3G5XA

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
b'DILMTQSPSSMSVSLGDTVSITCHSSQDINSNIGWLQQKPGKSFKGLIYHGTNLDDEVPSRFSGSGSGADYSLTISSLESEDFADYYCVQYAQFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 806 light chain
molecule tags Immune system
source organism Mus musculus
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
total genus 49
structure length 214
sequence length 214
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5xA01
1OVZA 2NMSA 3MV11 3OJMB 2VABB 5CJQH 4NSKB 4NWTH 1M71B 1KG0B 3B5GA 4HUUA 2OSLB 4P59L 4AH2B 1RJYB 2IC2A 1A5FL 3IVKB 4FABH 4PJCF 1CFNB 3VXQA 1PKQA 1D5BB 4XVUC 4QXTB 3B9VA 1UACH 3S96B 3VRJA 3EJZC 2DQHL 5K9QI 4GW1B 4EOWH 1RJCA 4XXCA 4ZFOA 5GS1B 2ZCHL 4HWEH 4FNLL 5HHOD 4Z95L 5GS2D 1LEGB 1SEBA 4Y4HD 4P46B 4GS7B 3EYQD 3K4DA 4Y4HB 3SJVD 3ZE1E 5A2LH 2VXSL 3L3OA 3WSQH 5BRZE 3S4SA 3RDTC 4MD5A 1CL7I 4S0TD 5GS0H 2AXFB 5CZKA 3JV5A 4FFVD 1WGOA 3WN5A 3DO7B 3L3KA 1A6WH 4Y5XA 3HE7B 3QCUL 1F6FB 3F58H 5BW7C 1WZ1L 3BHBA 4W6YB 1D5MA 3V7MA 2BHUA 4OTXH 4C56A 1OSZA 1BBJA 4U0RC 4NQCD 1YY9D 1ACYL 4G6KH 2WWKO 3I2CL 2NCMA 4E9LA 1Q1JL 4CDHA 1IT9L 3QDJB 1KEMH 2EDNA 2Q8AL 5FDYA 4D94A 3DURB 4YDJB 3MBEA 3Q6FB 2VDMH 1BWWA 3LQZA 1RZIB 4TTDD 2HTKD 3HMXL 4NKMA 1IQDA 1ZXQA 2VR4A 3KPSB 5GISH 3MLSH 5D70H 2XV6B 4X6DB 1IT9H 4PGCB 1MCPL 2BSTB 3CMOH 5EIIA 3OZ9L 2OMNA 4NCC1 4LMQI 4AG4L 5DFVC 1J1XH 3T04D 5JA9A 3BD5A 5JXED 5EOCJ 5D7JD 2BERA 4KROB 1WBYA 1AGFB 1XR8A 4PJXA 2DICA 3ARGA 3Q5YA 2F54D 4UB0H 5CCKH 1JIBA 1TCRB 1T7WA 1T7ZA 1QBMH 2AV1A 3MOBH 3MV9B 4MQ7B 4WDIB 5AZ2H 3N50A 1CFBA 4YHNB 2FL5B 1U8MA 4DZ8B 1PSKH 1EJOL 4YBQC 3WIFA 3BRGC 1KXTB 2NW2A 1FLRL 3FT4B 4NQCA 2Y9RT 1ZS8B 3FAXA 4FQLH 4I0PD 4F3FB 3V9FA 3QCUH 4XNZB 5EO1B 1UWEL 3DVFA 2NTFA 1ADQA 5TGBA 4YGVA 5MI0B 3DRTB 3O2DH 1Z5LB 3CDCA 3BZ4B 5H94A 1DBMH 3P0YL 2VLJB 1K2DB 1OLLA 4BYHA 2X4QB 2OTUA 1WITA 1EAPB 4NC1C 4QCIB 1NC2D 3FFCE 4GMTH 2CKBB 1UG9A 5BZWB 3HUJE 2HLAB 4HT1L 2F53E 1DQQA 2D7OA 3O3UN 3QR2A 5IG7B 4LFHG 3EYSL 5ETUA 1VKXA 3QAZB 4H1LG 5TDNA 3NCFB 4YHIA 1YMMB 3JUYA 4Z77B 3HS0B 2A1WH 5DYOA 3WDHA 5KSVA 2UYLB 5ETUB 4LHJB 1EJ6A 4PJHA 3VFSA 3GKWH 3KPQB 1X7QB 1OQXA 1DCLA 2YS4A 1FIGL 3RBSA 3RVUC 3IDJB 3PHQA 4RCAA 3REWA 2AEPH 1PGRB 4GRMA 1AE6L 3QIUD 1S9VB 4CU6A 4F9PA 5D7LA 4KWUA 1WFOA 5L8KB 4D3CH 5ID1B 2DLTA 4PRBA 2XZCL 4QRRE 2ZUQB 2BY2A 5IW6B 1QFWI 5F1NA 1T0MA 4KXZH 1L9NA 4JFHD 2R0WH 5KG9B 4I1NB 2P7TB 3QRGH 4KHTH 1DLFL 1ES0B 5E8NB 1T89A 3P4OA 4PJGA 1I9RL 5C1MB 5ADOH 1IEAB 4GRWB 4Z7UA 5HHPA 3U4BH 2ITCB 4WW1B 5I1IH 3CPLA 3H7BA 3TPUB 3HNTL 1F42A 4FQCL 3P9WB 4ODTL 5J13C 3VD7A 1UACL 3LHPL 2AGJL 2X7LB 3WKML 2GJJA 4IBLT 1R0AH 2VZ1A 3KJ4C 1R6VA 3QI9A 3IXTA 1HKLH 1BIIB 2J88L 5BV7B 5L2JA 3ULVH 4PR5B 5J3HC 3IFOB 4NO0A 2BVPB 1F11B 2XTJC 3RVTD 3NA9H 2HT3D 3G6JA 5A40E 4I0PC 4YDIL 1MCNA 3QNYA 4JGUA 4JZJA 5AG8A 1BBDL 5FGBA 5GS1C 5BJTA 1YECH 4X6CA 5E08H 1JGDA 2EIZA 1C7TA 2J12B 4JRYA 5E2TL 3E3QE 3RU8L 2DLGA 5E4EC 2HA1A 3MV9D 2XA8L 3FB6A 1N5YL 5JO5A 4H88L 1C12B 3DXAE 1CF8H 3GMLA 2AEQL 2DLHA 2H26A 3BPNC 3NIGF 5BRZA 3B2UD 4XAWL 3EHBD 2V7NB 3GRWH 4IRSA 5JHDD 4X6FB 2BSSB 1CGSH 2EDYA 1J1OH 4BUHA 3T8XB 3KS0H 4FS0A 4Z7VF 2G75B 3VG0L 1QBLL 1MIMH 1BBJB 5ECJE 2GI7A 2R0WL 3PWJA 4R90H 4O2CA 4L8DB 3T0VA 1CS6A 1J0ZA 3M17A 3KPSD 5ISZB 1RURH 1BJ1J 1GGUA 1U95A 1MCBA 1KT2A 3AY4C 2Y7QA 2OM5A 3O6ML 1JPSL 2EDBA 4JANB 1UB6A 4X9GA 3VG9B 4DGYL 4R4BA 4X7TB 4KUCD 3ZKXB 4KZEH 3JWDC 4P5TC 1J8HA 1KF9B 2ADGA 1Q94B 4ZYKB 5D1XC 3CXHJ 3H9SA 4WCYH 3FN0L 1WZMA 3PABB 5F3HA 4DZBB 1KSRA 4NKMB 2A83B 5EULV 3HHRB 2Z4QA 3LD8B 2X4UB 3I75B 3MRIB 4G9DB 1L7IH 25C8L 4MQXC 2QR0B 1HH6A 5DD6A 4GRLC 3C6LB 4JDZA 2P48B 1DBBH 2DJUA 1JGLH 2R8SH 3TBSB 4RA3A 1MQKH 5E1HB 1ZT4B 3X14A 1J5OL 1DSFL 3G04A 3MV8A 3RKDD 5IR1B 3WBDA 5BOPA 2WZPD 4W6XB 4XAKE 5JHDA 4QXUL 2MPAL 2FIKA 4N0UE 3PP4L 4P46D 2X4SA 4OT1L 2N4IA 4N1EA 4PJEA 1XGTA 4KUZL 4NZTL 5DF0A 3OJDB 3S4SG 1YMHB 5CUSL 5C70A 3CD4A 3O3DB 3UEZA 3CFEB 3OJ2C 2X70A 2XACC 4R2GC 1M4KA 4M61B 4YC2B 1G9EA 3P0VH 4KDTC 3V79C 1LO3L 3CGTA 2FEEL 2HTKC 4TUJA 4XI5D 2C9AA 2WLYA 5L8LB 2X1XR 4G6AC 3AM8A 4U7MA 4JRXE 4LCUA 1G9MH 3HC3H 4M9PA 3DX7B 5TE6H 4CU8A 2Y5TA 1EFXB 5C6PB 3BKCH 2AEQH 3IB4A 3ZHLA 3MXVH 2CRZA 3HC4H 5FYLD 4P49A 4RIRB 5KSUA 1HSBB 4G7YH 2EDRA 4YDKL 3SY0B 1F8TH 3KPNB 5FOBB 1TIUA 2X4PA 3UDWC 1H8OA 3GJFK 4NT6A 3UYPA 4LVHB 2HJKA 2V2TB 2J6EH 3GZKA 1YEKH 5E9DB 1NFIB 4A6YA 3VXNB 4PRPD 1MCFA 1A0QL 1IM3B 1CLYH 3GSRB 1FGNL 1ZHKA 3B5HA 3T8XA 1X4YA 4OI8A 2VDRL 4XPGL 5ITFA 3DIFA 5TDOB 5DSCB 5IMLA 1A4JA 4WJ5B 4TVPL 1KPVA 3HFML 3WCYA 5GGUB 3U9UB 2NY1B 4OFIA 1N3NA 2QV2A 4TNVK 4W70A 4EUPH 3AU1A 1BX2A 1NFKA 2CK0L 5D2LF 3WNOA 1ZA6B 1IGYA 3BMWA 3EFDH 3FQWA 3DRQA 4S0SD 4HCRA 4Y4HA 1JBJA 4LLMA 4P5TB 2MKLC 4WHTA 5D1QB 1KLFA 1IFHL 4AENB 1HILA 3VXSB 3PQYA 5IQ9A 1FFRA 4FQHA 3BGFB 2LABA 1ETZA 5C08D 2DLFH 2HJFA 3QI9B 4Q9RH 3DNKA 3AC0A 3IETB 3JVGA 4M43H 3NTCH 1I9IL 3TZVD 2P45B 2L0DA 3N85H 4OZFA 3MRMB 4PRPA 5MENE 1JTTA 3IDJA 5JW5B 5E70A 1FL6A 4HXBH 5KSBB 3ELAT 5D6DA 5EWIH 5AAMA 3VFSB 2VDLL 3KPRD 2R39A 3BDYH 4UNUA 3ULVL 4NC1E 3S36X 5E8EA 1T03L 3TO2A 4DTGL 3X13B 3MA7B 3DSFH 5HI4D 4OGYL 3SKOB 2DWDB 3BW9B 3ZT7A 4RQQB 2IF7A 2BC4B 3LV3B 3QXUA 2DTSA 4KQ3H 5CGYD 4OUOA 4WTWA 1J7VR 1FIEA 1U8KA 5FUOH 5DD5L 5MEPB 1T2QH 2JELH 5F21B 4PRAA 3K3QA 2IALB 1B0GA 1T0MB 1I9RH 3ARFA 3VXUA 1JWUB 5GZNC 4Z7QF 3GJFA 2WK2A 3FO9B 5C0FB 2HT4C 15C8H 2OYPA 5ICYA 1UWEH 4UQ2B 4K8RC 3BSZL 3ARFB 2IJ0C 2NXYB 5D1XD 3WO4B 1Y18A 4LQFL 2D0GA 3VXPB 3MRJA 1PSKL 3D5OF 3S96A 2VDQL 5FA4B 4NQVB 4XVSL 2JIXA 4QRTB 3UTPE 1SJHB 3U7YH 3KPSE 4UB0L 4DEPB 2VZUA 5DEGA 1F3JB 1TZIA 4Q9QH 1S78D 2VABA 4U6YA 4PP1C 3RWCB 1QRNA 3CH1B 3HFMH 5H94B 3U46A 4MA3A 4NRZA 4P2OD 2NXYD 4MDIB 5JLZA 2V5TA 2H32A 5IHUL 4X5WB 4YBLC 4OKDA 3QO0B 2PXYC 4FQ1H 4KGJA 1MFAL 5CINH 1JHKH 3WXVH 1XF5A 4GW5A 5JPNA 3U36A 2D0FA 1LEKB 1QFWL 1JGEA 3V4PH 2WBJC 4KTEH 2AJUH 2Z93A 3EKCA 4DFIA 4YK4C 3TIEB 5SWQB 3L7FA 4H26B 2BVOB 4APQA 1EVUA 3V0AC 3GRWA 2W9DH 3JTSB 5J6HB 3ULUE 4XCCH 2R1XB 3V52H 3DSNA 4N0UA 4LSDA 4HS3A 5KN5A 5J12B 1J8KA 2W9EH 3QUXB 4GAJH 4ELKB 2YUVA 3EW3B 5J6GA 2JKXA 4QT5B 1L6XA 1GGCH 1P2CA 3L6FB 4KV5E 2Y7QB 2AQ2A 1YEHH 4W4OA 1KTLB 5JQ6H 3MRCB 4KJQD 3HG1D 1IAII 3ARDB 3A67L 3WL9B 5HYSA 3DETC 5FO8B 3FOMA 1CD0A 3DURA 4YDJA 2ZCKL 5DJ2A 4IM8A 4YX2H 3PQYD 4XBGB 1E6JH 3W9DA 4C83A 1JHLH 1H3VA 1URLA 1S7WA 3UBXA 3WS6C 1GRWA 5J1TC 5HVFB 3C8HA 2XKSA 2P5WB 4H1LH 3BUYB 3MUHL 4DCQA 1YEEL 3QNZB 2IBBA 2HJKB 2V2TA 5EU6E 5IBLD 3BQUA 3X3FL 2IANB 3AXLA 1ZE3C 4D9RE 3CXDL 5D1QD 5HPOA 2BX5A 2QQNL 4YE4L 2PW1A 1KJ3H 3P9LA 5DJ6B 3E8UH 5HJ3A 4HGKC 4N9GA 4WGWB 3QPXL 4HCRL 4F7CB 2EDTA 2O5XL 3ZYZA 5J1AB 3TCLB 1D3CA 2NY3B 4UAOC 2AJZA 4YHKH 5KANG 5MP6L 3J8F7 3N1PC 2DMKA 1KG0A 5H37G 1EAJA 3GK8L 3FT3A 5FYKH 1NEUA 3O3EB 1NGQL 1X4ZA 2H45A 2BVPA 5D6DC 3WIIH 3MLTB 3FQUA 2R9HC 1QSEB 5C08B 3QWRD 4H5SA 3ARXA 1QRNB 5DJ8B 4AH2A 4PJ7E 1MCRA 3VH8G 1KC5H 4LSTL 5F7MC 5IFJB 1SM3L 1OAUH 5IB4B 3VXQB 4P5TD 1G7IA 1VPOL 2JCCF 35C8L 5CFHA 3EDDA 1F58L 5D9SB 1HYRC 5DQDH 4Y4KB 1KNOB 3CLEH 3E6FA 4LSQH 1EPFA 3MNWA 5JA8B 4ZFOB 2BOCB 5KSVB 1D7FA 1JNLH 2CLVB 2P5EA 4C59B 1EFXD 1E4KC 4HJ0D 4U6HA 3L3IB 5F9OH 5ENWA 4NWUL 3TBWB 3BP5B 3VXRE 4ZPVA 1FP5A 2FJHB 1BM3H 5CBEA 1BJMA 4EBQH 5I74C 4ELKA 4QKXB 3SDDB 5EU6B 4OIBA 3THMH 4PRPB 3L95A 5I2IA 4LPVA 4NQEA 5DVLA 1ADQH 3E6HA 2OBGA 4LCCA 2ADGB 4LRNL 3UTSB 5DYOB 1A6AA 5AYQA 4N0RA 4Z5RA 4R7NB 3MRCA 3MR9A 4HJJH 2HFFA 3VRLE 4LKCA 2LU3A 1LDSA 3MA7A 1KCRH 1AJ7L 1AR2A 1YN6A 3R0MA 2G60L 3C5JB 1NBZB 5H37H 3DTXA 5C2BL 2R15A 5IROC 3RJDA 3C9NA 1FVDA 4KZDL 4L8BA 3V4VH 1INEH 1U8OA 4TPRH 4P5TA 3KPSA 4S2SA 5D1QC 3FQRB 3QXTA 4WFHE 1GIGH 4Z7UF 2FECL 5DR5L 3CZJA 1RK0A 1MRDL 1F3DH 5E00A 4MNQA 4BM7A 3C5ZC 5DQDL 2YD1A 3O4LB 2Q6WA 1MCOL 2EO1A 4KXZI 4D2NA 1JZ3A 2V2XA 4OIIL 5LJYH 4TUKH 5DTFA 4IIQC 2NW2B 4P9HH 5I17B 2HFEB 3IXTB 4JJ5A 3LD8C 4L4TA 1JHTA 3HZYA 2XZQL 3QXAA 4Y16A 5JIHA 3BOVA 1V3JA 5EZJB 2X1WL 5I1JL 3BRDA 3IJSB 4DKFH 1EFXA 1T2JA 2C26A 4Q2ZA 4OSUH 3C6LD 4Z76A 4YO0B 1XGPA 3FCTA 5FFLA 5EU4A 2XZQH 5FYJD 1J18A 4GRWE 1OF2B 3O6MH 2D31A 4JZOA 1B0RB 3RWDA 3VGAC 4I2XB 2Y07H 1Z3GH 2ZUUA 2KL6A 2WUCH 1A3QA 4ZODA 1OM3H 2IWGA 4WWKC 3BH9A 5IGXL 3O4LE 4HC1L 3SGEI 3IU3B 4IMKC 2FJGB 2PO6C 3GIVA 2L7UA 4K55A 5CJOL 4GBXC 4WNQA 5DI8A 5J1SC 1NAKH 4KZEL 2VZOA 4Q74A 1KNOA 3VGBA 1I8LA 1I8MB 2I5YH 4WI9A 3MJ9L 3DVNA 4PRIE 1T4KA 5ESQA 5C6WH 1U8IB 2H1PL 3QI9C 3O8XB 1I1AD 1JYXA 4G8GB 2ZJSH 3CFDA 4N8VB 2X4OA 4XHQA 4LEOB 3REWB 3S3PA 7FABH 2R2HA 1NL0L 5SWZB 5FGBC 4BSVA 2XTJE 1GOFA 2W9LA 1KBGH 1IAOB 2DWEA 1V7ML 1TVDA 4YQXL 5GGVY 5IR1A 3U0PB 2OJEB 3TZVA 3ILQD 1UB5A 4LLDA 5AZ2L 5FV1L 2EC9U 3RVVC 2W38A 3PP3H 5I66B 5I0DA 2NNAA 4D8PB 4PJHE 3FQWB 3NCYP 3FFDA 4FQIL 1VADB 1WIUA 1X5XA 1CDUA 1MAJA 4HUXA 2VLKD 4O58L 3TNMB 1A1NA 4M6OH 4LLDB 5IOPB 1W0WA 5FCUL 3LDBC 4PG9A 4U1IB 5E2TH 3GM8A 3GO1H 1FNEB 3G08A 3RI5F 3SE3C 4Z78B 4QHLB 4OIAA 5E99L 1FJ1B 5TF1L 1G7LB 3MRKB 5HDBF 1X3DA 5L6YL 4M4PA 4FZEL 3SHSA 3WO4C 4X7SH 2AEIT 1T1ZA 4PGCA 1B88A 4XNQA 3PUCA 3QP3A 1I9EA 3MREB 1FVCB 3LB6D 1QO3A 4I5BB 1J0YA 5HDBE 1MRFL 1NGPL 4LCIH 5GJTL 4G7VH 5IEKA 4PP1D 2VIRA 2AEPL 3ARDA 5FM8A 3HLAB 4PJFB 4X83A 1E28A 2KDGA 1UGNA 4L4TB 4GKNB 2VWEC 4PJ7A 2YBRA 1G6RA 1VDGA 2YKLL 1N4XH 4NO0D 3DUUB 2OS7A 5F9DC 3HLAA 1OAUL 2D7NA 2B5IB 2WIIA 3PV7A 1CCZA 1VFBB 1XGPB 3RY4A 3I02A 1HEZA 4KZDH 4X99B 4ONHA 2VO5A 1TFHA 5JXAH 4X6DF 2GAZA 4JO2H 4J3XA 3FHAA 5C0EB 4BQBA 2J6EA 4A6YH 4PRNB 5F7FA 1HOCB 3BP5A 4ZOCA 1SJHA 2B4CL 3RTQB 4LVNC 5F70A 4KQ3L 1G6VK 3U30C 3B6SA 3BEWB 5EC2B 4S1SL 4PJEF 4XNUH 3NA9L 4GAGL 2ZUWA 2DKUA 1E6OH 1PQZA 2H2SD 2NY1D 5CLWA 4ZFGL 3LEVH 3RWHA 5I1HL 5JLZB 4U2YA 1ZTXH 3O41B 2X4NA 3G5XA 1WEJH 4GAYB 3RWEA 3U79A 2MCG1 2QADB 4WV1C 1CFSA 1MJUL 4PBVC 5IVZA 3MLXH 5B3JF 3E1F1 3F12B 4X6CF 1OAKH 3RWGB 1JYWA 2A83A 4LLWA 1EHNA 4XP1L 5K33A 4BFIA 4RBPK 3QUMH 4PJIF 4JHAL 1VESA 2ED9A 3TA3A 5GGRY 5DD0L 2CIIA 2VWEE 4NZRH 5EFIB 3KPLB 5JDJA 2NY5H 3TP4A 4BA8A 1IC5H 3X13A 3P4MA 4RMWA 2YZ1A 3PHOA 4NUJB 4TUOB 4UNVA 3IDYC 1GGCL 1HE7A 1KYOJ 2XRAL 5MEQA 2UYLA 3ARYA 1NANI 2MWCA 3OKNA 4LCYB 1YUHB 5MEPA 4LVHC 3VA6A 1MCPH 5IW6A 2E9WA 2A6IA 4WTXA 4IMLA 4OUUA 3QEHB 2Z8SA 4J3OC 4LSRL 5F7EH 4RMQA 3BGMB 1BFSA 4TVPH 3SKJL 1FZOA 3W39B 3ROOB 1OTTD 4Z0XB 4B50A 4RGNC 1BAFL 2FX7L 4EN3D 3BZEA 4O51B 1RJLB 3SO3B 3LV3A 1A9BB 2ADJA 5HYQA 2VXVL 4NNYA 1INDH 3NIFF 4LSVL 1A64A 1U8NA 4OFYD 4IJ3B 1PY4A 4PJFF 4OD3H 5HI3D 2AXGB 3WIHL 3MUGB 4EN3C 3K8LA 5DJ6A 5DMJB 1P7KA 3CFCL 4HUKB 2Q8BL 3ZMRA 3KPRE 4NQCB 4I48B 4WU7A 1NBYB 5AAWA 3JTTB 4UU9B 4YFDB 3QUML 1HOCA 3L3GA 3RY6A 4J8RB 5BZDA 1UB6B 3FB6B 3IRZA 1BFTA 3OX8A 1RHHA 1SYVB 2B1AH 1ZMYA 3VJ6A 4Y4KC 2BMKA 5FIEA 3BPCB 4RAVA 2P46B 4JHBA 4J8RA 5IMLB 4GAJL 3PL6C 5J0BA 4PLKD 5KOMC 3EO1B 3OKEB 4U1JB 1KGCE 1BLNB 2HG5B 4DTGH 2YRZA 2CJUL 1IEHA 5FM4A 5FDWA 3GSVB 1DBJH 2G75A 3WFDL 2UZIH 4NRZB 1NGYA 1L7TH 4FFVC 2IQ9L 3I50H 3L5JA 5C0RL 1A7QH 1XGQA 3QFJE 4JREB 2GY5A 3GB7A 3BEVB 1UKSA 1U8HA 4GKOA 4JRWA 5IHUH 1DBBL 4ZFFA 2VZ3A 1X7QA 3L7FB 4N8CL 2CXKA 4R6UA 1ZT7A 4R4FL 3HMXH 4GAGH 1GPOH 3EZ8A 3KR3H 4Z77A 1D6VH 1OTTC 3TN0A 3HMXA 4UQ3A 1N8ZA 4NRYA 4JFPB 4S1QH 2FJHA 1ZHLB 4D0DA 5CP3A 5E6ZA 4OM0L 4J3SA 3GSWA 2VDOH 1UB5B 1F13A 1QNZL 3FO1A 4H25B 3MLPA 1PJ9A 1V3KA 2IAMA 5AEAA 4GSDH 3HUJA 4HUVB 3LQZB 1HHHB 4LQFH 5B21A 4F7TB 3CDGA 4LGSB 1EXUA 1X5IA 2X44D 4TNVF 4I18A 3SBWA 2ITDB 4CKVX 1BZ9B 4PGBB 2DWDA 4YHOH 3HR6A 4P3WA 2A9NL 4RFEB 1K8IB 2WW8A 2QADD 1KCSH 1QVOA 4Y4FB 4ZO8A 5T1LA 4AIOA 1IC7L 3VWJC 1JV5A 4XMKL 3ARVA 3BJLA 3U7AA 2CK0H 5KSAC 5IOPA 5IT2L 4ODSL 5DHYA 4FRWA 4YPGA 1B3JA 3QYCA 1DL7L 4NN6C 3F7QA 4M7ZB 3TC9A 3O9WA 1WEJL 2KUTA 2ENYA 1FG9C 2EDHA 4PB0L 4E0RA 5C0EA 2F58H 4CVXA 2Z91B 1GC1H 1RZKL 1E6OL 2G60H 2YD7A 5HVGB 2IAND 2F5AL 1NSNH 1S7XB 2PCPA 2A73A 4MA8H 1JI2A 2AW2A 2QBWA 4D0CA 2GTZB 2GITB 3S35H 3UBXI 4R7DA 1IKFL 1I9IH 1NMCB 2NW3B 2OXHA 2QTEA 3DX8A 2GTWB 2R29L 4P2QB 4ZPTB 2GHWB 4X6FA 1TVBB 3HB3C 1BQHB 4WEBH 4JFXB 3VFWA 2I60L 3OJVC 1OCWH 3EO1A 3OKEA 5LBSL 4BQCA 4L8DA 1IFHH 1D9KC 2JLLA 2WIIB 3IDIB 4LIQE 2QQLH 5T1KA 3SJVE 5DSCA 3K7UA 5TDOA 2DQGL 3HE6D 2P5EE 3QRGL 4HIIA 1ND0A 3RL2B 4YHOL 2ZOLB 3PWLB 4M7KH 2NXZB 3MROB 5KOVC 3DECA 3C8KA 4OF6A 3P4NB 4PJAE 4BQ9A 4XWGL 3K81A 1SEQL 4HS6B 3LZFL 5EOQL 1REIA 3DRQB 4XPTL 2ARJQ 2Z0BA 4PUBH 1CD8A 5KSAB 3K8MA 4JPIA 2KZWA 1MHCB 3F5WA 5IJKC 1AR1D 4HFUH 4P5MB 5FKPA 1E27A 4NZUL 3WHXA 3ZTJH 4BELD 1N2RA 3KYMB 1YZZA 1B0WA 1UWXH 2A6KA 2HT3C 3DARA 4GRLB 2M1KA 5KVGL 4DVBB 3BO8A 1U8NB 5J3HD 2WWMC 4UUJA 4AT6A 3HI1A 4KROD 4MWFA 1A4KB 5T3ZH 5BVJA 3WHE0 5CEXB 3VWKC 2YD2A 2F8OA 4XMLH 4CW1B 4DW2H 5JPNB 1OT1A 5D96B 5HGDA 1AD9B 3RAJH 5F7DB 1H15A 4C4KT 4UDUA 4ZS6C 1PX4A 5DK0B 1U93B 4Q58C 2J8UE 4KJQC 4NQVA 4K3EL 3PL6D 1NCCH 5D2NB 2F54A 3E3QC 4JFDE 2EIDA 1KJ2B 4I77L 2R2BB 3MFFB 5EU7C 5J8OA 5LCVH 2R0LL 4Q7DA 4KJPD 1BJ8A 4ZOEA 4PD4J 5JW3L 2D3VA 2HVKA 5EA0L 4JPKL 3UAJD 2CR3A 3MRHA 3RZCA 2VDOL 3NCJL 5DRZA 1YPZA 4ERSH 4OM1L 4LARL 5D7IF 1LMKA 4KKCD 3BI9X 2D4DA 4XNYL 2I60H 2XWTB 2YOCA 5EZLA 2HVKB 2R0KL 4CBPA 1U2CA 4ZD3H 3BZDA 4UIKH 5H8DA 4PRHD 1NDGA 5ACMA 1U8QA 1N5AA 1RZ7L 4PGDA 2DQEH 1YMMA 3OXRB 5I1KH 1QLEH 4PJHF 4YXHL 4UTAL 3SKMA 1T21A 3ET9F 3VFGL 5DGQA 1BBDH 5HHOB 4XMKH 3LRSA 1X5KA 4HPOL 3C87A 4OZHA 3QHTC 2D2OA 2VN7A 3MQIA 3K1KC 4N1CA 5B3NA 1FN4A 1I7UB 3KWWB 3NZ8B 3O11B 4NN5B 1NCBH 3PWPD 1GC1L 2AV1B 1UT9A 1U8LA 4C4KO 3IDXH 3TT3H 1QBAA 4ODUA 1IAMA 5FECA 4LLQA 5FYJE 1M6OB 1NBVH 2COQA 2ZCKH 5C9JB 1OP5K 3GSVA 3ULVE 1MHEA 4ODSH 1KTRL 3P4NA 4XB8A 1QR4A 2HT2D 1OAXL 4MAUL 1HIML 2FB4H 5GRJH 1WWBX 3SO3C 5EORH 4GAYA 1KCSL 3CCHA 4OCYL 3AFLA 4LLMB 2CUHA 3GK8H 1EXUB 3EOTH 3NH7L 2VR5A 4MJID 1KLUB 2C3GA 3VCLA 3NIDF 2PF6A 3KDMA 2P8MB 4X4YB 1QG3A 1QKZH 2CDEA 4ZS7L 4PJ5A 3KYNA 4OD2B 5TF0A 4CMHC 1CD9B 4NDMA 1AE6H 2BVQB 1S7RB 5D5MB 3V4UH 1DBKL 4XNMA 2XA8H 4LVEA 1HHIB 3T65A 1NMBH 4D0DB 4EKXA 2IBGA 3UYRH 5A2KH 5JPMA 3L9RB 3C6SB 5C0GA 2WMPA 2Q3ZA 4RDQG 1G1CA 3KYNB 4OD2A 4K3JL 5DJ2B 2R9HD 4OI9A 3LB6C 3O81A 1WFUA 2MTPA 1CLOL 1SMAA 1YJDC 1CXLA 5EZOH 3T1WA 2FNBA 5DWUH 3QO1B 3CSGA 2PXYD 5EH1A 3LKPB 5DFTA 5J9PB 2VZVA 2ERJC 4XNQB 5DD1L 4JFXA 2A74A 3Q5OA 4Y4KD 1WFTA 3S5LG 3MC0A 1HI6B 5C0CD 2JJSA 3ALXA 1JNLL 3LS4L 3FMGL 4YDVB 1LE9A 3BE1H 4QRUA 3H9HA 4YUEL 2ZUVA 3D87B 3DTXB 4KDWA 2AXGA 4M1GL 3VXPA 2VLME 1UYWL 5AWNH 5D6CB 5DGRA 1D5ZB 1CLZL 3TPUA 2BJMH 5E2VH 3G5ZB 1FL3B 3BKYH 4ELMF 2VZTA 1S9XB 3QDGA 3JSSA 3V95A 4M1GH 3MLRL 3MRJB 4UMGA 2NY3D 2A73B 1L9MA 4JDTL 1I1CA 2AJVH 4QY8A 3CFIC 1OAXH 5HHME 1OL0A 3PGCB 4GXVL 1DUZA 3MLTA 2YN3A 3QEQE 3PGDB 3OAYK 7CGTA 1MY7A 3RGVA 4OZIB 1MF2L 1JUFB 3S4SB 1IGIL 1QQDA 1I7UA 4GOSA 4IS6B 1OTSD 4LBEB 4NNXA 1U0QA 2GJ6A 1HH6B 1P9MC 3QEGL 3RP1A 3BD3A 4NCDA 4S1SH 1A6ZA 2DWEB 1DQTA 4GBXD 2WBJB 4Y4KA 5J11C 4NUJA 1ZV5A 2F54E 1P4BH 5KJRL 5CWSA 3P73A 3FCTB 1C5DB 4IS6A 4P3DB 4KRLB 4JN1L 5HGDB 1M7IB 3QA3A 4CL7A 2NY1C 1F8TL 5D1XA 4UDTA 3IFLH 5D72H 1Y0LA 1JTOA 4U1KB 4EIGB 1Q8MA 2EEDA 2JB5H 4JGJA 1SQ2N 1MCJA 5FHBL 3DBXA 5MERA 1IGCL 4JM2A 2YPLD 4ZUWB 5IMKB 2XG4A 2K1MA 1I1YB 2WQRA 2DQCH 2IG2L 3QXAB 1MLBB 2FHCA 4QOKE 3MRRB 4JANA 3F58L 3MO1B 5H2BA 4M62H 5DJ0A 1QBML 4Z0BL 3V0WL 5GRXG 3UC0H 3UTTA 4XP4L 2ZUQC 4Z9KB 1N64H 5FKAB 5EIIB 4LNVA 3TO4A 1U6AH 2ESVB 4JN2B 2FX9H 1JMZA 4Y1AB 3VXMD 1P7KB 1ODAA 3VWKD 4DCQB 3LS4H 3OTTA 4HWEL 2Q76A 5L2KB 3D3VD 5FAAA 3OR6A 3N85L 1MFCL 4FN0A 2MPAH 4HKBB 1MJ8L 5M7QA 3V0VB 5DD1H 3OQ3B 1FE8H 5HHPB 1VGKB 1UQSA 2YEZA 4MZ3A 1VHPA 3BDYL 5DZOA 1F4AA 2XOTA 4OV5A 4U1IA 1MF2H 4ZFOL 3QEQB 4WFEE 2VDML 4IJ3C 2XXCB 4OZHE 5E1AB 3K2UH 1KCUH 5E5UB 2C4FT 4EDWH 1TJGL 2IFFH 3PDDA 4LSPL 1EGJA 4XGZA 1IZKA 4G6KL 4XMPL 4BSWA 3NTCL 4NN7C 2XXMB 1YPZB 5EA0H 1HQ4B 3O2VH 3IKCB 1NGPH 2DQUL 5DEFA 3S9DB 2B7DT 1NL0H 3LDBB 3DIFB 3B2VH 5GZOD 3NPZB 2P8PB 1CT8A 1MCQA 5D5MF 2E6JA 3C5ZD 4XB7A 4PGDB 4NQXB 1YJDH 4UBDC 1E28B 4XPGH 5CWSB 3TBWA 1LNUB 2EO9A 3TA3B 4MXQC 3NAAH 1CFVL 1M7IA 1CDHA 3MUJA 3O4OB 3QDGD 4URTB 4H20H 1MHPL 1TJHH 5EU6A 3WHE1 1I8MA 5CSZB 5I1EL 1YMMD 4MD5B 2XY1A 1INEL 3CFEA 1F4WH 2CGRH 2VXUH 5KVDL 2E8ZA 5IM7B 2WQ8A 4U05A 1ZLSL 3BZFA 3U1SL 4LIQL 4CVZA 1FVEA 4FQIH 5DJZB 3TZVB 5I71C 4ODHL 3PHQB 5I75C 2O93L 3QJFA 1FORH 1KACB 1QUNA 5LGJB 1MCWW 2JK5B 4U6XB 4HXBL 4PPTA 4AQ1B 3MNZA 5JW4M 2VQ1A 4P9HC 1JZ2A 2W92A 4RFEA 5GRVK 4O2EB 3VWJB 1WCBA 3GO1L 4YWGL 2ZSWB 4ODHH 3DO3A 2QJDA 1CK0H 1RZKH 1SBSL 4YFEA 3BAEH 2NNAB 3QUKB 1HK6A 3MRQB 4BZYA 3UBXB 3PWUB 1R3JA 1RUML 5EU3B 4P2CG 4Z7WB 1AKJB 4JFOA 2R69H 2DOCA 1Z9MA 4APQD 3FOMB 1NGXA 2EDLA 3BO8B 3S36H 4Z7QE 1DE4A 4MYWB 4NZTH 5DT1L 1Q0XH 4LASL 2O5YL 3N06B 4LDOB 2PO6B 2VLMD 1LO4H 1VFAA 1KCLA 3WLWC 1D5ZA 4HWBL 2QHRH 2ICEA 4XVJL 3BPNB 4ZDHB 5GS0D 5DO2D 2NY7L 3LRHA 5HJ3B 3C09B 4WEBL 1JF6A 3B2UC 3F65A 3QQ9C 1G84A 2NZIA 3ZTNL 2DQJL 3C5ZB 3GSXB 2D9QB 4OFVA 5F96L 4OM0H 2EH8H 3QZWG 5FDWB 5K93A 4YHKL 4ONOA 3RKPA 2ERJB 1FORL 4LCUB 4I3RL 4I18C 5SX4H 5HHQA 3GSXA 2DRUA 2XIDA 5MEND 5L88L 4P23A 4M1DL 4HLJA 4WI8A 2IGFH 5BO1L 1P6AB 2X4PB 4EBQL 2J3SA 4YHML 3LEYH 2R1XA 4PJ9D 4FQXA 5A2FA 4M4RA 3NA4A 5D8JL 4YE4H 2EICA 2JTDA 5DA0B 3V5HA 5C0AA 3VFRA 5IESH 5EUKA 1WF5A 1H3PL 4PJAB 3QO0A 3FOLB 3WD5L 3GSNH 2BFVH 1ZLWH 1RULH 4PLKC 5LGHH 1OGAA 1ZT1A 4U33A 5HYJA 3I85A 3IU4H 5C0BB 4HS3B 1GIGL 3KPOA 3X12B 1BZ7B 2FX9L 4LLQB 1IAOA 4O2FB 2ZOLA 3PWLA 4U1HB 4H26A 3VMOA 5ALCH 4GXUM 5F89A 1YNTB 4QOKA 1RVFL 2JCCE 3O11A 2FR4B 3QQNA 3SJVB 4LEOA 2GJ6B 4ENEC 3UTTE 1A6AB 2WBWB 3DGCR 1DLHB 3QH3A 5JOEA 1A6TA 1RUPL 2ZG2A 1QSFD 3NOIA 4FTVB 4XNXL 2DB8A 2ZOKA 3PDOB 5GGVL 1MEXL 4QXUH 4PG9B 1Z0NA 5BXFA 4PJEB 2P24A 3PIQA 1B4JH 3MLUL 2ZUYA 2J7LA 2KZ1B 4EUPA 3WUWB 4KKLD 4P4KA 5FO9A 5EBWA 4PV8B 4I4WB 1IKFH 5FK9A 2AJUL 2E9JA 5HPMA 2DTMH 2GKIA 5KSBA 1JF1A 4Q6YA 3DMMD 4TSCH 3S97C 4I3SH 4PRIA 4UBDD 3IF1B 3WS3B 2PTTA 1AP2B 4KJPC 3C6LC 3H8NA 3T0WA 3V2AR 1YY9C 4IMLB 1BFVL 1JHTB 3HZYB 1J0HA 5HVHB 3CVHA 2OL3H 5IJKA 3WFZA 4QRSB 4ENED 1AXIB 5J13B 1T5WA 4WUUD 1FC1A 3JWOC 4MLSA 4OCSL 5C08E 4NKQB 5DTFB 4HWBH 2C5DC 1HZHH 5JQ6L 4FFZL 3MXWL 1LNUA 4Y8DC 1A7QL 3UYOD 4PGZA 2BSRA 4O9HH 4KV5F 3TFKD 4ZUVB 1QSFB 2EE9A 3IJSA 3ZHKA 4I2XA 1A14L 5IHBA 4CN6A 3WEXA 4XZUA 1OD7A 4LK4A 1DR9A 1ZK9A 3JV4B 1WBYB 1U41A 3CSPA 1KCKA 1GZQA 4L29B 3D85B 1ZKAA 3C8KB 2QQNH 5DK3A 3KYOA 5JIIA 3TN0B 4RAVB 5C0BD 4F15C 5FYKL 1WSST 2IFFL 1S9WB 1RZGA 1OAQL 1KJMB 1CBVH 2ORBH 2Q86B 5D7SH 5E6IC 5C2UB 1ONQA 4XP9L 2FBOJ 2JJWA 4HH9B 1MJ7L 4WI5A 3D39E 3D2UA 2W60A 5DVOA 3OMZA 1H3XA 3PV6B 1ZAGA 3U0TA 5IB5B 5D7SL 4QTHB 3I3DA 4M93B 4RFNB 3MLWL 5DURD 3UXFA 2ARJA 3L5XH 1NGYB 5B39G 5E56A 5JUEH 3VFNB 5D7LB 5E03A 1IAKB 1K8DB 4HG4K 1PG7H 1U8OB 3N1QC 3WKNA 5JOFB 3U2SB 3TYFA 1F2XK 1RK1B 1D5MB 4KPHL 1QOKA 3HZKB 1F58H 5EOTA 4Z18A 3JWNC 1MCEA 4BZ1H 3EYOB 3L3KB 4LFHD 3RGVD 3HG1A 4W68A 2BVUA 1NCWL 1J1XL 5GZND 4YUEH 2CRYA 2FJFB 4MCYA 4MAYD 2FO1A 3DVIA 2F53A 3V6OA 4KI5F 5D7KE 3IJHB 2A2QT 3SGKA 1J1PL 2PKDA 2IALA 2A1WL 1K9TA 3Q6FA 3QWOB 3SCMB 4POUB 3ARFC 2BVEA 2D03L 1BFVH 4I0CC 1AKJD 4NM4H 1QPXA 1YEIL 4MSWA 3MFFA 3ULUD 3ARBB 4R0LC 1QFPA 2R2CA 3O2WH 3QG6B 3BZEB 1QFWH 3V4PL 1P4BL 2P7TA 5KJRH 5DMIL 1I8IA 3ARRA 4N9OB 4U1SA 2FEDD 3NCBB 1A8JH 4GRWH 4PJ8D 1T20A 4UZGA 1NGWA 5D1ZA 1UZ6E 1KJVA 1OGAB 5T1DL 1N26A 2Q3AA 1UWGL 2AJSL 1ZVSB 2CSPA 1HHKA 5DEGB 2B0SL 1ZWIA 4JDVB 3V5HB 2DLEA 5I1HH 1BVKA 3ETBF 4AEFA 2VB5A 4X4MA 1NGWB 2DMCA 5ADPL 4RZCB 2BRRH 4B5EA 4X7EC 2VC2L 2ZP0T 4R97B 3HPJA 5TGBB 1Q0YH 2RQ8A 2EEAA 4E41A 1M7DA 5IB1B 2BNQA 3BEWA 2WP3T 1TQBB 1NC4A 1ZS8A 2HT4D 1I85A 1D9KA 2Q20A 3G9VA 5E2VL 5FM5M 5DUPH 2OZ4L 3L3HA 4QTIH 4FMFA 4G6JH 3PIQB 3O8XA 2OZ4A 3VGFA 1F6AA 1BVLA 5IFHH 3RVWD 3FFCD 4YO0A 2ZOKB 1OGAE 1INQB 4RISL 5HHMB 1BQUA 1ZHNA 2V9RA 2VISB 1Q94A 3S98A 3VFNA 2RIKA 3VXOB 2F53D 3HCVA 4O9HL 5DS8B 4KTEL 4IOIB 1QACA 3MV7E 4HHAA 5E99H 2OTWB 3MOAL 4WUKL 4N0FA 12E8L 4V1DA 4NQDB 3QEGH 2Y06H 1LO5B 4L3AA 5HYFA 5TE7H 1ED3A 3QEQD 3UJJL 3T0AA 2FX8L 1MI5D 3DOSA 5E6IB 3S88H 3OGCA 4OD1H 4QHUB 4JFFB 4XVSH 3O4OC 4UV7L 4HKJB 3FRPA 4UTAH 1NLBH 4YLQT 4ISVA 2H41A 2E8YA 2OJZH 5TH2B 2NTSP 2DLIA 2YRLA 4PJDF 4IRSD 3KYMA 4L5FL 4UT6H 1P9MA 1S7QA 1I3RB 3MLUH 1IGML 1ZLVH 2AXJA 2WSKA 3Q3GB 5BV7H 5CIPB 1MJJA 5HI3C 5EBMB 4OZIE 2FGWL 5HGHA 3FN3A 4FP8H 5KZCB 4JKPH 4GUPB 1WICA 4X6BA 1G7PB 1MIML 3UMTA 5D7IE 1DQML 4HIJB 4NZDA 5EPMB 3D85A 4DN4L 4H1LA 1AXSB 4PRDA 2RCSH 3DVNB 4YPGB 3L3DB 1DUYA 1PKQE 4YR6B 3SDCB 3MUGA 4PLJC 1DSFH 2UWEE 2MOVA 4UI2A 1L0YA 4DOHB 3MYJA 3S5LB 3S3JA 5FYKE 2XWJB 1BOGA 3W11C 5LXGH 2VITB 1KN2H 1CFNA 4M6NH 1ZLUK 3I84A 2H2SC 2CXGA 2E7LC 4PRIB 1S7XA 1EUUA 2PCPB 4HJJL 2HMIC 2NR6C 1OAQH 1FYHB 1AQDB 5EO0B 4MAYB 1G9NL 3RVVD 4EI5A 4OV6F 1G9NC 4DW2L 4LCWE 4PJ5E 4XXDB 4XI5C 4RGNB 1LO3H 3SE8L 4ZPTA 5EUOE 5IBTL 3RGVB 1OM3L 4ODWB 1UXSB 3MXVL 4KTDL 2R0KH 1X5AA 1B2WL 3R8BB 2Z31B 1A14H 1L0QA 3V6BR 1TMCB 1JNNL 2P5EB 1R5VA 1G7QA 1QSFE 4U4BA 3BWUC 1AGBB 1E4WL 3NCJH 3VGGA 3O0RH 5IQ7L 4WFED 4KUZH 5D7LD 4P3CH 1N6QL 1XF3A 2Y4SA 4QRUB 3A0OA 4TULL 4OF5A 2OTUB 4HFWB 5I6XB 3V5DB 2DM7A 2XY2A 4WHCA 1CXHA 5F89B 3OB0H 1MWAB 4I3GA 1KB5A 2E5EA 4YH6A 3MRNA 1CFQA 1B6UA 25C8H 1NEZA 3DX6B 4L9LA 4RAUB 1P53A 4U1HA 2GFBB 3MRMA 3SBWC 3SDAD 3WL9A 5HYSB 2A6KB 4DKEL 3LKSA 4WCYL 1OTUD 1NBZA 3WNMA 4UQ3B 4HZLA 5TH2A 1MFDH 3O41A 3MO1A 2HKHH 3IGAA 1Q9WB 4C56D 1AGCA 4P57B 3QDGE 5B8CB 4OCWH 1WIOA 1KJ2L 1G0DA 5CP7B 5FCUH 3V4VL 1I3GL 4PRID 3QUZA 4N8CH 2N7AA 4X5XA 1FPTL 4DK6A 4LLUA 5I19L 3BKML 2P8MA 5AUMB 4MNHA 3ZE0F 1X6NA 3F7PC 2IPKA 3QIBB 4KK6D 4MD0A 4NHUB 3VFUA 4NFCA 1XEDA 2DI9A 4HBCL 1D6EB 2F8VA 1R3KA 3DGGA 3LKPA 2GJ6E 1XGRA 2EXYC 1KCVL 1JYVA 4WW1A 1H5BA 5LXGL 3AMLA 1P7QA 3MGOB 4U3HA 3HE6C 4RAHA 3HKFA 1KIPA 4G8IB 3UTQB 1LE5B 4XXCC 3BJ91 4U2ZA 3RWCA 2NX5E 5D7JA 1BREA 2ED8A 3IDNA 3UPRA 1ZVYA 4WY7H 1JCKA 3QIUC 1RZFL 4L3CA 5D71L 5DR5H 1XH3A 2VLLB 1NAKL 4X5WA 4UV7H 1SEBB 3AS0A 1H3PH 1YDPB 4MNGA 3VMPA 3UPAA 1UJ3C 4JG0H 1S7TA 3WEXB 2APXA 5IIEB 3S88L 2MSPA 1JNNH 4PJFE 1C1EH 4L4VD 1IRAY 2PYED 1M05B 1FYTD 4R4FH 1N5YH 5FYLH 2YPVH 2X10A 1WAAA 3RVUD 3UZEA 3RKDC 3SE9H 1XF5B 4GW5B 4QRRD 4H0HB 3WFEL 1XF3B 3PWPB 1J12A 5DJAA 4KRMB 4DGVH 1T21B 1LGVA 5C0IB 3W0WD 5SV4A 2V7HB 3PGDA 1AFVL 1A9EB 4PYHA 3OV6A 3ULUL 4ZTOH 1XIWA 1S78C 3MBEC 2W65A 5ICXB 2OJEA 2VZSA 2PTVA 5ESVB 4GMTL 1AO7B 2H8PA 3P11L 4JE4B 4X4XB 1P5VA 1F3JA 3GM0A 1D5BA 2DJ4A 2DQIL 1FGVL 1HDMB 4X9IA 1G6RH 1RJYA 1RUKL 4WI4A 5GS1A 5GZOC 5BVPH 1K6QH 1HHJA 4JPWL 1VACB 1QVOB 3HAEA 3I6LD 3G04B 3MLRH 5GS3A 5HD8D 5C09E 3VRIA 2BNUA 1BZ9A 2F9BT 3LH2L 3WNLA 1IMHC 3F62A 3CX5K 3AGVA 1UM5H 3D0LB 5JDSB 5C0JA 2JB5L 4NQXA 3NFSH 2P5WA 2YD4A 2O5ZL 4K71C 2W0LA 4P2YA 1J0JA 4KU1A 1I8KA 1AXSA 5AYUH 5L9DL 5KN5B 3DYOA 2F53B 3S3SA 3V8OA 3VFMB 3T77A 1BQHG 4N1HB 1BOYA 4R3SA 1JHKL 2CKBL 3QCVH 4PS4H 1UH3A 2Z9TA 3LEXB 1JPGA 4HDIB 4QHUA 1ZGLB 3DSFL 5I8OL 4HIXL 2EYSB 4FFYH 1OWRM 2X42A 5I17A 2UUDK 1R0AL 3TVMC 1CIUA 1FH5L 3CC5B 4OFYA 5EO9A 3LHPH 1IJ9A 2ORBL 2X89A 4YHPB 5E8PA 3V6OC 3QJHA 1SJXA 3X3FH 3H42L 4M02A 2IQAA 3JBG7 4XHJC 5E7BA 1YEEH 1RIVH 32C2A 4FXGB 2JIXD 4PJ8A 4IOSD 4JZNA 4POZC 2LE9A 3BZ4A 5F9AC 5EN2B 5CZVH 3RUGE 3B43A 4MJ2A 2DQDH 1K4DB 2DM3A 5EO9B 4R97C 4X99A 5BJTB 4HFWA 2FLBT 8FABA 1A9BA 1G1YA 3MX0A 1RHFA 3TPKA 4OF7A 1YJDL 1WWAX 4R96A 3CK0H 5EC2A 3O3AB 3DV6A 1IC5L 1C12A 5KVEL 1MFEL 1ZT1B 5HYJB 1KC5L 4RX4D 3QFJB 2IPUG 1T5XB 3OX8B 3VFPB 3R1GH 4J12A 2UWEB 3S34H 1EEQA 1K6QL 4XMPH 2ICWJ 2ZCHH 1TZHB 2PYFA 2UZXB 4R0LB 4KQ4L 4NHCL 3UO1H 2AV7B 2W9EL 3SQOL 4ZDHA 4ZTPH 5GISL 1KELH 3HN3A 1AGCB 3MROA 1RIUL 5HYIA 1WZKA 5DFVD 4NZRL 3QHFH 1NKOA 2QLVB 1KIRA 4NNXB 4HZLB 4RDQF 2VL4A 4Z5RB 4EI5D 4Z7VA 3LKQB 1ZHBA 3IS0X 3KXFD 3QEUB 4HLZH 4OF8A 2B4CH 4YPJA 1MCWM 2CLVA 2NX5B 3GMQA 3W0WA 2NXYC 3U9PL 2DQEL 5HPMB 3MV8B 1ZHBB 3ZKND 4HH8A 4ZFGH 4HIXH 2XN9A 4AEEA 5FO9B 3RDTD 4YHIB 3TO2B 3LH2H 1IARB 4RRPA 5D4QA 1TPXB 1YEHL 4MXWL 3VWKA 3G6JF 4JPKH 5EORL 1U8JA 3FZUC 4M61A 3MRQA 2EKJA 4PREA 5AYUL 2VC2H 1AH1A 4I77H 3RWFB 5KS9A 4OZFG 1HYSC 5FKPB 3VXUB 4ESKA 3LOWA 1MJJB 1MHHA 5I1CH 3RIAF 4OZ4B 2PW1B 5HDLA 1KTDA 2J8OA 1NCBL 3EOTL 1KENH 4RGND 3GMRA 1E4XH 4K8RH 3MLXL 4G8GD 4XPFH 1XFPA 5F1KC 1N6VA 3VDCA 1X4XA 4ZOAA 3AXLB 2HN7A 2NY3C 3FOLA 4KJYA 3CDYA 5GGRA 1SJVA 2ESVD 3GMMB 1AC0A 4FMKA 4HS8H 4NHUA 3VFUB 5I1KL 3O3BB 1UH4A 4X98A 1OP9A 5FYLL 2NQCA 3L3DA 3IDXL 3SKJH 3LKRA 1CDCA 1H15B 1IILE 3DGGB 4PJCB 1HSBA 3SY0A 4HXAH 1LO0L 1NCDH 2OI9C 4PRNA 1BJ1H 4KVCH 4Y16B 3M07A 4DKFL 3MV9A 1LK3H 1V3LA 4BFGA 1RJZB 2G9HA 3X3GH 1YEKL 4XNXH 3NVQA 1KIPB 4Q6IB 3A6CH 1ZGLP 1JK8A 2B1HL 3MRDA 5DEFB 1FO0A 2I24N 15C8L 4R0LA 4WUUA 1FG2B 3EOAB 3R0NA 3JTSA 4WFFE 3CH1A 5JZ7C 4ZQKA 4HUXB 3C8DA 1IVLA 1NH6A 4EI5C 5EDXA 3AU1B 4ZPVB 4TULH 2YWZA 4F9LA 4D8PA 4MCZA 1RMFH 3GSNL 2OR9L 2NY6D 4P46A 4FFZH 4OZGA 4B7LA 5TPWH 3O2DA 5E6ID 2RFXA 3H9YA 4WWKB 4P2RB 1GOHA 2X9XA 4V1DB 3VDBA 4YXKL 1JNJA 4WO4B 1KB9J 3C08H 4LLAA 4U7KA 5SWQA 1OTSC 3SDYL 3TIEA 2XQBL 1H9VA 5I8OH 3SE8H 1P84K 1F4YH 1KB5B 5ISZE 4JQIL 3VXUE 3UTSA 2J8UB 1OSZB 1EMTH 1I85C 3PXHA 4XCEA 1UZ8A 3HG1E 4OSUL 2X4UA 3I75A 3MRIA 4M5ZL 5F9WB 3I6GB 4Z0XA 3TBYA 1F4YL 3QIBC 4JO1L 5D5ME 3TNNB 5FCSH 3ZDZE 4X9HA 5T3ZL 3KHQA 2MHAA 1FL5B 4DKDC 2BC4A 2IGFL 1K8IA 5T1LB 5BO1H 2DLFL 5EB9A 2Y5TB 3X14B 3LKNA 1N5AB 3FB7A 1UM5L 3WUWA 1P4LA 4DEPC 4L3EA 4D9QD 4XVJH 1JF1B 5EU6D 1XGUA 2A9MH 3Q6GH 2QSVA 4M00A 2FZ3A 5E95B 3CUPB 3KJ6L 4YEFA 4PV9A 2JJTA 2YD6A 3EGSA 1F00I 3ZTNH 2PO6D 1RZFH 5DHVH 4Y19B 2FYYB 3T4YB 4Z7WE 3Q6GL 2PYEE 4M03A 1JPSH 2D4FA 3B9KC 3GNML 2CRMA 5B39B 4XPHH 2DYPD 4H5SB 3QZWA 4NSKA 3AREB 5C2BH 5E8DL 1JYNA 1KB9K 2X40A 1A1OA 2W60B 1FBIH 1EZVX 2IFGA 3T0BA 3W2DL 2XICA 1G9MC 3S8WA 4PB9L 1FC2D 4F7PB 1V5JA 3BVNB 3CU7A 3CAFA 1OLZA 3BH9B 4RGMC 1KCUL 2IEPA 1FAIH 3BIBX 1X9QA 3ARBD 3NCEB 2WUCL 4OFDA 1YQVL 4JVUA 2FO4A 4K2UL 3ZE0E 5HD8C 2H3NB 4HS8L 1I1FB 4YXKH 5F44A 4H88H 1A7RH 4NDMB 3RWJA 4PB0H 3RGVC 1WAAF 3E8UL 4QGTA 2HVJA 2R2EB 3T3MF 4OCLC 5EUKB 5C0CA 5F9JB 3HNTH 4QF1A 4XPFL 4APQB 3D18A 4KMLB 3FB8A 5CSBA 1U95B 2GSGA 4Y4FC 1GZPA 1MLBA 2Z93B 4AZ8A 5I16B 2ATKA 5F1IB 3PWJB 3GJFH 2A6JB 4G8FB 5ITFB 2HRPL 1BIHA 2DQFB 1JTPA 4KK8C 1P2CB 4KVNH 1A4JB 3WLBB 4Q6IC 1IGYB 1YYMH 2ADIB 2AJYL 2VKXA 2Z35A 3AB0B 4QTHA 4TVPD 1BF2A 5I1IL 3V6FA 1D9KD 5T1MA 5C07E 1TQBC 5I8CA 2EE2A 3FQRA 2N56A 1OP3K 1H0DB 2DYPB 2EIEA 2HRLA 3M1BB 4GO6B 5CJOH 5I1GH 3VD4A 2RB8A 1IGCH 1DVFB 3GKWL 5CBAA 1VACA 2EECA 4CADB 4XCNA 4PRHB 3QBTB 4JKWA 1OP3H 3UTTB 1FPTH 2B0SH 1I8KB 1NFDF 5TQ2L 3EJYC 3TBTB 3QUXD 1T2XA 1U3JA 1QLFA 3BIAX 3TA3D 1ZANH 3MOAH 4WUKH 4V2CB 4UIMA 2IPKB 5EBLB 1IGJA 3TESA 2VNCA 4Y19A 1NCDL 2J4WH 1ZLUH 1FVCA 3O2WL 3ZL4H 4MNGE 1EGJH 3HI6H 3T2QA 3BP6A 3NPSB 1H8SA 4PJGF 2AK4E 3PL6B 2Y06L 5F9OL 1MCOH 4ZUTB 4Y5VC 4M7KL 3VFOB 1B90A 1O5DT 2IADB 4JFYA 5TPWL 4UILH 3ULVC 3GMRB 2R4RH 3QG6A 5DHXB 4BUGA 4HGMA 4LASH 2YPLE 1MFNA 5F3BB 3OL2A 4NO3A 1E4XL 4K8RL 1MHHB 4WO4D 2FHBA 2MCPH 3AM8C 1BVKB 5BZWA 1LO2L 4XWOD 3HB3D 1SJEA 4JFYB 2ICWB 4OCRH 4ZUSB 1HQRA 3CLFL 4NQEE 5I9QB 3MOQA 5HHNA 3TO4D 2X4QA 5DJXA 4Z7OF 4OLXH 1FFQA 3LRSB 3EIFA 3D3VB 4NN5C 1HXYB 1KV3A 3QDJE 2EC8A 4OF3A 2JJTC 3R06B 2OR7A 3HS0A 1PFCA 1TZHA 2PYFB 2EXWD 1BZ7A 3UAJC 4MMXC 2I9LA 5FF6A 1N7ML 2PN5A 3BZFB 4K3DH 4OQ1A 2OP4H 4IIQA 1T04A 3F7YB 1PBYA 3QDHA 1H3TA 1CTOA 4ODBD 4DJMA 5D70L 2FX8H 1J8HE 2NZ9D 4WVRA 4PJXE 3KPRA 5CS7A 5D7JC 1RQ5A 5TQ0L 2XTJD 4XX1E 1AY1H 5CD3A 2AK4A 3CFJB 3KLAA 3RA7H 5D2LA 3U4AA 5DZNA 2Q8AH 2A77H 3GEWB 3INUH 4KI5E 5IB2A 3DXAA 5CIPA 2DI8A 4DN4H 3AB0C 2YZ8A 2VQTA 5IWLA 1TVHB 4HHAB 5DLMH 2A9NH 1IEBA 2R4SL 3ARGD 2YEZB 2BJML 4KROC 1QSVA 1YEGL 4PJ9C 3RY6C 2BDNL 4P2QD 3P2TA 1NCNA 3CZFB 4MNQB 1AKJA 4G6JL 1VEPA 5DLML 3ZO0A 3UBXG 3MRFB 4Y5XC 5D2LE 1XF4B 3MMEB 1IGTB 1OTUC 2IBZY 4PREB 1RIVL 1K4CA 1JWSA 2YSSB 1D5IH 4ONFH 4EQ3A 3SDXB 3VD5A 4GW4A 2A0LC 1A1OB 2BRRL 4JFEA 5CILH 8FABB 4DAGL 4ZAKA 1UADC 1F4HA 3CK0L 2Q1EA 4F7MA 5T5FL 3IFLL 5DQJB 4TSCL 5ICYB 3BVNA 5L2KA 5HY9B 4Y4HC 5TJWK 1S9YB 1HHGB 5GHWH 3FMGH 4HT1H 1J0IA 3RWIA 4ZUVA 1BQSA 4EUPG 3ARQA 4HD9A 5D1ZB 3MLSL 1I1FA 3RA7L 4NFDA 2Z31D 2ZKHL 3SKMB 4Y2DB 4CN4A 1UVQB 3QXVA 1A3RL 3CVIH 5DWUL 1FZKB 1CICB 3N1MC 4X7DC 4ZSOA 1NC4B 5DJZA 5I9QC 1DEDA 5IEHA 4UOJA 2AS5M 1I9JL 4LPYA 5C0BE 3R06A 3IVKA 1ACYH 4X4XA 5GGTH 5GRZA 3ZYIA 2OXGA 2B1AL 5BS0E 2D7PA 2IAMC 4GXVH 1YNKL 2QHLA 5KW9L 3RPIA 4RFOH 4QGYA 1MAKA 4OZHF 1UEYA 5LCVL 3O3EA 2DBJA 1S3KL 1JZ4A 4QRRA 2C7UB 1AI1H 1BEYL 1Y6NR 3CLFH 4PTTB 3SDCD 3N0PB 4OD3L 6FABH 5DA4A 2YN5A 1A47A 2P8PA 1MIEH 1VKXB 4KY1H 4BSVB 2CKBA 1Z6JT 4P2OC 4Z7VE 2AJXH 5SWSD 5FK9B 4K7PH 1ZT4A 4XRCA 3ZDXF 3DUHA 4OZGB 3VWJD 3ULUC 5JOFA 4OLUL 4OCXH 3PDOA 3ZSTA 3UTOA 2QADC 4JKMA 4PJCE 2L7JA 3AAZA 3U4EA 1QPPA 5J7CC 4NC0B 4PJIB 1T03H 3SGKC 1LP9F 3OJDA 5E9DE 4QEGA 4GG6A 4LP4A 1IGIH 3K46A 4OCWL 3OKMB 3BN3B 4OZFH 2V7HA 4NZUH 1CFTA 3B9DA 4U0QB 5CHNA 3QQ4B 2NY4C 1ROWA 1E27B 3W9DB 1CXFA 1LD9B 3MMEA 4R7NA 4ZAKB 5DMKB 1WTLA 2Z31C 3MA9H 1PD6A 3F6LA 1ORQA 4LAJH 1CQYA 2DYPA 3CC5A 3M1BA 1HEZB 3MREA 4XAKD 1TLKA 3ZTJG 3HE6A 1JWMA 1JL8A 1MEXH 5KS9F 1QBLH 3QIBA 4MD0B 1LQSR 2W0PA 1PLGH 1S7SB 4AM0A 4JM4H 2YBRB 4MQXD 4KFZC 5I75B 1A6VH 1A7PH 4X8XA 5DUBB 5HYQB 4XMLL 4PFEA 3GSUA 2RGSA 1ONQB 1HH9B 3VFVB 3IKKA 3VGHA 3EO9L 4K71B 3KJ4B 4HKZB 4FZ8L 5GGRB 3RUGB 3IXAB 3BAEL 3X17A 2EIZB 3U7WL 3EFFA 1U3ZA 2ATPB 2EYRB 2BXZA 5MENA 1KJ2H 1SY6A 4JRXD 5DVNA 1CN4A 3BN9D 1TXKA 4N68A 4L29A 4OZIA 3ZYOA 4Y5YC 1FN4B 3KWWA 3V8CA 2X1OA 4DUWA 3JTTA 4HWZB 3PP4H 3RX8A 5DJCB 3G5VB 4G6AD 1R3LA 5DRNB 3FZUD 1FNSH 4GG6F 2DIBA 4GKSB 3ILPB 4ETQA 5E24E 3LVEA 4U6YB 3JV0A 2HH0H 4Y1AD 5HI5C 4YHLH 1GC1C 3OBAA 3STLA 1W0VA 2IBZX 3L3HB 2D7TL 2VSDA 1UM6L 1MCKA 5DJXB 3BP4A 3GNMH 1G7IB 3I9GH 1M05A 4DN3H 5D2NE 5FA3A 1MFDL 4AEIH 1WZLA 4NQEB 5CSZA 3U82B 4CMMB 1A22B 4JFHE 1AO7A 2H8PB 3UROR 1Q38A 4RSVA 4MX7A 4NP4H 1HIMH 4UT7H 3ULSA 1FBIL 1XGTB 2FGWH 3DO7A 4XP6L 3P0VL 1V8HA 4NM8H 3L3IA 3QJFB 5SX5K 5A3IC 1MCIA 4UT6L 5F88B 1RUMH 2XQYG 2DQUH 2FDBP 5DD3L 2OX5A 4KKLC 1S7WB 2B2XL 3HAEB 5FXCH 5CJXA 4XP6H 1PW3A 2VXQH 2OLDA 5E4EB 4JFEE 1YNTA 4PJDB 4M5YH 5EU5B 1DVFA 1KFAL 3G5YB 1EO5A 3SEPA 1KTLA 4G9FB 4U1NA 3QIUB 3JV6B 5ANMB 5IVXB 1JPFA 4KKCC 2KQNA 1W8OA 2BNRB 4ORGB 1RZ7H 3N9GH 3SCMA 4WO4C 4M7JH 3HE6B 3B8SA 2DAVA 3IFPA 4ZXBD 4MNHB 3K4ZA 4EI6A 2CDEB 3T08A 5F72S 4R26L 2R1WB 1IGJB 1UQSB 5IBUB 3HZKA 1VFBA 3MUZ1 3MV8E 4YAQA 4PBXA 2AKRA 4JM4L 1L4IA 2EH8L 4NBXB 4PG2C 1KJ2A 1R3KB 4HAFA 4HK3J 5KAQF 5E00B 3QULB 3P4LA 5SWZE 3FFCA 1EX0A 1CI5A 4XGZB 2DIJA 4NO5B 3STBA 3U1SH 3QJHB 3EO9H 1VFOA 3C5ZA 3GSQB 3WFBH 4CRPA 2AV7A 5FUCE 2F19L 2YC1B 5DJDB 1YDPA 3D9AL 4MNGB 1UEMA 4LPWA 5GGUA 4PJCA 4M62L 4C55A 1IKNA 1CU4L 1YEDB 3MGTB 1WBXB 2BFVL 1JGVL 1TZIB 2EEBA 4JFDB 2O5YH 3MOBL 3I3EA 1J8HD 4PY8J 1Q0XL 1G7JB 1EHXA 1G7MA 5T1KB 3MGAA 2EDKA 2E3VA 4PIRF 1IGMH 1WBZA 1TQCB 1JGLL 2R8SL 3WFHB 1MUJB 5F1IA 1J88A 2W07A 4RIRA 5KSUB 3ARTA 3SDDA 3QUYA 3O6FB 4HUMB 5D7LE 2H3NA 1QLRA 1RZ8B 1FE8L 2JB6B 1MCLA 2PNDA 5E9DA 1J11A 1EVTC 2WUBL 3ZT6A 1P6FA 2RBLA 4OLUH 1GJIA 4IDJL 2R2EA 5C0AE 4JM2B 4ZUWA 2UY7A 3CMOL 3FO2A 4LHUB 4YDLB 1R5WB 5E9DD 3ROLB 2CDFA 4Q9CA 4U3XA 1OGTA 4BZ2H 5M94B 2AGJH 1PZ5A 4MDJB 3OSKA 4U6VH 5CHNB 4E5XA 1I7ZB 4I13B 2X4OB 2NY0B 3A67H 2OK0L 5KVMC 4O4YH 4HC1A 1FL5A 1JP5A 3IAGC 1J10A 4HWBA 3OKKA 1MRDH 4RAUA 1TCMA 3KLAB 1T20B 1EJOH 1X6LA 4JFOB 4FOMA 3QDJD 1Q9LA 5F71A 3HI5L 4ZS6D 4OLYH 4EN3A 1J9CT 4ELME 4JFFE 5BV7L 1NAMB 4JLRA 3O9WB 4GUPA 3ECBA 3MV9E 1JPFB 3MCLL 2PO6A 4CVWA 5DQ9A 1I7RB 3LQMA 1E4JA 1MAML 1LP9B 3QDMD 5CZVL 3VXTA 1FIGH 2AEWA 1TITA 5IWLC 4Y4FA 4M8QA 3WS6A 1Q9OB 4JO4H 1U91A 2ICWI 4LF3B 4OLVH 3PHOB 4TUOA 4X6DE 1FL6B 4TVPE 3G5VA 4AEHL 3ESVF 2FJFA 4MCYB 4PRPE 4QRPE 2YUWA 2F74B 1UJ3A 4BQ6A 1YYLH 4HWNA 4ELMA 3WXWH 1B0GB 3EYSH 4XNUL 3ZZ1A 5ABDE 4JJ5B 1C5CH 3H9HB 4O00A 3RIFK 5F7LB 1YEJL 4WW2A 1K5NB 4NKOA 3NACH 3QQ3A 3ILPA 4ETQB 3O3AA 1AHWB 4F7EB 1MJ8H 3T0EB 2FH6A 2Z8WC 3D25B 3STZA 3K8KA 4O02H 1K2DA 3T3ME 4TNWF 2OTWA 5IB3A 4KHTL 2KQMA 5C0AB 3DROB 3MACL 3DETD 4YC2C 1FNFA 3MSPA 3WNKA 4NJ9L 4YIQA 1H3GA 1BP3B 3B2VL 4PRDB 1U8HB 5L2KE 5M95B 1GGBH 4X8JA 4ZTPL 4ONHB 2NY0D 5IF0B 5SWSE 5JXEC 4H8WC 4XBPB 1JRHH 1CE1H 1IAIH 4WENB 1Q9KA 3JWOH 2BK8A 5J6GB 4JPWH 3GFUA 3QDJA 1JNHA 3GUTB 1KIRB 3PWPE 5IBLC 4QHMA 2ATPA 3FO0H 5K9JL 5I1DB 4NJAH 3LN5B 3K2UL 4U1JA 3IFNH 5IB1A 3O6FC 4E41B 2FSEA 3SQBA 5I1AA 3TYFB 4M1CC 3OKDB 5DD0H 4F57L 1MNUL 5DO2C 1JZ8A 1A5FH 5DK2A 1V05A 1CFQB 4X5XB 3EOBB 3OR7A 4ODUB 3LSOB 2OP4L 1FGNH 5SWSA 5KSAA 4HEPG 4L9LC 4P57A 3RVXD 1T7XA 4JN1H 3NBNA 2BNRA 4S2SB 2XKUA 4XNMB 1CGXA 4KC3B 3QUXA 4AK1A 43C9A 5IK3B 1LEGA 4LLUB 4OQTH 1AIFA 4XH2A 4Y88A 5KSAD 2YPVL 3P4OB 4PJGB 5TFSL 4GG6B 1B6DA 4PJ5D 4FFYL 4CAGA 1FNLA 3AAZB 4DAGH 4XNYH 2D03H 1XR9A 4JDZB 2CIKA 1LEIB 4QF1B 3CX2A 3IF1A 5JTWA 4JO4L 5K9KA 2VLRB 4ZMAT 4W81A 5JW4R 3HA0A 4OTXL 1A6UH 4NO0B 3OAUL 1A2YA 1NMBL 1S7UB 4JKKA 1NLDH 1U8KB 3R1GL 3S34L 4L4TD 5T5NF 1TVBA 4GJTB 1IAIL 3GSWB 3MPCA 4DGIL 2QSCH 3MRLB 5GGSY 4U6VL 4R4NC 3UTPD 2C1PB 4JFQA 5L0QB 1P4IL 2NY5L 2GYSA 3JUZA 1S9VA 5KVEH 5EIVA 5I76A 3NIFE 2B5IC 4D0BB 4GFTB 4H8WH 3ZSSA 1FV1A 4ZXBB 4F2MA 3WE6A 1ULVA 4OAWA 5ILTH 4PLJD 4CVUA 5EOCH 5E5RB 3BFOA 2BNRD 3M8OH 3DV4B 3B5TA 4Y1AE 1T7YA 3P9LB 1KLGA 5D96C 3KPTA 4OCSH 4WNQB 1NGZA 3H42H 3MLWH 1QR1B 2ICWA 3BQUC 3KS0J 2IMNA 1R5IB 3MODH 4Z7OE 5A2JH 1DDHB 1OAYL 5L88H 4LRIA 4YR6A 1U8PB 2DQTH 1IGFH 1KPRA 5E2WH 1FZKA 1T0PB 1FNHA 1NCAH 1GAFH 3MYJB 4NQDE 1GGIH 1AQDA 1CLOH 1Q1JH 4NFBA 4HKZA 3M17B 3HRPA 1DEEA 5EO1A 3WNPA 3MGOA 1N0XH 4RGMB 3D0VB 1XCTB 4RGOL 5BS0A 1Q72H 1ZANL 3B3IB 4ZFZA 5JORA 4DGYH 3GSOA 3CJJA 2NR6D 4P5MA 1QTYT 4LAQL 1PQZB 4KVNL 4BK5A 4DVBA 5FHAL 1RZJH 5IG7A 4HIHB 4ZD3L 3EOBA 1QKZL 4ZS7H 4JFED 3NFSL 2YPKB 4FXKA 3OF6A 3U9UA 3MLVH 5HDOA 3C2AH 5DEZA 2CMRH 4PJ5B 3EJZD 4FTVA 5I1AB 3D6GA 2ZNXA 4UTBL 4TYUA 5B3JE 1I1AB 4NQDA 1KLUA 2ATKB 4JFFA 4HIIB 1OD9A 4YNYA 3CZFA 2R4RL 3W9EB 3SKNA 3TZVC 5I71B 2XWBA 5ITBL 4P2RA 1DQJB 5C6TL 3G6JB 1Z3GL 1SBSH 1Z9OA 4YZFE 4MS8C 4MJIA 1JWSB 2YSSA 4JRXB 5IMOB 1YQVH 1MSPA 1TDQA 2J5LB 2BHYA 5FKAA 5SX4I 3FQXB 3FT2B 5IHZB 4NKIL 2HKHL 1JPGB 4HDIA 3G6JE 2GW5A 2IQAB 4PB9H 5SWZD 3KHOA 2NY4D 2EH7L 5ANMA 5IVXA 5IESL 3SOBL 1OHQA 1J05B 2UY6A 5I1JH 3GKZA 3C5SA 4P99A 5FO8A 3T3PF 1BQLH 1GAFL 4LLYA 4FQXD 2NY0C 5CLTA 4OBSA 4TSAH 1K5NA 3ARGC 5E8NA 3OKLB 3T0XA 4WFHD 4ZXBA 4OGAC 3UP1A 4RWHA 1P4LB 1YA5A 3D69A 3VE0A 4PGJA 3T2OA 1IC1A 2LU4A 3DXAB 4G43B 1B4JL 1NFIA 1MVFA 5I1GL 2WBJD 4GBXB 2BNQD 5EOCL 4NP4L 1T1XB 4JR9H 5HHVL 3IJYA 4NNPH 4YIQB 3T0ED 3UX9B 4AL8L 4MNQE 4OZGE 1EIBA 2CK2A 5C09D 3WV0A 2F5BH 1M7XA 2XZCH 2GTWA 4P2QA 3IS1X 3TIDB 43CAA 4IIQB 5J56B 3QXDB 2Z91A 2G2RB 1RIHH 2GITA 2X70B 1G0XA 1OB1A 1QNZH 5B38B 4M6MH 2QQQA 5I30H 3VMNA 1S7TB 3E6FB 4M9OA 2DD8L 4W4NA 3GSNB 4FFWD 3WNNA 2W0FB 5IW1A 4MA3B 4JG1L 2FRGP 2G2RA 1A7BA 5DD6B 4P4KC 2OQJA 5L8JB 3U6RA 5KSBF 4IRJB 4HC1H 3TJHD 3O4LD 4YHMH 4NCC2 2IH3B 3L1OL 4ZQKB 2F58L 1BD2D 3DX9A 4MVBD 3LPFA 3HNVL 5IP4A 1KT2B 2APFA 3O9WD 4ACPA 2HT2C 2ZUSA 2BXYA 1FG2A 3M8OL 5T3XD 5E08L 4O2FA 3LKQA 1Y6KR 3P4MB 3VXME 3VI4F 4LHUA 4NKIH 4CJ0A 2JCCB 2MQCA 1OW0C 5C0BA 3SGDH 4ZYKA 2CIIB 4R2GD 4JQXA 4FP8L 4LKXB 3LS5L 3EYOA 3VFPA 4XCFL 4XPTH 3FQTB 5IKCA 1OT2A 2R23A 3WKMH 4XVTL 3KLHD 3C60A 4BJLA 5DZLA 4RFOL 2VH5L 4WWID 3QH3B 3RHWK 4XCNB 4NRXB 1OWWA 2WWKT 5DFWH 4RRPG 2AQ3A 1SMOA 2DQGH 4BH7B 3ARWA 5CGTA 1AD0A 3BP7B 5GGTL 4JM2D 1NGQH 3TBTA 3OR6B 3L6FA 4AT6B 4G42A 2E27L 2HN7B 1AR1C 1OP5H 4U3CA 3OKLA 1JI1A 1F6LL 2QQKH 1JZ7A 1NAMH 3W5NA 2H6PB 5D72L 3P3YA 3JZ7A 1HILB 2BVQA 4MMZC 3BMVA 1UXWB 4D3CL 3FONB 1FQ9C 4JZJC 4MB5A 5IMMA 2YK1L 3A6CL 3LKRB 3QPXH 1R3JB 4X6BB 5C0GB 3VXRA 1TNNA 1YY8B 3FN0H 3H2WA 5CMAB 5E5MB 1YN7A 4NOFA 5F6HJ 2QKIB 5E8OA 1JGDB 4JRYB 2R0ZH 1CG9A 3FONA 4UOW0 2AKRB 1WJ3A 1T22B 1II4E 1KPVB 4AMKH 4JY6A 5F8QC 4PJ9A 5KTEL 3UCRA 1YEIH 5EOQH 1CE6B 1JK8B 3HAEG 2EYTB 5TE4L 1CG9B 3BGFC 3V7AG 2AABL 3B3IA 4TTGA 2OZ4H 4Z0BH 1UXSA 5KS9B 5DC4B 2X2YA 1S5IH 2XRAH 1I1AC 1SY6L 3Q0HA 1N59B 4JCLA 4XXDA 3JV4A 1L7TL 1BVLB 3VG9C 5I1CL 1MFEH 3T2NH 4OAWB 3QHZL 1FSKB 4GW1A 3BIKA 3GBNH 5C09B 4I0KA 1CF8L 5IB4A 3KPLA 3MA9L 2R29H 4JRYE 4MDJA 2VLKE 5T1DH 4OLZH 4QXGH 1DUZB 2R56H 4NPYA 3WN5B 1KPRB 3DXAD 1UZ8B 3H7LA 2YPLA 3FQTA 4PTTA 2P8LB 1GVIA 5JXEA 3QEHA 1A3LH 5I66A 4RQQA 5ISZD 4X4ME 4NM4L 1ZHLA 5I8EB 1BVZA 1GPOL 3KYAA 5TFSH 3BYYA 4S1RH 4LSRH 4N5ED 4ALAL 3NCMA 3DVGB 1PZ5B 3RZCC 4G8EB 1GOGA 2ILLA 1INDL 4DOHE 1CZ8L 1EBPA 3S37L 3CXDH 4U49A 2VQUA 4F33B 4WV1A 3F12A 5CBAB 1NJ9B 4UDUB 4JQVA 1EEYA 3QFDB 1IBGH 3FTGB 4LSQL 4OKVB 2IQ9H 3I50L 5JNYB 1F45A 3H0TB 1VFMA 1UKQA 4KDTA 5L0QC 4GRLD 5DXWA 3I3BA 5EBMA 3BPOC 4D9LH 4PLNC 1EO8L 3A6BH 2VKWA 3IFNL 3NMEA 4MJ4A 2GT9B 2QSCL 4LCWB 3O8XD 3VFVA 2BNRE 4F37F 1H5BB 4RMTA 4PGEB 5F97E 3BDBA 4JPVH 1WK0A 4WDIA 3IDGA 4KI1A 4MAUH 5GSRA 1LE5A 2RAMA 3L5HA 5DRXB 2AK4D 3QWOA 2X4TB 4XVTH 3VXMA 4JFEB 1FFPA 5HHQB 2N1KA 3DUUA 2WV3A 4EXKA 4KKAD 3H9SE 1ORQB 4PJEE 2WANA 4PJ7B 2YWYA 5EU7E 3WJLC 1OAKL 4G43A 1T5XA 3RPKA 1OQOA 4LPUA 5F7YC 2GAZB 3QUYB 1ZHKB 1KXVC 1RUQH 1DVFD 1HINH 3I02B 1BAFH 4OZIF 4A6YB 2YA2A 4OGYH 4TTDC 4OLWL 5I16A 5DUBA 3NGBC 5I73C 3QHFL 2VMFA 3VJ6B 5T3XE 4RZCA 2GCYA 2OCFD 4U1LB 2M2DA 3HI5H 3OXSA 5TE6L 3LMJH 1Q9KB 5IB5A 4QHKJ 4OCYH 2GFBA 2HLFD 3VXSD 5KANI 4P5KB 3RDTA 5IW1B 1UFUA 4NC2B 4H0GA 1JRHL 3KPRB 2B2XH 2BP3A 4NQCE 1HHJB 3QUKA 1F6AB 3MYZA 3KPQA 2Q86A 1CLZH 1ZOXA 3BN9C 5FA3B 4LKCB 3QHZH 3WIHH 2E7BA 2Y1VA 4L3EB 4N8VA 4NM8L 4LBEA 1XIWD 3B9AA 4MD4A 1JFQL 1I1AA 2QR0A 4P48A 1UCTA 1DN2A 2YXMA 1IQWH 4RMUA 4YJZL 3WD5H 3TF7C 2VERN 4G9DA 1P84J 5F1NB 5FUOL 3RGHA 3UTSD 4HJGA 3WFCL 3INUL 1CDBA 3WFEH 2Q87A 5B39A 4CNIA 1HYSD 2LVEA 4S1DD 1NAMA 4JLRB 4RMVA 3MNVA 3D1MC 4YBHA 2A6IB 2ED7A 4O58H 3FRUB 3BWAB 1UA6H 4PJDE 3CPLB 3H7BB 1QYGH 1RU9H 2HTLD 2R1YA 3QCTH 3CDGB 2YA0A 4L8CB 4WRLA 4F2MB 5F96H 3TN0C 4F15B 5FB8B 5GGVH 3HMWH 3FO1B 5B4MC 2PXYB 4JEGB 4JB9H 1AGDB 4Y19D 4QXWA 5JW3H 2F54B 4Z7NE 1XH3B 2NY2D 2VLLA 3C60D 5DVMA 1B0RA 2Z35B 4M6OL 1NGZB 2WBKA 4LNRA 5D7JB 3VE0B 2QQKL 3CFBB 2WINB 3GJEA 1DQDH 3MRHB 3CUPA 4QRPB 4HIEA 1DVFC 3RWIB 1UZ6F 3P77B 2SEBB 4P3CL 1N6QH 2I5YL 3ZDYF 5ESAA 1OPGH 1LWRA 4XVUD 4G3YL 1K4DA 1KBGL 2GSGB 2VRAA 3MXWH 1IKNC 1SVZA 1A7OL 1OCWL 1RZGB 5I1LA 2CUIA 4M8VA 1W72B 2D7TH 1PEWA 4N9GB 3QWQB 4KHXL 1CE6A 4EXPX 1U9KA 4R2GB 1DQLL 4L4TE 1NEZG 3O4LA 2Q6WB 5FHAH 1R3LB 5DRNA 4GG6E 3PV6A 2H1PH 1KCRL 1U8MB 3RU8H 4N90E 3EO0B 3VRLF 4B0MM 3CSYA 3QDMA 2DD8H 2ICCA 2VLJA 2BMKB 4XPAL 3GHEL 2BCKB 5C9KA 1S9WA 4HFUL 3NN8A 4YGVB 5BS0B 4FXLA 1J5OH 5CIPH 1NCAL 2NY6B 4Y5VB 1NUFA 3KPMB 2FSEB 1ZA3B 5GGQH 1IEBB 3PQYB 5IQ9B 4N0FB 3PWVA 4LEXL 1TQCC 9CGTA 2XNAA 5ITBH 4K3GA 4EVNB 5FYJU 5C0JB 1RK0B 3BX7C 4H20L 2Y72A 3D18B 1MWAA 3KYKH 5ENWB 4FQXB 2VISA 2HVJB 4DKEH 1T1YA 2P1YA 2VE6B 3E2HC 4K7PY 1CU4H 3T77B 3MLVL 4XCYA 5IUSA 4XRCB 4IOFC 5IKCB 1U91B 3LZFH 4LRIC 3BT2L 4X9FA 1NDMA 4LSTH 3C5JA 5D2NC 5HGAA 1GHFH 4QRSA 1EK3A 3QIUA 2WAHA 4K3EH 3LS5H 5FB8A 3O3DA 2O26U 5F7KC 3MRLA 3SDXE 3ZYJA 1CLYL 3UZVB 3VG0H 3TH4T 2EH7H 2QQLL 1QO3B 3IT8D 4I5BA 3RAJL 1NFDA 5K59F 1TJGH 3OKNB 4LCYA 1FLTX 2HLFC 2OI9B 1JMXA 1FYTA 3EDJA 4KKBD 5DVKA 1EERB 3K2MC 4KRPB 5E2WL 2APVA 2AERT 4TQEL 4WEMB 5CGMA 3C60C 1A7RL 1ZVSA 3BPLB 5I19H 1S9YA 4LIQH 2FBJH 3L1OH 2VDNH 3C08L 3SDYH 1XGYL 1NJ9A 4TOYL 1I75A 4ZSOB 2BOBB 1JV5B 4OCXL 4IHOA 1S7QB 2G5RA 3CFKB 4X6EA 5K9OB 1NGXB 1BGXL 4YHYB 3FQUB 1AIFB 4XH2B 1MIEL 4MJ6A 1CQKA 5DK0A 1HQ4A 4KI5D 1ERNA 4Z76B 3TCXA 2JJSC 4NKDA 5A43C 1DQDL 4OBRA 3MV7D 1EHAA 35C8H 5CEZE 3QUMA 5ALBL 5CILL 1DFBH 1H8NA 4MHHI 5C08A 4KH2A 5E1AA 5I1EH 4EIZC 1A7OH 2E7CA 4UT9L 4G5ZH 3FO0L 5IHLB 3IU3A 4JY4B 3QT2A 2K3TA 4FG6C 3G5XB 5F7UA 4HZAA 4K9EL 4HUUB 4HXAL 1W0VB 4LOUD 3EJYD 3HZVB 4XAWH 3RWHB 5KVFL 4Z7UE 2HFGL 5IFAL 4QYOB 2NTFB 3GMQB 4OB5L 2J8HA 5GPRA 4P23C 3SGDI 4J3VA 4JB9L 12E8H 5C86A 1BQLL 2HFTA 4XTRD 1CDGA 4DK3A 3BXNB 5CKGA 3K74B 3SO5A 4JRXA 3E0GA 5C0RH 5BQ7A 1NDMB 5C92A 4N0UB 1JZ6A 5D7IB 3P0YH 3QI9D 2HP4A 5E7FA 2YRPA 1UKTA 4XPBL 5D2LB 1CICC 4KMQA 5I8CB 3LIZL 3SCMC 2R23B 1F4WL 2CGRL 2VXUL 4Y2DC 5KVDH 1LDPH 5EUOB 5HDQL 4QRQA 1DBAH 1MREL 5DJYA 3FFDB 1CFTB 1O0VA 4JRYD 4R8WL 3FTGA 1JPTH 2W1NA 5INCB 4MXWH 4JY5H 3T4AA 3TT1L 5C3LD 1RJLA 2VLKB 4C54A 1FNEA 4N0YL 3O2DL 5DMKA 4E42A 3OF6D 5DC9B 1DN0A 2GT9A 2I07A 4F8QA 1A21A 2BOBA 5FOJA 4G80A 4U7SA 3NZHL 1A1NB 1R5IA 4LSVH 4PRHE 5BZDB 1FLRH 1ZWIB 3H6JA 3V6OE 5CEZH 3QNYB 3MNVB 5DD5H 3OAYH 4OQTA 1DANU 3U48A 1KPUB 1FNAA 4NO3B 1JN6B 2LTQB 4FTVE 1P69B 1ZGLA 3VH8A 4K94H 4X7CC 5T5FH 1T1WA 2IADA 5F7WC 3NGBB 3VRJB 3QULA 4FA8A 1LP9E 5JR1H 3MFGB 5F7NC 3UDWA 4OI7A 4NKDB 5JIKA 2PXYA 1XF2A 1PAMA 3PGFL 2BSRB 4W6WB 5GGSB 4L1HA 2ZCLL 1CT8B 1EUTA 3B4NA 2D31B 3P77A 2UZYB 4JZOB 3LPGA 5IBUG 4P2QE 3CX5J 4P2RE 3F8UB 4TN9A 1EO7A 3UYRL 4X80L 4GMSL 5T33L 4ODVL 1PEZA 1QA9B 2NLJA 3ZHDA 5IFJA 4L4VE 4YBLB 1CLCA 4IRJA 4QLRA 1WC7A 2Z92A 3FO9A 1Z9LA