO0B 1W0YT 3QXAB 4Y19B 1YUHA 3LKOB 2VXQH 3VFOB 4W70A 2VKXA 3C8KA 2ICWA 1RZ7L 2QADC 3KHQA 4JHAH 1CDCA 2WZPD 4KDVA 2BMKA 4F15C 4KHXH 5DUMH 1BQSA 2C1OB 4OGAC 4PGEB 1MAML 2P44B 3WIHH 3HI5H 1T83A 3X14A 1F4WL 5LJYH 2IBGA 3AXLB 1VEOA 4QRUB 4D8PA 5GSRA 4LCCA 3MV11 5C8JB 1UG9A 3KVQA 4L3EA 1A1NA 5DD3H 5CFHA 2GITA 4M43L 1BFOB 3MMEB 2CXKA 3EYUH 2A6JB 3M17B 4K3JL 4L8SC 1KGCE 3RZCD 3TN0A 2EO1A 3Q6GH 2EC9T 2FYYA 5B4MD 2CJUH 4JFEE 3G5ZA 3ET9F 2R23A 4WV1C 4AIOA 4DKFH 2Z91B 1RZJC 1XCQB 2SEBA 4N90D 3QIBA 5SX5H 5JQHC 1MLBA 4UQ2B 1R0AH 3MUJA 4XP6H 3PL6A 2FECL 4OZIF 1OGTB 4U6XB 1U95A 2HTKC 4OZHF 1G6RL 4HUXB 3MJ7A 4NQEE 3WS3B 1KUMA 4PS4L 1G7JB 3J8F7 3JUYA 1LGVA 1FNGA 5A2FA 1IRAY 3LCYA 1LE9B 1P7KA 1KN2L 2UWEA 5JORB 2J8HA 3RVTC 4FQIL 1PG7W 4OCRH 3T4AA 1QSEE 2FX7H 5F8QC 4JHZA 1ZLWK 4OCXH 2BFVH 2BC4A 4U1LA 3BEVB 3GHEH 1R5WB 3SE8H 3V4UH 1DUYB 4J8RB 1DBJH 3V8CA 2YUVA 4ALAL 4TRPH 2JCCB 4KI5C 4G42A 1CLYH 3FO2A 4N5EC 3EOAA 2DQTH 3V5DB 2LV4A 1M71A 4NFCA 1QR1B 3BKJL 5E2UL 1T04B 3UBXB 5DI8B 1BD2B 3P73A 5CILL 5E2WL 5HHOA 2J8UE 1MWAL 3HAEH 4G7YH 1CDGA 3DVNB 4C83A 3NA9H 4PLKC 5J56B 5H8DA 2YN5A 1QLFA 5I1IH 3NBNA 1BFTA 2VXSL 1IZKA 3G6DL 4LGRB 1EIBA 2HA1A 4F37F 2VLME 3AY4A 3CVHA 4WI4A 4TULL 5FCSH 1PSKH 4NPYA 3TBVA 2GSIB 4JRXB 2HTLD 3MRPA 1KB5L 1SHMA 5IVNA 4XPHH 3O3DA 4HKBB 1RPQA 3VFNB 3QFDA 1HQRB 5I1GH 1G0XA 1N8ZB 3JTSA 1X6LA 3OXSB 3GSNH 1RHHB 1NCAH 2A74B 1LNUB 3FQRB 5IHBA 4KPHH 2XWJA 4HC1H 4K55A 4PJDB 4O58L 3CDGB 5E94B 2E9WA 2R4RH 2HH0L 1NAKH 1NCCL 1WUNT 5FF6A 1S8DB 4RISL 4H5SA 2YKLL 5EO9B 3NN8B 1UM4L 1T20A 3L3OB 4ZUUA 3BGFB 1FHGA 1KB9J 2AJUH 1ZLWH 4EI5D 3HFML 5D9SB 5AWNL 3H9SE 5GS1C 4XNZC 3FQNB 1YEHH 2UZYB 4J7RA 4PJ9A 43CAB 1A7BA 4GJTB 1UM6H 4BZ1H 1KOAA 2CKBB 3DNKA 3FB6B 3MXVL 5T3ZL 5JO5B 2GY5A 5EDXA 1DQTA 4JGMA 1CI5A 1YN6A 3BJLA 1I3RA 2WANA 5DHYB 1IKFH 4NO0A 3QCTH 4GMSL 4KTEL 3PWUA 3KJ4C 3DVIA 4ONHA 5FDYA 4PJIB 4LFHD 1I8MB 5JDSA 3RWDB 4KTDH 4WHYG 1RJYB 5IP4A 1DQQA 5AAWA 1ETZA 3RDTD 4APQB 3C09B 4JB9L 5D7JA 3WEXA 1XF3B 3TVMC 4JO1L 4KK6D 3T1FB 2Z31B 1TIUA 3Q1SH 3S4SG 5EU4B 3RWGB 4TSCL 2X5PA 2ARJA 35C8L 4S0TD 2AV7B 3AUVA 5EO1A 4R6UA 3L3HA 2DM2A 1JWMB 4JG0H 2HWZH 1PG7X 3CDFA 3MXWH 3OMZA 2Z35A 2ZUTA 3IDYC 5LWYH 2I24N 1P5UA 4HS3B 1DQLL 1QQDA 5I9QC 3X3GL 1IGCL 1FC1A 4PGZA 1AXTL 5DJYB 2RGSA 4LLQB 5I75C 3QFJD 2WINA 3WKNA 4PP1D 5C0GB 4FTVA 4X6BA 4S1RH 2D7MA 5DT1H 1EEYA 3O2WH 5ICYB 5AEAA 3CFKA 1AD0B 2A6DB 2VLJB 1UACH 4L29A 4P46B 4QRPD 5EC2B 3RGVD 4ZDHB 3O8XA 3X12B 2BVPB 4MVBC 1NGXA 2CKBH 4G6FB 3C08H 2XFXA 1BECA 3VJ6B 1MFCL 3LAFA 4XT1C 1NGPL 5K33A 1XGYH 2KBGA 3P77A 1I7ZB 1S78C 5FCUH 4HK0A 4PJ7B 3VGHA 1PG7H 3MOBH 3VG9C 5D70L 1I7RB 2N56A 3MV8E 4NN7B 1V3JA 4LKCB 3G08A 4MD5B 3TT3H 4IDLA 3GKWH 3O6KL 1KJ3H 5F7LB 4ZD3L 3RQ3A 3R0NA 3DXAE 3QA3B 3UDWA 3WSQL 4CRPA 1BBJB 2GCYA 5FO9B 4I2XA 5IROC 2GI7A 4QRRA 4ESKA 4MJ5A 2Z9TA 2BNRB 4QRTB 4OQTA 4YZFF 2X41A 2Q8BH 4YGVB 4XWOC 5MEOB 3U2SA 1FO0L 5JXED 4WFHD 3MBXH 1FH5L 2H26A 3KLAB 2WK2A 4E5XB 3BMVA 1OCWH 5I17A 3PQYB 4F3FA 4LASL 3BKMH 2A9ML 1U93A 2EDTA 4LCWD 5F7UA 4G43A 1B3JA 4L9LB 5HI3C 4KJWD 5T5FH 2BNUB 1AC0A 1R3LA 3SKNB 1UC6A 3LIZL 1A4JA 4XP1L 2CK0H 1AGCA 4BZ2H 1R6VA 2H8PB 2ZCKH 5IBUG 3QUYA 2VR9A 3FQXB 3HC4L 3TESA 2M1KA 1LO5B 1V7ML 3VFUA 4WNQA 4ZAKD 3GIZH 3IAPA 1QSFB 1KTRL 4BSJA 3EO1A 2XN9E 2YPVL 3UJTL 4JZJB 1WIPA 5ICXA 4EEEA 4WO4C 4NQSB 5ALCH 1UCTA 4K9EH 4XP9H 5F1SA 4XWGL 4YHOL 5JOFB 1NMCB 5EU7E 4X8XA 3C5ZB 1FVCA 4J3OC 4FFVC 2JELL 2R0KL 1MREL 4EI6B 5AD0A 1NCDH 1WFOA 2XTJC 3GBMH 5A2LH 1O7VA 1T1YB 5BZDA 5FDWA 1A7PH 4MJID 2HVKA 2NTSP 4KROD 3SDAA 5KSAB 5HHME 1VFAB 4AJ0A 4LSUH 3MRKB 3EOTL 5ITBL 4NP4L 4P2OD 3GSXA 4RGMB 3LN9A 1ZHNB 1DJSA 4M5YH 3UZEA 3MBEC 4Z0BL 1ZA3B 3C87A 2BVOA 1QPXA 1JTTA 1X4ZA 3SCMA 5HYJE 4GRMA 4QXGH 4GKSA 1ZVHA 4CMHC 5FB8B 4M7LT 2MHAB 4YXLL 5KJRH 2UWEF 5ABDE 4L8BA 1W72A 1KT2B 5IBLD 1A6WL 1XGUB 4P2QD 1JHTB 1BQHA 3ARSA 3MLRH 4XNYH 3RNKA 25C8L 2CLRB 3I50L 1RUPL 4NQVA 4JFDB 1ZSDB 4P48A 4IOFC 4FQXC 4U31A 5F6IB 1EHXA 1X5HA 4JY4A 3KAAA 4TVPD 5D7SL 1AJ7L 3ARGC 3VWJA 5GZOD 5DJAA 3U0TA 3CZFB 4CKVX 3RAJL 4FMFA 1U8QA 1H0DA 2DMKA 1OD7A 5HVFB 3HB3C 1NCWL 5FUCE 1J1OL 4M7JL 5FECA 5GGTH 2IPUG 1U8NB 2ZNXA 5GRUH 3PWLB 1HNGA 3NFPB 1K4DB 1F5WA 1JPFA 4ZMAT 3O4LE 1JI1A 1TQBC 1WLHA 1X3DA 2VLLA 4XCEA 2DL2A 5JQ6L 3KPRD 1JHKH 5HHPB 2NY3B 5DJ6B 4WRLA 3C60D 1PKOA 4JDZB 4FFYH 1ORSA 2Q86B 2UZIH 2HLAA 3VXQB 4YHMH 4BFGA 5EWIH 3VCLB 5C0BA 5D7KD 4P49A 2KPNA 5E2JA 5IFHL 2BVYA 1URLA 5J7CC 3U0PB 4XNXL 1J0HA 3IFLH 5DMIH 5M7QA 3VXPB 2F8OA 3HKFA 2G2RA 1JNLH 1ZT1A 4OCLC 1FYTD 2NR6D 1HILA 1SY6L 3LQAL 5C08B 2G60L 4Y16B 1DBML 1KLGB 2P8PB 1FCCA 5D96B 3GHBH 4JPWL 4KJQD 5EU6B 4KKBD 4I9WE 3K80A 5E9DD 1T66C 2F9BT 3PHOB 4FQ1L 3KWWB 4P23D 3U7WH 4HGWB 3D39A 3VGAC 3GKZA 2DQHL 3VFMA 4N8VB 5EOCJ 5IOPB 2DQEL 4GRWE 2GIYA 1Y18A 2P8MB 3PWPE 4V1DD 4DFIA 4F9PC 1FGVH 2N4IA 1PLGH 3K4ZA 4UUJB 1INDL 1CN4A 4NBXB 4Q74A 5I1HL 4PY7B 1EFQA 4LF3A 3K74B 1I1FA 2NY2D 4GAGL 5FOJA 5FV1L 5FGCE 3ULUD 4HX1B 5I0DA 3OAUH 2CDFA 1UEYA 4JFZH 5ENWB 5CSZB 2WUBL 3ZKSD 5HGAB 4LSVH 2AKRB 5IB4B 4P9HC 1RIUH 5I8CA 2QADD 1G7LB 2P5EA 3SDDC 5D2NB 2Q8AH 1YJDL 2XY1A 4DGVH 4Z5RA 3EYOA 4UDUB 4DAGH 1MJJB 3VXUD 1J1XL 4PJFB 4HUVB 4OGAD 3VFSB 3BPLC 4U0QB 2NTFA 2BCKA 3Q6FB 3S5LB 3FFDA 1JIBA 2Y72A 3P0VH 4LEXH 2O5YL 3ILPB 2EYTB 3FO0H 4OJFH 4P5TC 2GK0B 1CLZH 2Y06H 4EUPB 4ZOAA 1PW3A 2YWYA 4HIXL 3ZKNC 4F37K 4PRIB 4PG2A 1DSFL 4Q0XH 5DRNB 2HRPH 2Q76A 4CMMB 3BZDA 5BMFH 2QSTA 1MELA 2EH7H 3QCUL 3W82A 5K59E 1TZIB 3MA7B 5IESH 4TSBH 3VXSB 1NGWB 4Z8FH 3IVKB 2FH8A 4G80B 1BOGB 3FN0H 1VEMA 2H3NB 1Q9OA 1NL0H 1MVUA 4J3UA 5DJCB 3IDGA 3TBTB 4EZMA 4G7VL 2HTKD 4WHTA 5J1TC 2RAMA 2QSCL 4XC1H 3ULSA 1WBYA 2L4OA 2R56H 3QWOB 2YUXA 3K0WA 4OCYH 1HOCB 3BH9A 1NFDA 3MNWB 2OM5A 4WUUA 5C07A 4U6TA 5IB5B 1J8HD 4M7LL 5D7IA 2OTWA 3RVTD 1KLUA 3MA9L 2WBWB 2O5XL 1OHQA 3MRIA 2IH1A 3O3EA 2DMBA 4HBCL 4XH2A 4XVTH 2E6PA 1QTYT 4FQ2H 4MNQE 1A1OB 2H2PC 4N8CH 1OF2B 3H3PH 5IB2B 4IJ3C 1MCIA 3DVFA 4DGIH 5KAQG 4HQQL 3INUL 5E8PB 32C2A 4EUPH 4KI5D 4N5ED 4N0FB 4PB9L 3RWJB 3DVGA 5KW9H 3BAEH 2VXTL 1T1XB 3L5WA 5C70A 1J11A 4HIEA 4M93C 1LILA 3I84A 2EECA 1IQWL 3IJYB 1CLOH 4GQPH 4PLKD 3NPZB 1C1EH 5DJ8B 4S1QH 3SKMB 4XVJL 3DX6A 3CSYA 4Z0XA 4Q6YA 1J0JA 1FPTH 3PGFL 1WK0A 3B9EA 3LS4H 5FYLD 5GGRY 1SJEA 5B21A 3WDIA 4LHUB 5EUKB 4O02L 4HWUA 4TVPH 1TETH 4N90E 3K8LA 3RIFF 1JNHB 4CU6A 1JYVA 2D9QB 1B4JL 1UENA 2PO6D 3RI5K 3IETA 3D87B 1YPZA 1KIRB 3F65A 5HGBB 1J10A 3F7PC 1UB6A 4P57B 3RNQA 2GAZB 5DMKB 3PWJB 4O2CB 3W9DA 1C12B 5J1AB 4PUBH 2BOCB 2X4UA 3IS0X 4NN5B 3P11L 5CEXB 3IFNH 3QWRA 4E42B 5L9DL 3U79A 4YX2L 4XNMA 1MHPL 1KPVB 1AHWB 1UB5A 4XVUC 3C8DA 4LBEB 3F7YB 3VH8B 1S9WB 4NKIL 5ILTH 3NZ8B 3QXVA 2AJXL 3QRFM 3HG1B 4R7NA 3VWKB 1FNSH 3MJ9H 4X9IA 1S5IH 4Z7NE 5H2BB 3LQAC 1AFVH 2DB8A 4ZO9A 5JW5A 2XNAB 2FCBA 1KIPA 3WFCL 3E6HB 1XT5A 3GBNL 1CICC 4M62H 2K7PA 3Q5YA 5D5MA 3QYCA 3ULVF 1IL1A 4ZTPL 3BRFA 4LRNL 1QFWM 2V2TA 4RNRB 1KJVB 4YDJA 3TT1H 5DRXA 3BJ91 2QSQA 4MDIA 1QSZA 3GO1H 2ADFH 2X44D 3ISWA 4P3DB 3B43A 5BS0A 3U30C 2PR4H 1OGAA 5D2LE 1IGFH 2PXYB 5TE4L 3TC9A 1VFMA 3QZWG 1AD9B 2EDDA 2VXVH 3HMXH 1AKJD 1DN2A 3TPUB 4HIHB 4BFIB 1WZ1H 1OAZL 3ULUH 1A1MB 4ZOBA 2LE9A 2IADB 4H88H 1KIQB 1IZJA 1BZ7B 2ZUYA 1R3KA 3P9WB 4XP4H 4XMKL 5L2JA 4ODHL 1LO0L 1GOGA 2ESVA 4AEIH 3NIGE 4X5WA 5F8RC 3O0RL 1L9NA 4MVBD 1A22B 2IH3A 4PRPA 2WWMC 3U1SL 4QXTA 1PYWB 4URTB 5I16B 3DARA 3SKJH 1GAFH 1RZ8A 1U41A 1XCTB 3FQWB 4KVCH 1LD9B 4FQLL 4QOKD 4MCYB 2X05A 2J4WL 4I3SH 4JDVB 3GSOB 2VDPH 4Y4HC 5ID0B 1XGRA 1ACYH 4QYOB 1F90H 5KSVA 1P7HL 2AXFB 4X99B 2FWOB 1TJHL 4Z7UB 4H26A 1U8OB 2E7LA 4W4OC 3MLWH 4F7TA 4X4XA 4O4YH 1JE6A 5FUOH 3HS0A 4DQOH 1DLHB 2J12B 3O2DA 1OPGL 4OGXH 5DD0L 2NXYB 3RY6A 5IMMB 1EVUA 1Z6JT 4JPVH 4BH8B 4LLYA 1NGYB 4FXGB 1IGML 5ADPL 2NX5A 4OKVB 1XGPB 2FHCA 1BX2B 1RZJH 4XWOD 5KSUA 3IFOB 4ERSH 1KFAH 5L0QC 2IC2A 2F74A 3SDCA 3WNMA 5LQBL 1EPFA 1D9KA 5SWQA 5I8OH 3I6KA 3KPQB 3SE3A 3DO7B 1F11A 1T5WB 5D8JL 1KTLA 2DBLL 4LPXA 5HI3D 4BFBD 3SKOB 1HHGA 3PWVB 4UOJA 3T0AA 1XIWB 5DJDB 3L9RB 4DK6A 3KPOA 4OCSH 5E1HB 1RUQH 1ZT4B 4RAUB 1W0WB 4ZFGH 4G6JH 4CNIB 2IAND 3QXAA 1IILE 4Y19A 3LKOA 5EU5A 4ETQA 2JIXB 5AYUH 4UU9B 2LVCA 3VFPB 1P9MC 2DQCL 7CGTA 1KYOK 4HAFA 3RWIB 4Q6IC 5EOTB 3QFJE 4PGEA 3HI1B 4HHAB 1RZIA 4WO4D 2GEEA 4LVNC 4HUWB 3MRNB 4XPTH 2OK0L 3AXLA 2EXYC 1OTSC 4NGHH 4QRPE 4JAMB 4KDTC 2ZPKH 2XI9A 3AMKA 4FFVD 4OCMC 5C8JA 2APWA 5E6YA 2XTJD 5EBMB 1PKQE 4DN3H 1BFOA 3MMEA 3MLZL 2XWTB 1CDIA 4OFYD 3CLFH 5HHXH 4ELMB 5HJ3B 2BOBB 1ZA6B 2Z91A 3DSFL 2AJVH 3GJEB 4U6HA 2WWKT 2Y7QA 2WBJB 3BKCH 4WU7A 3MBED 2D7PA 4UQ2A 4NQDD 5IFAL 4PJAE 3PGDB 5DRZB 3ROOB 3DROA 3B3IB 3QEQB 3ZLQC 1FE8H 3D85B 3D2UD 4HUXA 1A6TB 1U8PA 1F97A 1NFDF 4JREC 1NEUA 1G7JA 1A9EB 2OXGA 1JPSL 3HPJB 4WFHE 3O4OB 3VFVB 1I9IL 4HPYH 2APBA 1RV6X 3T2NL 1G0YR 2YPLB 1I1CA 3SE9H 4C4KT 3IJHB 4LCWE 3WFBL 1VGKB 3QG6B 4GRLC 2JKXA 4JM2F 4IOFD 4UZGA 1I8LC 4FQXD 5J13C 4EBQL 5IMLA 4R26H 4PP2A 2ED7A 3ZE0E 5DHXB 4BUGA 4OUOA 4MNGE 3BEVA 5EIVA 1MCHA 3MTRA 5T3ZD 5C0AA 5BVPH 4MXQC 2A77H 3S8WA 3OKLA 5BJTA 1WVZA 4LRIA 4PJGE 5HHMB 4WCYH 4ISVB 1FSKB 1MJ7H 3UTZA 3VXOB 1QR1A 5F9OH 4NRZB 1UH2A 3PABA 5I74C 1TLKA 4NT6B 4LLMB 1BD2A 1ZS8B 1JGLL 1EBAA 5EPMB 3O6ML 2EC8A 4C56B 5DHVB 4YHIB 1NGQH 3DVNA 3PV6B 2FBJH 1T22B 3TZVC 5IJKC 2ZCHL 4H8WL 3L5IA 3QEHB 4AIXA 4QXWA 2W07A 4FHBD 4MJIE 1BIHA 4GOSA 2GYSA 1L0QA 1JP5A 1MCQA 4UIMA 2NNAB 5IB3B 5E08H 4I18A 5C3LD 2AP2A 4JRXA 5JPMB 5FM5M 4HKBA 3V7AE 1D6VH 1YPZF 3O6FB 2O26U 2MKWA 2XQBL 5E6IB 5TFSH 1RHHA 3NABH 4H1LB 4P4RA 5KS9A 2VH5H 3FQRA 3UJIH 1X5ZA 4PJDA 1T66D 4TUJB 3CDGA 1EFXA 5MEQA 4K7FB 5DD5H 4FFWC 1S8DA 5F9WC 4ZUTA 3NN8A 1S7UB 2YK1L 2H9GB 5F1KC 3WIIH 3QXUA 4P2QE 3MJ8A 1GZPB 1DN0B 1RZ7H 5IQ9B 5I71C 3FQNA 4YDLC 2XACC 43CAA 4JFXB 4TVPE 4DZ8A 5JO5A 3TYGL 2PYED 2A1WL 5KZCD 4YXKH 4RMSA 1MCOH 2R8SH 1F4WH 4NUGH 4WGVB 4P4KC 3T0VA 5T1LB 4JRYD 5FK9B 3L3JB 3D25B 1ZE3C 2K3TA 4D0CB 4PJBB 3RA7H 3MRMA 2AV1B 3SDDD 2ZKHH 4HZLA 2FO4B 2EE9A 1RJYA 2UUDH 4WTWA 4APQA 5H37G 3SE4A 1XF3A 4UDTB 1FBIH 1ODAA 1ONQA 3T1FA 3H7BA 2N7BA 4FOMA 1A4KB 3KPRE 4HGKC 1YYLL 5EU4A 3RWGA 3LKRB 5B38G 4Y4KC 4U05A 2AV7A 3W11C 2NZ9C 4PRNA 4P5TD 4ZXBB 3FAXA 5D1XB 3WDJA 5D7KE 4LSTH 3ZKND 4KMTL 2Z92A 3MCKB 1B0GB 1HXMB 4QHMB 3BE1L 4JM4H 4GRWB 4ZFOB 4F8QA 3NIFE 1G6RH 3JXAA 2ARWA 1DDHA 2YRLA 1FYTE 2DKUA 1C8PA 5DJYA 3OJ2C 4LLQA 3BP6B 2GJ6A 2GSGB 3DYPA 3VD3A 5BOZG 3GK8L 1T83C 5FGCB 5C0GA 5FFLA 5E9DE 2LAAA 1DANT 4LCCC 4HULB 1AD0A 2A6DA 5EC2A 1TJIL 4P46A 4YHNB 5JIIA 4ZDHA 3GFUA 4JFFD 1U92B 4HUKB 1CE6B 3X12A 1KPRB 3T77A 3GM0A 2FX8H 3ARGB 3CFEB 4YHKL 3QRGL 3TN0C 3DGCR 1F4YL 4V1DE 2W60B 3WV0A 3NMEA 5GSVA 4QHLB 4YC2B 2X89A 1Z9LA 4PJ7A 2W0PA 4K2UL 1OSPH 3I75B 4RGNC 1I7RA 2YD1A 3P0YH 3QIBC 4ZPTB 3GSUB 4OLVH 1LO4H 4MD5A 4YEEA 1AE6L 3PL6C 3CPLA 3QDJB 3UYRL 3QA3A 4WDIB 2ZOKB 1BBJA 2QQNL 5DUPL 3VRJB 3CX5K 2H2PD 3QZWA 2GT9B 1XZ0B 3BQUA 1AO7B 3QJFB 5MEOA 1F4AA 1RZKC 4NZRH 4MZ2A 3VXUE 1D5BA 4TTGA 1P7QD 4U0RB 3PQYA 1EA9C 4OUUB 4ZO7A 4H0HB 5DTFB 3MOAL 1UKQA 1XGQA 1MLCA 1KB5H 1YEFH 3I9GL 5J4MA 1MAJA 3S3PA 1J18A 1CZ8H 4YLQT 5F3BA 1A7NL 3MFGB 4D3CH 2KQMA 3MRLB 1ZLSH 1LO2L 2H8PA 1KELL 1T03L 3GIVB 3WDHA 2V9RA 3BDXA 3FQXA 5GJSH 2HH0H 1KSRA 4Q9RL 4MA3B 4JM2D 2X2YA 2YKLH 1NCUA 3F6LA 4L4VA 4WY7H 4ODSL 5FYKD 1IGIL 3FAWA 4JZJA 4YH6A 3ZTNH 5C2BL 5AWNH 4N9GB 4NQSA 4ZFZB 4Y1AB 3VXRB 4MGXA 5J1SC 4OD3H 4JFQB 2D0GA 3ZKXC 3C5ZA 2C4FU 2NQCA 3UEZA 1DP0A 4EI6A 2F5BL 4JDTL 3HE6B 1QBML 1D6EB 2PCPB 4HIJA 2UZXB 4Z77A 2E8ZA 3V6OA 2FR4A 4YDVB 1CU4L 2CGRL 2GHWB 4IS6A 2OR8A 4ZTOH 3RVVC 3V6ZA 3T08A 2D0HA 3EDFA 3IDXL 4OF5A 4OZFA 4UINH 4XVUD 1J8HE 4AIZA 4HS8L 1WJ3A 2ZOLB 1MRCL 2JJSA 1ZA3A 2OSLB 1G7IB 4EIGB 3VXMB 2VLRB 3CC5B 2XWBA 3T09A 3SQOH 2NXZC 3BPLB 2V2XB 1MRFH 3OWEA 1Z9MA 4NM4L 4NWUL 2MHAA 4ZNEA 1MFNA 1CICD 4KI5E 5E8OB 4HXAL 1DQLH 1XGUA 4LMQE 3OQ3B 1F4XL 4OFVA 5I30H 1JHTA 3X3GH 3UPRB 1G7PB 1R5IB 1AXTH 3FCTA 4Z7VA 3REWB 4PJ9C 4HLZG 1ZSDA 1CIUA 3AVEA 4QWWC 5BOPA 5EBLA 3OF6A 1N5YL 2DQDH 2F53B 3BOVA 1KXQE 1WWBX 3CZFA 1GHFL 4YAQB 2BZDA 1UWGH 4Z7OE 4O51B 3RWCA 1SMOA 2ICEB 4KZDL 3T2OA 2VRAA 3T3PF 4LDLB 5FYLE 1K4DA 1F6LL 4LNVA 3UO1H 4F58L 1FLRH 3V79C 2QJDA 1CXIA 2Y6SC 2EH8L 1SM3H 3IDNB 3MROB 1I7UB 5E56A 3DLQR 2AK4A 1UKTA 1HZHL 5DJ6A 3L5HA 3BI9X 4JDZA 4PJXE 2Q86A 4P9HH 1T1ZA 1RSFA 3VCLA 2WWMD 4UV7L 4M7ZC 4MD4A 4ZD3H 3WFHB 1YEKL 4JQIH 3MYJB 2MPAL 1B2WL 1MRDH 4DZBA 3ARFB 5D7LB 4Y4HD 3U0PA 3Q2CA 4UT7L 2NZIA 4DCQB 3VXPA 3RWEA 2GKIA 4TYUA 5KS9F 1DUZA 3BWUC 4KH2A 1VPOH 2ILLA 5IVXF 5L8JB 4RMWA 1U3ZA 3AM8A 4Y16A 2AK1L 1YMHB 2P8PA 2VABB 3D3VD 3C2AH 4A6YA 5EU6A 4PJEE 2A9MH 4KAQH 5KAQF 3PHOA 3KWWA 4XGZA 2NY7H 3O8XC 2EDQA 5HBBA 4HGWA 3GRWL 3TJEH 3MRCB 3WN5C 1QEWB 4N0YH 4U1NB 1T0MB 1HSBB 5IBTH 4UTAL 3OAZH 4XP1H 1IGJB 5IOPA 2WM0A 4I5BB 2P8MA 3FONB 3C5JA 3WUWB 2AJ3B 3MACL 4UUJA 2PTTA 1OSZB 3K4AA 2QSVA 5AZEH 1JNNL 3R1GL 2X9XA 3P4NB 1RAMA 3I2CH 1CFBA 5EORL 4HX1A 5DJ0B 2F54B 5DQDL 4PPTA 1X7QB 2X09A 3UDWC 4X80L 4K23H 3GSRB 5BVJB 4WWID 1Q0YH 1YMMD 4U1KB 2NLJB 1IAII 5E03A 5KVEL 3CFDA 2YWZA 5HGAA 2AKRA 5IB4A 3IRZA 1D5IL 3U0WL 1G7LA 1UZ6F 2V5MA 3IXAA 4M9OA 5D2NA 3AREB 1I1AB 4UDUA 4OQ1A 5B39G 3BKYL 1MJJA 3AS2A 4PJFA 4J6RL 2FEDC 3LVEA 5DWUL 3RVXC 1ZOXA 2BNQA 2J5LC 3KLDA 4R96A 3Q6FA 3EOTH 5ITBH 5D1QA 4QHUB 4N1CA 2Q7YB 1BVZA 2EXYD 1OTSD 5INCB 1W8NA 1SEQL 1X5JA 2GK0A 5F7EL 4IIQB 1QRNB 4OLYL 4X5XB 3S35X 4X9HA 4QOKE 1U8KA 4N1EA 1FIGL 2BRRL 4NN6B 3WFEL 3KPPB 5CD5C 1UKSA 2I9LB 3AGVA 3IS1X 2EZ0C 2CMRL 2AEPH 3HZMB 1A6WH 1IQDA 1AQKL 1NC4B 1NGWA 25C8H 4G80A 3I50H 1RUPH 5JXAH 1BOGA 3ZE1E 2IPKB 4MD0B 1CDBA 1A64A 2H3NA 1IM9B 3TBTA 1HCVA 3MLSL 5AZ2H 3DYMA 4PGBB 3FRUB 5FYKH 1CGVA 2DRUA 5L2KD 1PZUB 2VE6B 5GXBB 3PJSA 1A6VL 2YMXH 3LOWA 1N0XH 4XCNA 5F3HB 3SDAC 2DIAA 2HRLA 2X4NB 3MNWA 2DM3A 1LP9B 2R29H 4HUUB 5DVMA 1XF5B 3S35H 4GRLD 3FMGL 3OPZL 1OQOA 2EYSB 5IM7B 1CFQB 2FECI 1I3GH 4LGPB 1CF8L 2NMSA 1MHCB 1PQZB 1LE5B 2DN7A 2FH6A 4JHWL 2IANE 3LRSB 3V8OA 3OKYA 3PHQB 4NO3B 3IKKA 4GXUM 3GSWB 1T21B 1BQUA 4MXQD 1CBVH 4MA8H 3QJHB 3F6IA 4Q9QH 5B3JF 3OGCB 4JHBA 2P5WB 1FN4A 3DV6A 4XNXH 3RWJA 4GG6F 3QNYB 3JUZA 1HH6A 1WWAX 4XAKD 1T1XA 2PYFB 4G9FB 1JGDB 2PUQT 1MOEA 1CFNB 1HK6A 3U9PH 1J88A 4EKXA 3IJYA 3T8XA 3BIKB 2XTJE 3KPSB 3QIUB 3O2VL 5DJ8A 3NACH 4NO2B 3TZVD 1OW0A 3SKMA 4NQEA 3LZFH 4QHNA 4X6DE 3C2SA 5HYQB 4WI5A 4M9PA 1EHLH 5BV7B 3O9WC 2DQHH 4JLRB 1MY7A 4NNXB 4N8PA 4JZNB 1CG9A 2EEAA 4PJCE 2YOCA 3HLAB 4LHUA 5KOVC 3S37L 4CW1A 5ANMB 4OZIB 2DQGH 5J9PB 4IM8A 4OZHB 1F58H 5I1LA 5L0QB 4NQDE 1QSEA 3OB0H 1KLFA 4WU5B 3HE7B 5E8DH 5C0CB 1N5AA 2ENYA 2X7LB 1KIRA 5CZVH 3WFZA 2R0WL 4S1SL 3SDYL 1LK3L 5DMKA 3KS0H 4FFWD 1C12A 3HAEG 2H1PL 1ZKAA 1S7RB 4PRHB 4R2GC 1SJXA 3RY5A 4M8VA 5CEXA 5GHWH 1LDPL 4XCFL 4NNPH 2NY5H 4E42A 2XA3A 3BZEA 4TUKH 5CJXA 5GS2H 1TPXC 3U6RB 3RFZC 1N64H 5T1MB 4LBEA 2ZG1A 3F7YA 4M4RA 1IAKA 4HK3N 3VH8A 4LHJB 1DEEA 2GK2A 1LQSR 2P42B 2J8UA 2OP4H 2EIEA 3VWKA 3BD3A 5H2BA 1A3LH 4P4KD 5JPNB 2EXWC 3QUXC 3G6JE 2OJZH 5J11B 3HUJE 4MAYB 5T3ZE 4Z7VF 3QUMB 3CU7A 5CZXD 3L5XL 3MRRB 3QHZL 2HT4C 5IF0B 4FABL 2CD0A 3O11A 1KJVA 1NSNL 1BREA 2HKHH 3B6SA 5GS0C 1U3YA 5KVDL 1F3RB 4BA8A 4FZ8H 1QP1A 5CZKA 2AEQH 1RHFA 2V7NB 1RZGB 4JQXA 1IT9H 4OI9A 4P3DA 4DGYH 2IAMC 1IEBB 4HXBH 4Y4KD 3AB0C 3HI6H 2NZ9D 4PTTB 5DGQA 3F7QA 4GXVL 1VADB 1U8IB 3RPKA 3BHBB 4KWUA 4KGJA 4U1GC 3FRPG 4BFIA 3ARPA 4QGYA 1G7HB 2OI9B 3U46B 1I7TB 4I4WB 1T3FA 3EBAA 4KHXL 2DL9A 3TF7C 1E4WH 1KIQA 2QQLH 2FJGA 1YA5A 2AERT 2VLKB 3HI5L 3STZB 1MF2H 4M7LH 4XVSH 3MA9H 1KJ2B 3BDYH 1E0OB 2OX5A 4JRWA 4G8FA 3BO8B 5DD3L 1HH9B 1LEGB 3FQWA 4YK4B 5E6ZA 3EYUL 5ESVB 3TN0D 4JDVA 3GSOA 5CAYB 1NC2B 1S7WB 3RHWF 3Q6GL 3FT2A 2AXFA 2HFEA 2HJLA 2UYLB 5E2VL 3LKNA 4Z7UA 2CJUL 2HT3C 4YDKL 4DOHB 7FABH 4FQHB 1U8OA 1JGVH 4OZGE 4RGND 1DL7H 1Z2KA 1GJIA 2XV6B 3QIBD 4I48A 3X13B 2PYEE 4XPFH 3WO4C 1A14L 3PL6D 1P1ZA 5T1DL 1R0AL 5IMMA 4ZG1A 2D4FA 4XP6L 5D93C 4RMVA 3JWDH 5KG9B 1N59A 8FABB 1CXLA 1NGYA 3W5MA 1IC4H 2ZG3A 3EO0A 2AS5M 3F7VA 4PJHF 4OKVA 1NANH 2VR5A 1Y0LA 4BQ8A 5GISH 2EEDA 1OM3H 3IFOA 4HV8A 4XVJH 4N0CC 4OBRA 2IQAB 2EIDA 1F2QA 3CGTA 1TTFA 3SGDH 1T5WA 4GW1B 5IW3A 4G9DA 5D71H 2IWGA 3QHTC 3SKOA 3U36B 4OCRL 2FX7L 1XIWA 1PZ5A 5DJDA 1DBBL 3PHSA 4HG4K 1B4JH 3ARBC 5CBAB 3VD4A 4LLUB 2OL3B 2R2EA 3J7HA 1W0WA 4ORGA 4ZQKB 1RK1A 2BFVL 5CCKH 3KXFD 5IEHA 3E2HB 3SE8L 3V4UL 2JIXA 1DBJL 2J8OA 3KPLA 1KG0A 3UPAA 2DI8A 3EKCA 5HGHB 3GMQB 4TRPL 4R97B 1O0VA 4XMPH 3OKDB 1J9CT 3MV8A 4Y5XB 3RUGE 4U1MB 2MQCA 4YX2H 1EZVX 1DE4A 1ZHLB 5HHVL 4HUWA 3MREA 5E4IA 2ZCLH 4YBHA 2FEEI 2WUCH 4JAMA 4NKIH 3DXAA 4CUCA 4JFFE 4G7YL 3MRBB 1GPOL 3ZYOA 2GFBB 2HJKA 3ZE2F 3NA9L 5I1IL 2DOCA 1FFPB 3SEPA 4Y2DB 2IALA 2XWTA 4NBYB 3RKDC 1PSKL 3RJDA 5DJXB 3D0VA 2RR3A 3RVVD 4IMKA 4ELMA 2XQYK 2EO9A 5B22A 5HJ3A 2BOBA 1ZA6A 5TF1L 4FP8H 2WBJA 4U1IB 5I1GL 5JA9A 1I8KB 4LRNH 3MUHL 1ZANH 5BXFA 1FZMB 1NCAL 5DRZA 3ROOA 3AAZB 5DYOB 3STLB 4KPHL 3OAYK 3QEQA 4HC1L 2NXZD 4WFFD 1MFEH 1ZHKA 5C7XL 1SYVB 1S5HB 4RAVA 4YR6A 4DK3A 1Z0NA 3D85A 4ZUWA 2R4RL 1NAKL 5D6DA 4M48L 4M3JA 4XXDA 2XYCA 1GGBH 1KTKE 3VFVA 5B39A 1KULA 2XN9A 1YUHB 3B9KA 2YPLA 4UQ3B 2AJUL 3C8KB 2ICWB 1L9MA 4PJ9D 1YEHL 3H9ZA 3KYMB 4NFDA 2BMKB 4R7DB 1UM6L 4QWWD 4BZ1L 3FHQA 3LPWA 5J89A 5T3XD 4IRSB 1VERA 3AS1A 5CJOH 2JTDA 4NO0D 1CIDA 4WWKB 1IKFL 1AP2B 5KSBE 4WENB 3QCTL 4D8PB 3CSGA 4TNVF 4G5ZH 3O0RH 3FO1B 1MCBA 4HT1H 3U1SH 5HSFA 5JW3L 4L3EB 1A1NB 3BVNA 1JWUB 4HWBH 1DTUA 3MRGA 4ISVA 5FYKE 4KTDL 3V6BR 3VXOA 2CXGA 2GTZB 2Y6SD 1BOYA 4NKMB 3G5ZB 4XC3H 5IB1B 3QSKB 3BPOB 1ZS8A 3Q1SL 1YYMH 5EPMA 2BXYA 3LDBB 4C56A 5HYJA 2SEBB 3KDMB 5DHVA 4GS7C 1JBJA 3PV6A 3L7EB 1AQDA 4JG0L 3OKOA 2HWZL 3MXWL 5DD0H 3E8UH 1U3HC 3QEHA 3QXDA 4JQVA 3W2DH 2BY1A 5LWYL 3F12A 5IB3A 1UWXK 4ZSOE 3IF1A 3PNWA 4N9OB 3HNSH 4OD1L 2GW5A 3O6FA 2R1WA 2LTQB 1FNGB 5LQBH 4H1LA 4FTVD 3UTPD 1DBAH 2O61B 3I6LD 1P7KB 5FGBA 2UWEB 4GBXB 4S1RL 5D8JH 2DBLH 3O2WL 4TUJA 1NBZB 5CIPA 4WTZA 5IR1A 1UACL 4M1GL 3T4AB 1JZ4A 4PRDB 1QHPA 3GUTB 1F2XK 3V4PH 3TA3A 1GL4B 2CKBL 1S7UA 2VTFA 4LFHG 3C08L 2H9GA 3JV5A 2BC4B 3EYSH 4U1LB 3EHBD 5HPMA 3FN3A 1GZPA 1DN0A 4KUCF 5JA8B 5IQ9A 5FCUL 2J8UF 3UTQB 4OFDA 1T1WB 5L8LB 2E7LC 1PG7L 3MOBL 5TDOB 3CDYA 3GI8H 3JV0A 1P6AB 3BRGC 1VFBB 3RY6C 1Q94B 3W0WB 1KJ3L 1NBYB 4CGTA 3TO4B 3LPGA 4LLWA 4YHLH 5FA4B 5T1LA 3P73B 4P5KB 4QRRD 5FK9A 3L3JA 3D25A 3RVWC 1GGYA 1JUFA 2Q8BL 3T0XA 2EKSB 3LEVH 4PJBA 5IT2H 5F6HI 4HKJB 4KRMB 5EIQA 2FO4A 3MLZH 3JV4B 3SDCC 5I66A 1D9KC 3CVHB 3WMSA 2Y9RT 1B90A 4NPYB 1OCWL 1U8MA 3TBVB 2FEDD 3H7LA 3MCG1 3WCYA 2ZSWA 3C6LA 5I19L 3BKML 3RVXD 4PJ8A 3ECBA 3TLRA 2PKDA 3MRPB 1UWXH 4W81A 4AZ8A 3O3DB 3LKRA 3A67H 3K81A 4Y4FD 5T5FL 3VW3H 3JTSB 2EDHA 4ZXBA 3SDXE 2FD6L 2ZG2A 4YXHH 5D1XA 3VI3E 1RZKH 1A0QH 2ZCKL 1HXMA 2XWJB 1AGEA 2HLFC 4KQ4H 2K7QA 1SBBA 5CJQH 3GIZL 2DWEB 3AU1A 5FF6B 5CD5D 3MZGB 4H5SB 4K8RL 2CQVA 2W9DL 1MCWM 1QLEH 2GSGA 4K7PX 2EKJA 3MGOA 4ZUUB 3D3VE 4B7IA 1XH3A 4RX4D 5ALCL 4XP9L 1MCLA 1NLBH 4K9EL 1GRWA 4G6AC 5JW4N 1X6NA 1B9ZA 4YHNA 3VMOA 2Z0BA 1U92A 1CE6A 4PREA 3QNXA 5B3NA 4LDEB 1NCDL 4S0SD 3V52H 1OP5H 3CFEA 1YN6B 4K71B 1SVCP 1I3RB 2FHFA 2W60A 1L7IH 4QHLA 1A7PL 3SDAD 3SJVD 1Q9KA 1YEGH 5DVKA 3I75A 3DBXA 4ZPTA 3GSUA 3K4DA 1DQQB 1ETZB 5D7JB 3WEXB 5LGHH 5DO2C 3CVHH 2ZOKA 1YMME 4JN1H 3VRJA 4WW2F 4K7PH 2BXZA 2ARJB 5E4EB 4P99A 1XZ0A 3FRPA 1EH9A 1AO7A 1YNKH 2BX5A 4UB0H 3TJHC 5HYFA 2CR6A 4BQ6A 2YA0A 2Y25A 2Q3AA 4OUUA 3MLRL 4IEFB 5DTFA 1QSVA 4BH7B 5FV2A 2DIBA 4HUMB 4P0DA 1Y6KR 4U4BA 3IYLW 5LGJB 5I1DA 1NAMA 4OM1H 2EYRB 1UXWB 2MCPL 2ZUSA 1HHJB 3QQ9C 3L3GB 5DK0A 2J6EA 3GIVA 1EEYB 1KJMB 3JV6A 4B0MM 3CFKB 1U91A 4L29B 1F42A 3QT2A 3O8XB 3O9WD 4LRIC 5GGTL 4WI2A 1NGXB 4MA3A 5GRUL 4LLAA 4OLZH 1NEZG 1TVHA 2XFXB 1AXIB 2C3VB 3H8NA 5T3XH 1UQSA 4X7SH 3P77B 4EUPG 4M7KH 1CD1B 3G6AB 4JFQA 5IVZA 3DIFB 1JHKL 1NANI 3KLHC 5HVHB 4KKLC 3QDGD 3TYGH 2ICCA 2MJWA 2UZIL 5T1KB 3BSZH 4YHML 2C4XA 3MGTB 5EWIL 5T33H 5KTEH 4R2GD 5L2KE 1S7QB 1VESA 2CR3A 5LXGH 3SGDI 3IGAA 4R3SA 1TZGH 5EA0H 3PP4H 1B0RB 3NPSB 4TQEL 3IFLL 1JNLL 4LSPH 5DUBA 2NY1B 2H26B 2E6JA 5J57B 2A38A 1LWRA 4LVEA 1CFSA 1U93B 3CC5A 1IAIM 1YYLH 4G43B 4AH2A 3ZSTA 3FZUC 3D39D 3U7WL 2EXWD 3QUXD 5LVEA 1AH1A 3MCLH 4X8JA 2E9JA 3RPIA 1MWAB 1IGYB 3GJFK 1AGCB 3BGFC 4ODTL 4S2SB 3QUYB 1WZLA 1FGVL 2HT4D 1PLGL 3H6JA 1G7PA 1R5IA 4RQQB 3KPNB 4NKOB 4WNQB 4XAKE 3MR9B 5GS0D 3B5GA 2OJEB 2AXJA 2X70B 3QI9D 5EZOH 3GMPA 1VSCA 4V2BA 3TO2B 4YAQA 2IAMD 3QBTB 2Q7NA 3DX8B 3OAUL 4XI5C 1ULVA 5DZLA 2Y36H 4JFZL 3UX9B 1HDMB 3E6FB 3BXNA 1TDQA 4LSVL 2R2CA 5AD0B 3VDBA 1A6ZA 4X98B 4APQC 3C09C 2Q8AL 3SE4C 4DGVL 4DAGL 5BZDB 3V6FB 2F8XC 1CQKA 2VWEC 3K2UL 3IDNA 3MROA 1AXSA 3PDGA 4PIRF 3VE0A 3WJLA 3P0VL 4CVZB 3SKUD 4LEXL 3ZL4H 2C3GA 4OQTH 4EN3B 3BN3B 3FO0L 5FA3A 4OJFL 4BK4A 1CLZL 2ID5A 2BVOB 2Y06L 3WFDH 1F8TH 1MNUH 3SCMB 3WFHA 2E3VA 2HP4A 1X5IA 2DMCA 4L4TD 4JVWA 3ALWA 4GRMB 1MCNA 4GKSB 3T65A 4DCQA 4KZEH 1X5AA 5C6TH 2Q1EA 2HT3D 2R0ZL 4L8BB 2EH7L 4QTIL 1JF5A 2DLTA 3FT4A 2VABA 3PWNA 1H15B 4TSBL 3IFPA 4FMKA 5HYSG 4FQQA 1F45A 1E28A 1MH5A 3FN0L 4P46C 3HMWH 2VQUA 4NQVB 3EYQC 5C0RH 3LEYL 2A6IA 5I1AA 2FSEB 4K8RC 4PG9A 2A2QT 4DUVA 1NL0L 3QPQC 4GW4B 2XRAH 3MRCA 4QF1B 3VWJB 4YEFA 1HSBA 1AGBA 1U8QB 1H0DB 2JB5L 4K9EC 4UNTA 3MV9D 2IG2H 4TUOB 3X17A 4N0CD 3WUWA 5JHDD 4OCNC 3CH1B 4OCYL 1OSZA 3IXTA 3N1GC 5FECB 5C07D 4GAYB 4NN7C 1IKNA 4WI6A 2X4QB 4MQSB 1JPFB 4QRQB 4UBDC 2C1PA 4ENEC 1HHKB 1I3VA 5DJ0A 1FL6A 2F54A 1G1YA 1BBDH 3ARBD 1DLFH 2B5IB 2VLLB 4XCEB 3S36X 5BVJA 4XVTL 3BD4A 4FQ2L 2NLJA 4HJJL 4M5ZH 1WITA 5I1KH 3H3PL 2F5BH 1C16B 1ORSB 2HLAB 4EI5A 4MQTB 5C0BB 2JK5B 1I1AA 3TGXA 4XNQA 5D1ZD 2OQJB 3VMPA 5K9KB 3FQTA 5KW9L 4L9LC 1RJLA 3IDXH 1WICA 3BAEL 4LLDA 1FZKA 2JJTA 2G2RB 4QHUA 2Q7YA 5K9JH 1U6AH 1G9EA 4ZFFB 4HH9B 5JNYB 4UMGA 1QRNA 1UZ6E 4KRPB 2E8YA 4WFED 3IDIA 1W72H 2P47B 1C1EL 4S1QL 5E8EA 3WLWC 2DQIH 2FX9H 1S9YA 3RKDD 5JTWA 1RUKH 2JLLA 4NM4H 3RDTA 1FPTL 3TIEA 2VOTA 3KPPA 4NWUH 1HHHA 3LS4L 3S36H 3VFMB 5JW4R 3ULVH 4RGNE 4JZJC 1EEZB 1Y18B 4TVPL 1OWRM 3I6GB 4HXAH 1TETL 1F4XH 1M7DB 1FO0B 1NMCC 3KJ6H 1WC7B 4TSAH 1ZLVK 2HYMA 1CFVH 2IPKA 1GCFA 1SJHA 2FBOJ 4LF3B 3C5ZC 1I1FB 4PJ5B 3CK0L 3WE6A 1N5YH 4HMEA 1B6UA 3V6OC 2YD7A 1P4BH 4PUBL 1T2XA 3CXDH 1OARL 4B5EA 5F3HA 4AY0A 1LO3L 4I0PB 2CRIA 3QFJA 4XB7A 3MJGX 4RGMC 4Y5VB 1XF5A 5FEBA 5I8CB 2P5EB 1KB9K 2EYSA 5ILTL 1TVBA 5IEKB 3QDMD 4R4BA 2EH8H 4GLRH 4JFFB 1PQZA 2DLHA 1FAIH 1FNSL 3MJ9L 5EULV 1S5IL 3KXFE 5GGRA 1JHLH 4N0UB 2BVQB 4GO6B 4A2MA 4X0KB 1W8OA 5K59F 5SWZB 1T21A 2B1HH 3GI9H 4UV7H 1YEKH 3UJJH 4DUWA 3PXJA 1KEMH 4NC0B 5ACMA 3QP3A 3DPBA 4LIQL 4PV9A 1H3WM 3TT1L 5F6IC 4G9FA 1JGDA 5CGYC 4PJAA 2CO6B 4HWZA 3GO1L 1CGYA 4HKXB 2AK1H 3QO1A 3BIKA 2JJUA 5BS0D 3R06B 1OGAD 3KPSA 1J5OH 4NO2A 2PR4L 4RFNB 1EXUA 1IGFL 2XZZA 4OI7A 1U3HD 5ICZA 5EUOF 4GG6E 5DR5H 1MVUB 5DGRA 1NFIA 3IDGB 4NNXA 5E99H 2WAHA 3HN3A 4WHTB 5GS0H 2I25N 2LFGA 2DI7A 4PBVC 4X83A 3HLAA 5CUSH 1WBYB 5E2TH 4JO4L 2FL5B 3L7FB 3ULUL 4JO3H 3BD5A 4KKNA 4OZHA 5CGTA 4H88L 2NY3C 1NFDB 3ROLB 3D6GA 2X7LA 4WUUB 1RQ5A 2ESVD 5C0CA 3BEWA 4WFFE 4QY8A 5DK3A 4AEIL 4BK5A 1YY9C 2OTWB 1WV7T 4PRPD 2CUMA 4IRJB 4JCMA 1S7RA 2IH1B 3O3EB 4PRHA 4ZAKA 2XZQL 3SKJL 1GAFL 1EGJA 4KVCL 3O6LH 5KVEH 1XMWA 4JM2B 1FNEA 4PJGA 4I3SL 4DN4H 1EAPB 2VDPL 2VMFA 1GXEA 1ACYL 4GG8B 1X44A 5I6XB 4P2RD 4YFLI 3U0WH 5T1MA 1N6UA 2BY3A 3FFCB 3SGJC 4Y16C 4M1DH 5D96C 3MLWL 32C2B 1D5ZA 4UILH 4O4YL 4OLXL 5CWSA 4G8GB 5FUOL 3DVGB 4DQOL 5CD3A 4OGXL 3T4YA 3KYNB 3WO3B 3L5WB 1N6VA 1ZTXH 4HIEB 4JPVL 5JPNA 2B0SH 3RTQD 4OZ4A 4MAYA 4MJIA 3RVWD 3QUMA 4OLYH 3IJSB 2X9YA 3OXRB 4ERSL 2HFTA 1KFAL 5IF0A 3SDCD 4MYWB 4P2OA 3DX6B 3CSYB 3IU4H 1D9KD 1P4IH 2D0FA 1FIGH 4POZC 1MFDL 3WFEH 2A0LC 5I8OL 1NLDH 3RZWA 1MCDA 1SJEB 2WP3T 2V7NA 1RZGA 3K3QA 3MUZ1 2E27H 3HRZA 1TQCC 1AQKH 5FHAH 3P3YA 5F71A 3I02B 4OF6A 2JE8A 3MZTA 1TTUA 4OCSL 1VADA 1RUQL 3S7GA 3IETB 4ZFGL 1JVKA 1YPZB 4Y19D 4OIBA 4G6JL 1S9VB 3BHBA 2HLFD 5HGDB 2VERN 3RNQB 3LH2H 2P45B 4P2QA 5D2NC 4HF5L 5AYUL 1GSMA 4RGOH 4ZUSB 1G7HA 1I9EA 5AUMA 5CMAB 1I4FB 2APVA 4I4WA 4B7LA 4Z7NF 3BP5B 4FTVE 4YO0A 3UTPE 2VLKA 3I6LE 5F9JA 2AEWA 3STZA 4XPTL 1J87A 1UB5B 4G6AD 2MMXA 3FMGH 4NGHL 1KJ2A 3GMNB 2DWDA 4GFTB 3NCYS 3BO8A 4KC3B 1JPGB 1LEGA 4DN3L 5FGSA 4NZTL 2B1AH 1NC2A 1S7WA 5IBUB 3CLFL 3S3JA 2Q3ZA 4ZO8A 1KIPB 4FQHA 5HHXL 4U3CA 3L5JA 5ECJE 1CVRA 2GJJA 5JR1H 3KPRA 5D2LF 2AJVL 1A47A 5B8CB 1QFUH 5C0EB 3MUY1 1KACB 5DRXB 3EJJX 3S3SA 5DO2D 1U8LA 1A9BA 1HHIA 1E4KA 4ZS7H 3DUHA 5KG9A 3DHMA 2D03H 4HUNB 8FABA 4I2XE 3DWTA 4QRRE 1FE8L 3U82B 4I77H 1HYSC 3CNKA 1OT2A 3TJHD 1ITBB 5ID1A 1C7SA 2P7TA 4HPYL 1C08A 1OAYL 2C7UB 3NIGF 1MHHB 3PF2A 4KJPC 3VXTA 3U36A 1KF9B 1FJ1B 4NJAH 4R26L 4P23A 1EJOH 5CBAA 2D7TH 2BSED 4LLUA 2OL3A 3QQ9D 1R3KB 4JY5L 1AY1L 3HR5B 3UPCA 2BERA 4S1SH 4V1DA 3SDYH 2VXUH 3OTTA 4X5WB 3MQIA 5BVPL 2IH3B 2A77L 4LVHB 5HGHA 2DYPD 3NAAL 4WCYL 2Z8RA 3OKDA 5TDNB 5HYEA 4WW1B 4Y5XA 4P5MB 2OMNA 4CDGC 1T7YA 3H0TA 5F9OL 5HYSA 3RIAK 1INEL 4H26B 5C0NC 4LAJH 1BD2D 3TFKC 1RY7B 2IFFH 4X4XB 1MJ8H 3MRBA 3MV7D 1V3LA 2GFBA 1NGQL 3TIDB 1SJVA 1V3KA 2FBJL 4FNLH 4Y2DA 1TENA 5BO1H 4KKCC 2I27N 4V2CB 1FLTX 4LLYB 3SJVE 4JRXD 2FIKA 4NM8H 2NX5B 2W9EH 3VXUA 2GJZB 3ARUA 5SX5K 5KSUB 1D6VL 3FL7A 1L0YA 1UA6H 1N7MH 2AJSH 4EDXA 5FXCH 1F3JA 3QH3B 3ZE2E 1K3IA 4HCRA 4K94C 1WWCA 5TFSL 5DMGC 3NABL 5SWQB 5FM8A 1WBXA 2VH5L 5DYOA 3STLA 3I6KB 3UJIL 3FT3A 1T2JA 3FZUD 3MLTB 1HHGB 4L8SA 1VA9A 5DD5L 3MUGB 1HSAA 5D72H 1HWGB 4NN5C 2QEJA 3KPOB 3B9VA 1T2QH 6FABH 3OKEA 4U49A 5CJXC 2Y23A 12E8H 3GGWB 4ETQB 4WUKH 5EU5B 1DVFB 3WIIL 4UQ3A 1AHWC 3PGCB 3QEGH 2BK8A 3KYMA 4R7DA 4JKPH 3LMJH 1QYGH 4UTBH 5SV3A 3IB4A 5E70A 3VWKC 5C71A 4IRSA 1RMFH 4LSSL 4YXKL 1RZIB 1MCOL 3U4EB 4XI5D 2R8SL 4NUGL 1JMXA 4LL9A 1GIGH 4WWKA 4XBGA 1AP2A 5DURB 4ODVH 5L2KB 3R0MA 2IPTH 1CGTA 3FO1A 3MLPA 1JWUA 4LAQH 2CPCA 1FAKT 3RA7L 4PJAF 2ZKHL 3U4BH 3ARRA 1UZ8B 4APQD 5FO7B 1J8HA 1A7RH 2GTZA 5E2VH 4OV6F 3QEUB 4R8WH 1FBIL 2Z31D 4NRXB 4YDKH 4NKMA 1ADQA 4M4PA 1E4XH 5IB1A 4CADA 2N1KA 4MJ4A 1OAUL 2N7AA 4QRSA 1JGEA 3QDGE 3DURA 3KDMA 1I85A 3VD9A 3B4NA 3FO9B 4U6HB 4YWGL 2Y7QB 3H3KA 1N6QH 3L7EA 4WU7B 1AGFA 2V17H 3SGEI 1A14H 4X6EA 2H32A 2PXYC 2VQ1B 3D9AH 5T1DH 5DVNA 4LSTL 1D3CA 1T5XB 2ERJB 3DROB 1MCEA 4JM4L 2MFNA 2VISA 4ODXA 4HW6A 1UM5H 3QIWB 1T7ZA 4PD4J 1CXKA 1U8PB 3ZE0F 5DVLA 4GLRI 2XZCH 3K1DA 1DBKH 1WFNA 3UTSE 5C0FA 3RBGA 1YECH 4HBQA 2O61A 4I0KA 5EBGA 4E41D 4GBXA 1CGXA 5EOCH 2VLJD 1T0NA 4P46D 3U7YH 3EYQD 1JJUA 1NBZA 3D39E 4K8RD 4PJGF 2V7HB 3MLXH 4PRDA 3AMLA 5IMLB 3GUTA 1DBBH 3QPQD 4PP2B 1OTTC 4YE4L 4G6FD 2ATKA 2FX8L 1PAMA 2NY4B 4XPAH 5J6GA 2OZ4A 3TNMB 4LK4A 2VDQH 4ONGH 2IBZX 3UTQA 4F8TA 5C0AB 1T1WA 5TDOA 1OSPL 3R8QA 3KG5A 5F7WC 3OKLB 5BJTB 2PO6A 2Z93A 4M1CC 1SMAA 3P0YL 4JCLA 4UBDD 4ENED 1Z9OA 4OLVL 1LO4L 1VFBA 3UTZB 1N3NA 5J3HC 1M1SA 1Q94A 2NXYC 5HHVH 2ZUQB 3EDJA 3W0WA 3PABB 1NBYA 2X1OA 5GJTL 5A2JH 3TO4A 2VIRB 5FA4A 4P5KA 3LS5L 2BNRD 1JV5B 5FOBB 1GPOH 1P2CB 5C0DA 1FVEB 2EKSA 2VDLH 4HKJA 2P49B 1RJZB 3JV4A 1U42A 1U58A 1WIOA 4NZRL 1R3JB 4X6FB 2W59A 3PQYD 4MDJB 4UIMB 4MB3A 2HT2C 4I18B 4LQ1A 4ZFOL 3P9MB 3BISA 1YEFL 5TF1H 1XIWC 4UI2A 1CZ8L 5TF0A 1JN6B 3DRTB 4D3CL 2OMBA 4P4RB 1ZLSL 3ZHKA 5KS9B 2YSSA 1JYNA 4L4TE 5IVXB 3WLWD 4HAGA 5C7XH 5I1JH 1H3UA