3G5YA

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DILMTQSPVSMSLSLGDTVSITCHSSQDISSNIGWLQQAPGKSFKGLIYHGTNLEDGVPGRFSGSGSGADYSLTISSLSSEDFVDYYCVQYGQFPWTFGGGTSLEIKRADAAPTVSIFPPSTEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSSTPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 175 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yA01
1MRFL 4OCXH 5K9OA 5JR1H 3ZTNL 4OM0L 2ICWB 5SWSA 4LCIL 1NC2A 2H9GA 2A38A 3P77B 1FL5A 2NPLX 2QV2A 3ARED 4MVBC 4OIIL 4ZS7H 2WAHA 1BP3B 2G5BA 5CZVH 1FJ1B 3CLEH 2V17L 2N56A 5EU5A 3VJ6A 2BX5A 2VERN 1W8OA 2NX5B 3RRQA 1YQVH 4XH2B 4U6TA 4CDHA 4PJ8D 5I15H 3ULVE 4L4VE 1FORL 3EFFB 3KLAA 2HJFA 1JZ2A 4YHPB 4U6YA 3KPTA 4Y0GA 1NAMB 3VXUE 5D1ZD 3O41B 1AQKH 1KPRA 5KG9B 5DMIL 4AT6A 3LOWA 4YBHA 2F19L 1IKNC 25C8H 3GIVA 3JWDL 3D48R 3STZB 3WFBH 4L1DA 4H20L 4YGVB 4HS8H 2R2EB 4R4FL 3FONA 1YUHA 4XXDA 5B39A 3T4AB 1KGCD 1EZVX 2FX7L 3VWJC 3O2VL 4Q97A 3X3FH 4JQXA 5DA4A 2CDEB 3NA9H 5DMGD 5ILTH 4JGUA 1KJ2B 3OKDB 4LGRB 5CJBA 1EUTA 1I7TA 1LDPL 4KGLA 4KXZI 3VXUB 2VR4A 3KPRE 3RWIB 1INDL 3IFNL 4I8DA 2BMKA 4OCLC 3UJTL 1QBML 4QHUA 5EDXA 4XVSH 3PDOA 3BPCA 2BHZA 1Y18B 1P7KA 1MVFA 3QXAA 1MAMH 1KPUB 4HBCL 3U36B 1GH7A 1EHLH 5DWUH 2XTJD 1UZ8B 4WU5B 4KTDL 5IVXF 4X9FA 2Z31D 4Y4FD 1U8QA 1CIDA 3DHJA 4FQ1L 4P99A 2GAZB 5D7LA 1BBJA 1V7ML 1ZA6B 3U83A 1K2DA 4WVRA 4LLUA 2G9HA 4FQCL 3TM6A 4U1GC 3KPRB 4NKOA 3PGDA 1T1XA 1QPPA 2IANA 4LLWB 2YA1A 3P9LA 5C0RL 4OKDA 4IRJB 1VDGA 4AMKH 5AWNH 3BP5A 4XI5D 3VRIA 1T20B 3SDXB 1RY7B 1YC8A 3QNXA 5H35B 3ZDYF 1LK2B 3RDTC 4LLQA 1C12B 4LCCB 1XIWC 1INEL 1CICD 5CBEA 2D9CA 5L9DL 1MFBH 4J4PA 3G9AB 1MRCH 3BPLC 4WHYH 3ARBA 1IGIL 1IVLA 4Q2ZB 4Q9RH 1X5IA 3QO0B 3LMJL 4Y16A 4PGBB 1DEDA 2IPKA 3PJSA 1A6WH 4L3EA 5I2IB 4JZJB 4JRYD 3NIDE 3ZT6A 3CVHH 2UZIL 1QQDA 4LDOB 5JO5B 4YJZL 3HLAA 3UBXB 2D31A 4N1EA 1ZGLA 3IKCB 1FZKB 1XGRA 2BDNL 1FVCB 1RZ8A 2X4UA 4Z7UE 2EXWC 4K71C 1DQQA 1NDGB 4S1RH 1H5BA 1NUDA 4JHAH 4PJIA 3C2SA 3G08B 3SGKC 1FYTD 4LVNB 4P59H 3OHXB 2B2XL 3PWVA 1KB9K 1KTDA 3O45A 4M93B 1G7PA 1KYOK 3HNVH 3G04B 5LGJB 4QRQB 1MJJB 3MROA 2AABH 1ZANH 3L5XL 1V7NH 1IL1A 4G80B 4F7CA 2CRMA 2WSKA 3O6MH 1OGAD 5EU6A 3DJ9A 4Z7UB 1M4KA 3BO8A 4KTEH 1DUYA 5CEZH 1WZLA 4K8RC 5FHBH 1VEMA 3JUZA 4JCLA 4I2XE 5F9DC 4JFQB 4OTXH 4HJGB 3RWFA 1Q9OB 4YXKH 4KVNL 4I0PA 2Z91A 2HLAB 4OF6A 4Q9BA 4KUZH 4U1MA 1S7XB 3RVUD 2ATPB 3TEUA 5FYJL 1ONQA 2FWOA 3KHOA 1FL3B 1KGCE 3LKPA 4C59B 1N6QL 4YR6A 2ZSVA 5DVMA 4MWFB 1RHHA 2FATH 5F7DA 1HWHB 3IDYB 1ZE3C 2FEEI 3PHQA 5IV2B 1NUGA 1XF2A 4GKNB 2R29H 4YQXL 4GAYA 3O8XA 5D1ZB 3AXLB 1MCPL 5C07A 4ZNCD 3FFDB 4GAGL 4PG9B 4RBPH 2FYYB 1IGFH 4PLKC 3MJ9H 2GSIA 1P7QB 3B5GA 1U8HB 2C4XA 4RDQF 2ZUTA 3TZVD 3KJ6L 1MEXL 1FN4A 3C60C 5ICXA 3V4PH 5BVPH 3VFRA 5FUZH 3O6KL 4L8CA 2NY2B 1CDHA 2OJEA 3Q1SH 2XTJE 4AJ0A 3LN9A 5BVJB 1I3GL 2CLZA 4LARL 5BXFB 1S7TB 5J4MA 3G6JE 4MA7H 2YHGA 5JDSA 1F4WL 1H8NA 3EW3B 5J13C 5FDWA 1B0GA 3H9SB 3SBWC 4GO6B 5AZ2H 3ME0A 4EDXB 5A43C 3JBG7 4DVBA 4WTWA 2YMXH 3T0AA 2PTUA 4KJPC 5DJ8B 1QPXA 3U4BH 5HYSA 4GLRH 5E8PB 2VR5A 1KF9B 3PQYB 2FCBA 3W9EA 5DD5H 1E27A 3LEXA 2XTJB 5HYQB 1F90L 3MOAH 2Z31B 2BC4A 2MSPA 2ZG1A 5D5ME 2IGFL 2HT2D 3G6JB 4XC3H 4NO3B 3O6LH 1DFBL 3ROLB 4XTRC 12E8H 1KENL 4Z7NF 4WHDA 3F5WA 3CFJA 3NCFB 2QADD 4NQTA 3TH4T 1I9JH 2XXCB 3SKJL 1MIMH 1CFVH 4UB0H 5EWIL 5IB1B 4ZS7L 2EKSB 4KK9C 1FG9C 5CZVL 3IU3B 1T3FB 4GQPH 2EO9A 3O3EB 3IFPB 3F12B 5E9DD 4JRYE 1GGYA 3V8OA 4C83B 4MVBD 3WIFB 3NFPA 4QRRD 4MJ2A 1FNEB 3S98A 4KK6C 2VSCA 3TYGL 5HPMA 4LSSL 3FMGL 2BOBB 4YO0A 2BRQA 3OXSA 1ZT4A 2HTKD 1JBJA 1AQKL 4HG4J 1ZVSA 3GKWH 3CPLB 4JGMA 1FYTE 1VACB 1ZLUK 3WFBL 1RZ7H 2VDQH 4YBLB 3B83A 5ID0A 2DLGA 4MX7A 2WWKT 3O9WB 4J12A 4PJAE 4WDIB 2NCMA 3SDAA 4HS8L 3GBNL 3WHXB 3O81A 5F9OH 5ISZD 3L3IB 3M17B 3QHFH 3PNWB 4OQTA 1OGAE 3P0GB 3NA9L 4OCRH 1AGEB 3MGTB 2OLDA 2WV3A 1CE6B 1IAOB 1JGEA 5HGDB 1YEGL 1BX2A 5JTWA 3VWJD 5ITFA 3QFJA 4QTHA 1FAKT 1AY1H 5FK9A 3U7WH 1S7SB 5IVXA 4LRNH 2ITDA 1AGDB 4N8CH 4XVSL 3UYRH 5DK3A 3AM8C 3X11A 4X5WB 5IVNA 3NPSB 1QA9A 2I5YL 3D18B 5ITBH 2I60H 1NCTA 4PJAB 2OTUA 4GUPA 4XNZC 3LS5H 2VRAA 3TBVB 4F37K 2AK4D 3VXNA 3FKUS 4ZAKB 3MUGB 5I8EA 3ARZA 1R6VA 1KIRA 4N5EC 1HINL 5IHUH 1HHIB 2VXVH 4MA1B 2VXUL 1DP0A 3DWTA 3GJEB 4LCYA 3SDCA 2AJZA 2DQJL 2DQCH 2VYRE 2DQFB 2BNRA 2ZUQC 1RFDH 2AXFA 1XH3B 3MUJA 1HNGA 4U6VH 5DFVC 5FYKL 2J8UA 2BY3A 1KJMB 4AMKL 5AWNL 2NW2A 4XAWL 5D8JH 4L9LB 4OI7A 3LD8C 4AM0B 3P3YA 4PR5B 4YHIA 2OX5A 3BRFA 3F7VA 2Y36H 2EIZB 5C0AA 2WQRA 4NNPH 3JWOC 2FHBA 3AU1A 3JV0A 4KJYA 1MELA 4I0PC 4YZFF 1MRCL 3OJDA 3NTCH 5E6ID 3S3SA 3KDMA 1XIWD 4HKBA 1ZHNA 5DD3L 1AGCA 1OF2A 1PKQE 1CDUA 1A6TA 3GDBA 1A4JA 1PAMA 1FV1B 3HMXA 4IOFC 4EQ3A 5JW3H 2JE8A 1INQB 2DQTH 3RWCA 2WQ8A 4X7CC 3TZVB 4FQXA 4G3YH 5J1AB 3MODH 2DWDB 5C0ND 3LKRA 2COQA 3CVHL 2XWTB 4NKDA 3AUVA 3W5NA 3CXHK 1SY6H 4WHTA 3CXDH 4X5LA 1KEGL 2UUDK 2XG4A 7FABL 2W0PA 2PNDA 4S1RL 4OZFA 3GEWB 4O00A 5E8EA 4D8PB 4Z0XA 4JHAL 3KWWB 3P4NB 3CMOH 3T3MF 3DSFH 4XVJH 3GSRA 4Q6IA 4P59L 1KIPB 3OB8A 1E28B 1WAAF 4YFDB 2E8ZA 2UWEA 3ECBB 5E9DE 4AEHH 1DQLH 2E7LA 3HNVL 4WJ5B 5FYJU 4QRRE 1NCAL 2C3GA 4GXUN 3C8DA 3QUMH 4OLXH 2QKIB 3GMOA 4KTEL 4E0RA 5CEZL 2VABA 4PY7B 4DCQB 4PGCB 2QHRH 3D69B 1FVEB 2CR6A 4LVOC 3VGHA 2CJUH 2QADB 2E8YA 2YC1B 1QSFA 1MFDH 4KUZL 4ZPTA 4M8QB 3GK8H 3BHBA 4IRSA 4JFDD 3QBTB 3V7AE 1D5BA 1J8KA 1CG9B 5D1QC 5E9DB 1NEUA 3CFEB 2FIKA 5ISZE 3TNNB 3O6FA 5I19H 1P4IH 3THMH 5IEKA 1SEQH 4QRRB 2FH6A 4XBGA 3SKUD 4LNRB 1DN0B 1HSBB 1A14H 1IC5L 1JTPA 3D2UA 3I6KA 2Y7QA 3S34H 5K59E 5DHYB 4KZDH 4OLZL 1U8MB 3EZJB 1UGNA 3B2UC 3QPXH 4Z7WF 1T0PB 1I3UA 4HMCA 5I6XC 1ZHKB 4PJ5B 1QR1A 1BZ9A 1C7TA 3FCTB 3OGOE 4LEXH 5EFIB 1UACH 3V4PL 5FUZL 2AV7B 4PLKD 5HGAA 1FNGA 3CFDB 2Z8SA 2AK4E 1F11A 3Q1SL 4F33A 4KFZC 4LVHB 4JHWH 5ISZB 3C60D 2EYTA 3D5OF 1JTOA 1WC7B 3ES6B 1Q9KA 4I77H 1PDKA 2ZCHL 3E2HB 4XNQA 1IM9D 1F02I 5IQ7L 2EYSA 2VZTA 2VAAA 4HX1A 5TE6H 4A2MA 5IB3A 3NZHL 5D96B 5AZ2L 2HJKA 1LNUB 4BJLA 2ZUYA 1B9ZA 4U33A 1KACB 5ENWB 2DOCA 2A83B 3MLRL 4IMLA 3E1F1 2DLEA 4P2OA 2VKWA 2G2RB 4OT1H 3SGEI 4YC2C 3ZKMC 1X3DA 3N85H 3ZKQD 4F9PC 5L6YL 2AK4B 4NDMA 5JMOC 1HHHA 2P8MA 1X4ZA 4M7ZB 5L0QC 12E8L 4U1LB 2WLZA 3BIAX 2EDFA 3OPZL 4X9GA 1KG0A 3L5IA 5DJ2A 1TVBA 1FAIH 2VNCA 1I9JL 5ID1A 1MIML 2ED7A 2DLHA 4UB0L 3VMPA 4AENB 3DMMD 5K9KA 2ZOLA 3GM0A 2B5IB 3JTSB 5F3BB 3MUZ1 4KK9D 5DUBA 2A0LD 4GBXD 2WBJA 1ZHLA 5DMKB 2X7LA 5CINH 3KPOB 5DUPH 3UTQB 1R5WB 1B6UA 4FXLA 4KHTH 5E8DH 3HUJB 3LRSA 1GAFL 2XWJB 1J18A 3IF1B 4KK6D 3QDGD 4Y5YC 5IK3B 5DJZA 4M5YL 5JOEA 1E0OB 1RZ7L 1OARL 2XNAB 4R2GD 1QNZL 5EULV 2YUWA 3CK0H 3MLZL 1U8IA 5JPNB 5DT1L 3ZYIA 3QHFL 5F7UA 4PJGB 4LSQH 1OD9A 1EFXB 2CIKA 2LV4A 5J11B 4UV7L 3MRFB 5AAWA 4G5ZH 1BVKB 2V9TA 1AY1L 5KAQF 5JZ7C 1RURL 3U7WL 4G6FD 5DK0A 5CIPB 1VADB 4JZOB 3MBED 3DVNB 4LGPB 4E41B 1OAXL 1H0DA 1XCTA 4JFDE 4KKAC 2R9HC 3FQUA 3U0PB 4JANA 1UEYA 3V7MA 2P42B 5DJYB 4TNWF 3VMNA 5DSCB 1WIPA 4K3GA 1YN6A 5I76A 3J7HA 3RGVC 4KK8C 4P9HL 5IHUL 2VXVL 2ZSWB 2YPLB 2DQCL 2W91A 2DQEH 1TZHA 4WFED 1A9BA 4S2SA 5GS1C 2YD2A 1ZSDB 2XTLA 2XZQH 1X7QB 5AYUH 3T65A 4IDJH 4M43L 4URTB 5DJCB 1P4BH 3IJYB 3K8KA 4ZUWA 4P48A 4S1DC 4LPWA 4MDJB 5CLWA 5DFVD 2VDKH 3O11B 4Z0BH 3QG7H 4PJCB 3KXFA 3O4LD 4ONOA 4CVXB 4E9LA 4WI8A 1K9TA 4PTUB 3H9ZA 4WUUD 3NIGF 5JW3L 3EYFA 2Q86A 1CFSB 5GGTA 1RIUL 3JZ7A 1QZ1A 3O4OB 1ZLUH 3EFDL 1BQHA 1WT5A 3R4DA 1E4WH 3UTPD 1CLZH 3RL1B 4QLRA 4PREA 2X4PB 1OOAA 4XNMB 1UA6H 4HWEH 3WUWG 1G7HB 2FECL 1WAAA 1CU4H 1Z2KA 2JKXA 3QCUL 4XP6L 3L6FB 1F00I 4P2QA 3ESUF 3T4YA 3HNSH 3RVVC 1C7SA 1F4XL 4UU9B 2Q76B 5IJVA 4LCWB 4GW4A 5JNYA 1RAMA 3HS0B 5BS0D 5IR1B 4HD9A 4NHUB 3WHE1 1BD2D 3CMOL 4K94H 3D1MC 3DSFL 5D7IB 3H0TA 1GSMA 3QWOB 1DCLA 1JF1B 1TJGH 2GHWB 4Y2DD 4AEHL 1DQLL 4P3CH 5J89A 4G7VL 4XCCH 5GPRA 2E27L 1G7LB 4HSQA 2AJ3A 4PJBE 3CCHA 3NIFF 2AEIT 1H3UA 1NAKH 5DTFA 5EU4A 4ETYA 2EEDA 1PVHA 1MJ7L 4X6DA 4NHCL 3QUML 2VE6A 4TUKH 2H1PL 1T1YB 3UTTA 5D1XB 3OGCA 5CMAA 4ZFFA 4I18B 4HJ0C 4LEOA 1EK3A 3QDGE 2CJUL 5K9QG 4DWHA 3Q48A 3RBGA 5E4EB 3SDXF 3VI3F 3BWUC 1MFDL 3CX2A 3GK8L 4WO4B 3DMMB 4X4MA 3LB6C 1L9MA 3L3JA 3MRPA 3N9GH 4K3JH 4M8VA 1KJVB 3PWUB 4J3SA 2JK5A 3PWJB 1JWUA 1SYSA 3EDEA 1Q0YL 3S35H 4PJBB 1HWGB 3TN0B 5I0DA 4GBXB 4P4KB 5D1QD 3ARQA 2BSSB 1A14L 3QNZA 5DJ6A 2ADJA 1PZ5A 4ZDHA 1FNSL 1R5VB 4UOW1 5KVGH 4MJ6B 4KZDL 1V05A 2CLRA 3QCVH 4W70A 2FO1A 5E1HB 5JIKA 3QDGB 4B50A 3QPXL 3ET9F 2IC2A 2CO7B 5TQ0H 1UXWA 4R2GB 2YD4A 4UIKH 2WBJC 4EIGB 4M1CD 2F58H 3B2UD 3BOVA 3IFOA 3QEGL 1CL7H 3C9NB 4PRHD 1MVUA 4Q9CA 4JHWL 3VDBA 4L4TD 3BUTA 1IGCH 3IAQA 3VXSD 1ZWIA 1KCSL 4I77L 4BA8A 3CXHJ 3KPPA 4WFEE 1LK3H 1KN4H 5D70L 3MBEB 5H94A 1OQOA 4O2EB 1KB5B 1IM3B 3RWEB 4MD5A 3MLUL 3RWGA 3L5WB 3LV3A 4I5BA 1A3LH 3N85L 4YNYB 2YSSB 3NCMA 4OZ4A 2BSED 1O7SA 4EI6A 3ZKMD 5IUSA 4CU8A 3JVGA 1RVFL 3O4LE 1G0XA 1HHGA 4LSTL 4WUUE 5KSUA 4JFED 1DE4A 1YJDC 5EOTB 4DZ8B 1I3VA 4P0DA 2GK0B 5I66A 4JPIB 1WICA 3ARDA 3QIUB 1YEKH 4FZ8H 4JREC 4H5SA 1YNLH 4ORGA 5F1OB 3UTPE 1LO3H 3GGWA 5T1KD 5IMMA 5GGQH 1JZ5A 4JDVA 4U31A 3ULVH 2HYMA 5DUPL 1HI6A 3L7FB 3NAAH 3O4LB 1AGBA 1NEZA 2X40A 1JZ3A 1IC7H 2EYRA 2ZPKH 5TDPA 1SMOA 4Q7DA 4KY1H 4WUUB 5BS0E 1N8ZA 1MCWW 4EUPA 4OM1L 4W68A 3BAEL 1BD2E 3ELAT 3VXRA 4X9HA 1NANH 3C87A 1F6AB 1IKFH 3UO1H 2W60A 3CK0L 2PCPA 5CEXB 4YLQT 3STBA 2KKQA 4MD0A 4DGIL 5IP4A 1NGZB 1U2HA 2BOCA 3FL7A 3G5YB 3NFNA 5IBUB 2W9LA 5A2JH 1RQ5A 4YHLL 1VFUA 2RFXA 1TCRB 2F5AL 3IFLH 1NDMB 1WZ1L 3UJJL 1ZHBB 4LPYA 5I1IL 5BS0B 2VB5A 1GZPB 4DEPC 1ND0B 1YEDA 5GS2H 4WY7L 3QJHA 1JGVL 4L29A 4OQ1A 3U4EA 2VZSA 1CYGA 5JZ7D 4XMLL 4XC1H 1U95B 1RD6A 4Y2DB 5E1AA 3QQNA 4U1JA 5EU7E 2JJUA 3DTXB 1KXTB 3BGMB 1KIQA 2NYYD 3GHEH 3QXDA 1N26A 3AS0A 3MMEA 4U3XA 2ARJQ 3JV4A 2NTFB 2B4CC 1U8OA 2DQEL 5ESQB 5J8OA 4MJIB 3WL9B 4WEBL 4FNLH 1A6AB 2BVPA 2VQUA 4WGVB 2VMFA 1QSZA 4HUVA 5AYUL 1CT8B 2G75A 1CGUA 5GRYA 4Y4HA 5E2WH 2XACC 3VXSE 2IJ0C 1DQML 4KI5F 5EH1A 1OY3B 1P84K 4S1DD 1WBZB 3MXWH 4WV1A 3B5HA 1DVFB 1FRGH 2J88L 1RJLA 3MJ8B 1EEYA 5E2UH 1HIML 4HGKC 5FCUL 3RKDC 4KROB 1AXSA 2V5MA 4J8RB 3QXUA 4OBRA 3QIWA 5DLML 1E4WL 5HHMB 1S9KC 3MR9A 3WFDL 4LDEB 5I17A 1TENA 1H3GA 2E9WA 2O5XH 3WO3B 5EU3A 3VXSB 3OR6A 3VFNA 2DBLH 3TT1L 2V7HB 4KPHL 1TJHL 1Q9LA 2GFBB 4D0DB 3HNSL 5EO9A 3T0EA 5LWYH 4LLYA 5T1LD 3TJEH 4AG4H 2C4FT 5KSAD 4JFEE 1VPOH 1G7QB 2A2QT 1JV5B 1FVDA 4K94L 1J8HA 3RVVD 4DOHE 4LOUD 4BSVA 4KV5F 1OAYL 4CW1B 3LEYL 3MLSH 4P4RB 5IM7A 5CFHA 5CZXC 4P3CL 3DVGA 4XCCL 4KRLB 2P24A 3QZWA 5CSBA 3HE6B 4FQJH 2D7OA 3NOIA 2VLKD 5SX4H 3IXTB 5B4MC 5KS9E 1E4JA 2DI9A 4OB5L 1RZJC 2DWEB 3MV8D 5GGRY 4YDVB 3KYKL 1BFOA 2IFFH 4OGYH 5T1DL 1VFBB 4R90L 4ODVL 4Z7VE 1NGXB 1NBVL 1QHOA 3WKMH 3DIFA 1BQUA 2PR4L 3BQUD 4HJ0D 3U9PH 4FZEH 5JXEC 4KKLD 5F88A 3BYTA 3N9GL 4F3FA 3HC0A 5I1KL 3PIQB 1IEHA 1QFWI 3RI5F 3ULUD 3NGBB 2IG2H 5D7JC 5DRWA 1UCBH 3S35L 2VO5A 1CVRA 4MYWB 3DX7B 5KS9B 4P5TA 5GRZA 4PJDF 2R4RH 2EH7H 1D5ZB 4HPOL 3D3VB 3K2MC 4NQCB 5KVGL 1HSAB 1FFPB 3MCKB 1O0VA 3E6HA 3QCVL 2QJDA 3BH8A 5C8JA 2V5YA 2AJVH 3I2CH 3LS4H 5E2TH 2GT9A 4HZLA 3HR6A 5D6DA 5GRVL 5TQ0L 3HPJB 1MIEH 5FCSH 3SE4A 1I7ZA 2WW8A 4UIKL 3ZHDA 1F3DJ 1F3DH 1MCCA 2F58L 5DO2D 5KW9H 2BVQA 3RVXD 1CL7L 4UQ2A 5JOFB 3EO1A 4QTIH 1SHMA 1P6FA 3QHZL 3IGAA 1IGCL 1MHHB 3IXAB 2W07A 3QUXC 4QHNA 5CUSH 2XI9A 5F7YC 4CVZA 5JXAL 1T7XA 1IT9H 3PHOA 4J3VA 4Z7OF 1RUPL 1FGVL 1LK3L 3N1QC 4Z95H 2BXZA 1AI1H 5TE7L 4X80H 3RY4A 3NH7L 5GSVB 3VFTA 5L2KB 4GRMA 2VH5H 4MQXC 1MFEH 3GO1H 3BKMH 4O4YH 4X7EC 3D87B 1A3LL 5GSRA 5EZIL 4HKZB 2AXGB 3LKQB 2FBJL 4QYOA 4ODSL 1J88A 3WSQL 3QAZC 4I0CC 3EHBD 2ZWLT 3TESA 2W0FA 2P46B 1DBML 4F7PB 3TF7C 1X5ZA 2DM4A 4LSVH 4N90D 1LE9A 4NQDA 5KVFH 1YNLL 1KCUH 4XMKL 3QQ4B 5DD0H 2AEQH 2OMNA 1P9MC 3WDJA 4OD3L 3REWA 4UOJA 5GGQL 4S0SD 3LQAH 5DHVH 1WK0A 5IB5A 3KPMA 3ZE1F 4PJXA 1FL6A 3LKOB 1CGVA 4TUJA 5D93B 4P46A 4N8PA 4OIAA 3T0WA 4NRZB 4HH9A 1IC7L 3TPUA 4JY4B 1A7QL 1A6ZA 3N50A 4XNYH 4X0KB 2E9IA 5HHXH 1JJUA 2JJSA 3UO1L 1MHCB 3VFVB 1KTLA 3WHE0 4Y4KB 3CFBB 3DX6B 3HRZA 1DUZB 2DLIA 2CDFB 4PJFE 3W9DA 2VLMD 2VLKE 4NN6B 3VG9B 2EEAA 3OKMA 4NNXB 4RMRA 1WWCA 4PRPA 2IBGA 1EHNA 2Z92B 3MV8E 4G8FA 4RGOL 4V2BA 2VC2L 1KELH 2J6EH 2WK2A 2LU4A 1A7NL 4LKXB 2X1QA 2DLFH 5KSAB 2QTEA 5J6HB 4K07A 4ZUUA 4FFWD 4JVUA 1H3PH 4HK3N 1MCWM 1MFCH 3V0AC 4POZC 3ZKSD 1I3RB 3VH8A 4IIQC 3BD4A 4HK0A 1Z9OA 2J2ZA 2ZOKA 2AJYL 1PYWB 5CJQH 4Z8FL 3ULUE 5FGBC 4APQB 5F71A 4C56A 4K7FB 1R3KB 4MXQC 1NUFA 4PJFB 1GOFA 4FQIH 2VLKB 1S7UB 1N2RA 3GHEL 5CSZB 1Q8MA 2C3XA 2OM5A 4P23D 3MV8B 5A3IC 1QO3B 2R2BB 1YEJH 4JPKL 5ESVB 2BFVH 4CNIB 1WCBB 4HUUB 1TVDA 4FNLL 3S5LB 3UZEA 1TPXB 4XX1E 3TVMC 5CJXA 1PQZB 1NKOA 5AZEH 3BH9A 4YDIL 2E7HA 5HDOA 2K7QA 3O3AB 4PP1C 2YK1H 1I8IA 2R1XA 32C2A 2WUCH 3T08A 2BNQA 2PYEA 3LRHA 1YN7B 1TZIB 5DVKA 2FDBP 35C8H 2YPVH 3HUJF 4HEPG 1ZVHA 3OZ9L 5GJSH 4J6RH 1EERB 43CAB 3ARUA 4S11A 5C7XH 1A7PH 1IQDB 3WV0A 2JB5H 4R4NC 1VGKA 5E03A 3KPQB 1GRWA 3I02A 1UH4A 5DJ0B 1YMMD 4HIHB 4PJGF 3QDAA 3RKDD 4P5TC 1A1MA 1UADC 4OV5A 4GKSA 5EBLA 1NMBL 3H3BC 4LSPH 5F8QC 5B21A 4P5KA 4OAWB 5MEOA 3OKNB 5GS0D 4M6OL 2AEPL 3UZVB 3QG6A 4HHAA 3DBXB 1QBAA 5I71B 3GJFB 2EDDA 3QUYC 4HUWB 3TJEL 5F7HA 1UKTA 3CVHA 1I1FA 1AHWC 4HUXA 3HRPA 5B8CC 4MXVE 1UWGH 4RMWA 4RMSA 2PYFB 4QHKI 1UXSA 2APXA 4A6YB 4C4KO 1T66D 5ETUA 5DYOA 4JG0H 1B0RB 3T1FA 3K80A 1TTUA 1R0AH 1D6EA 8FABA 3P73A 3SE3C 3V6FA 2LAGB 2C26A 3UTSA 2DJSA 3ARGA 2R0WH 2CMRL 2VLRD 2IFFL 3CSBA 4DAGH 3DXAA 4OGYL 3K4DA 5HYJD 5FM8A 5EO1A 2AKRB 5B4MD 3NBNA 1F4YH 2PTTB 2F15A 3OX8B 1R5IB 1OT1A 3GMPA 3WKML 2P5EB 2NLJA 3KHQA 4LHUD 4N0CC 2ESVB 2R69H 3D25B 5L8KB 4Y8DC 4PJDA 3U9PL 4FZEL 3SQBA 3WO4B 3N1PC 4RFNC 2AV1B 1FBIH 3IS1X 1YNKH 4LHJB 3BEVB 3IAPA 2CKBH 2ID5A 2VLME 1UCBL 4PJCF 2EDOA 5F89B 1S7QB 3SEPA 3ZDZF 4BKLB 2A6KA 5FM5O 4PGDA 4D2NA 4X7TB 1O7VA 2PN5A 3WBDA 1P4LB 1GPOH 5E5RB 2EH7L 3FQRA 4JFFA 5HI3D 4GRLD 2APFA 3QDJA 3Q6GH 4M3KB 4AIOA 5EZLB 2AJVL 4A6YL 4HWBL 1CXHA 2X4SA 3IU4H 5E2TL 1A2YB 5KW9L 2CD0A 4IOIA 3SDDA 4P46C 5C9KA 4NOFA 3BMWA 5GISL 3GB7A 3DV6B 3RJQB 4X4YB 2X05A 1MI5D 4R0LC 5CUSL 4O2CA 2FGWL 3ZO0A 3D9AH 5KN5A 1EAPB 1T7VA 2WZPD 5D7IF 2VL4A 1M05A 2VZOA 2R15A 2FGZA 4Z95L 1AI1L 3HKFA 4X80L 3B3IA 3L9RB 1Y6MR 1MCFA 1T4KB 2EEBA 1AD0B 3CSPA 1FNLA 4YWGH 1KUMA 2V5TA 4HJJL 3DUSA 4J1UB 4ZFOB 4NQEE 4DFIA 3H6JA 1I8KB 3EGSB 4PBXA 1IGTA 3GSWA 5IMLA 1IAKB 1A8JH 1TNMA 1GIGH 3EZ8A 2K9UA 4XP1H 4LSVL 1CR9H 3HG1D 4JO3H 3U9UA 1UJ3C 2QQLH 2APTA 3FFCD 1RZKL 3VWKA 1YDPA 1BLNA 4HC1L 1JWMA 4Y5XA 5DVNA 3WXVH 4JEGB 4YAQB 4EXPX 5C09B 3ROOA 1YMME 4ZFGH 2AEQL 3PWLA 4NWTH 2H2PC 1FG2A 2X70A 3IDJB 5EIQA 3EYQD 1G6RB 2ED8A 1U93B 1N3NB 4HDIA 2ENSA 4NQEB 2HA1A 5IW1B 1X5HA 2Z9TA 4R26L 1CXFA 3CUPA 2X4TA 4WWKB 4YDLC 1SBSH 2HKFL 4YHNA 2IH3A 1NGQL 4QWWC 2IALB 5CIPH 3OKOB 4XNYL 5TDOB 3GMRA 3QRGL 1S7RB 1LEKA 3S96B 1K8DA 2E6JA 1YMMB 4JB9H 1XF5A 4FHBD 3S4SG 1UYWH 5C0JA 2XWBA 1G9MC 4GT7A 4RZCA 5C0CD 2A6DB 4OLYH 4HS3A 4JO2H 5GXBB 2FJGA 4WHCA 4QHLA 5I18H 2VDLH 2VLRE 5C0EB 5HYJE 5EBWB 5KVMC 2DLFL 5GIRA 4R97B 3PE9A 2QSQA 1ZLSH 3BN9C 3SDYH 3DI3B 4MNQD 4UTAH 1MFCL 4K8RH 3NCJH 3MCLL 1KN2H 3MRHB 3T3PF 1FPTL 5CJQL 4RX4A 4Z7QE 4QXGL 3L3KA 2CRIA 3QFDB 5I8OH 4POZD 3VXQB 2Z93A 5ANME 4KKNA 3H3PH 5D7SL 4MQ7A 1BWMA 4YEFA 1EFQA 3Q0HA 1YEJL 2ZUUA 5D6CB 5EUKA 2FX9H 2BFVL 5TE4H 1MQ8A 5HYJB 4LMQI 4HKJB 3MA9H 5C08B 2F5BH 2GJZA 2F54A 1M7IB 4LHUB 2D4FA 4XP4H 4Y5VC 4XPBH 1JUFA 3DROA 4PRBB 3V4UH 3P9MB 5AZEL 4DUVA 4UDUB 5GGRA 2EZ0C 2PXYD 5L2JB 1AO7D 2W65B 4PJHE 5F1IA 2WUCL 1UVQA 4PB9L 1BGXL 1T5WA 3MRBA 1CD1B 2F53D 35C8L 5EC1B 1FH5H 3CH1B 5ANMB 1MI5E 4J6RL 2R8SL 4HIJB 3V2AR 4GMSH 3WJJC 4M5ZH 1TQBB 4OZGB 4N0YH 1A7PL 4XGZB 4YPGB 2JB5L 3PG2A 4GRLB 2HN7B 2VDNH 3BDBA 2D7QA 2NXYC 4GS7B 4NQXB 5L88L 4ELKA 2NY1C 3ZDXE 2ZZUT 2WWMC 3C6LA 4QXUH 1BOYA 3I9GH 3OAYK 4F8QA 3MFFB 3BRDA 1S8DA 4PJHB 2YZ8A 3AAZB 1QG3A 2Y5TA 4LSPL 3JV6A 1NGWA 4GW5A 4OZIB 2WP3O 1YYLH 1YY8A 1HILB 1MI5B 1UT9A 3OF6D 5E7FA 1HE7A 5TF1H 2VSDA 5BV7B 3OR7A 3FFCE 1TMCB 5H37G 5DEFA 4BH7B 2PO6C 4NBXB 1GYAA 3DYOA 2VL5A 3GSOA 3QUYD 1RMFL 4XPFL 2JCCE 4GG6F 3UTZA 3FO2A 3PV7A 3TFKC 5I75C 3MLTA 1I1YA 2VXQH 1U92B 4WTZG 4R6UA 1XGUB 2XFXB 1QLFB 1DSFL 2MKLC 4JAMB 4WFGE 5DEZA 4BQ8A 3MZGB 4R8WL 1NSNL 1Y6NR 3W0WD 5IFJB 4ONHA 2R0WL 4NZJA 3RTQB 4NN7C 3TNMB 1T7WA 5AUMA 4NCC2 1FC1A 1F4YL 2XA3A 2EC8A 4P2RD 3FFCB 2A1WH 2CK0H 3KG5A 3MRGB 4MA8L 3WXWL 3CZFB 2R69L 1CFNA 3QUMA 1EEUA 1RSFA 4JRXB 2Q7YB 3SO5A 4G8GA 5AD0A 3RNKB 3GMMA 5BCAA 1FBIL 2ICWI 3WDIA 2DDQL 4N0CD 2CKBL 2I07A 1X5LA 1WITA 5ALCH 4XMPL 2XY2A 4LRIC 5D2NA 1GPOL 3QIBC 1M7DB 1NCDL 2JJTC 5CGYC 5E5MA 4Y5XC 5K9JL 5JW4M 4WU7B 1YECH 5H37H 3MOBH 5HHOB 4MNQE 3IU4L 5GRUH 1IQWL 3RL2B 4FQHA 4ALAH 2HVKA 2A6IB 2PTVA 3OBAA 1MCQA 1LVEA 5F97E 3RGHA 1X5GA 4NO2A 3BPLB 1JHKH 2VZ1A 1F13A 5GRJH 5IG7A 1AFVL 3IETA 4JO4H 3TA3B 1UZ6F 3FOLB 4KC3B 2YS4A 3O3DA 1FCCA 3B6SA 4ODXB 2ZUXA 1C16A 2MKWA 3L5HA 3CFIC 4ZSOA 3B9VA 2AI0L 4MNQB 2ATKB 2XRAH 1GGUA 1PY9A 1AO7E 2BCKA 3FQNA 2F53E 3KPSD 1CE1L 1W2KT 4L3ED 3LEVH 1D9KA 2NQCA 4Z76B 2HT3D 3ARYA 1S9XB 2GY7B 2XZAH 2UYLA 5IKCB 3IJSA 4PRAA 43C9A 2FJHA 1GIGL 3VGEA 4DGYH 4XP1L 2ADGB 1VGEH 1FHGA 2XN9B 3JWOH 1NKRA 4PPTA 1SBBA 5C0DB 4LL9A 4JJ5B 5KSBF 1WBXA 2V2XA 2IMNA 5H2BA 3WXVL 3QI9A 4NQSB 3BW9A 2PXYB 3X12B 1QSEA 1T83A 1CLOH 4NWTL 1AO7B 5KOVC 3U0TB 5HY9B 1RK1A 4P9ML 2QR0A 2XQYG 1PG7H 1U8JA 4Q58C 2F53B 3BVNB 3OKEA 5IW3A 3FN3A 2P48B 3M8OH 4TSBL 5DC0A 2H2PD 3P0VL 4TPRL 5MHSD 5C0GB 2HG5A 3CFCH 4L3CA 4CMMA 2R1YB 4YHZH 1F2XK 3D0VB 4OFYA 5EZJA 4EDWH 1MUJB 4L8SB 5M94B 2R2CA 5K9OB 1J1XH 5SWSB 4QWWD 1NC2B 2H9GB 3FHAA 1NJ9A 2DQHH 1FL5B 4FQLL 3TO2A 2G5BB 1CN4A 4LPUA 4D0BA 4LP5A 5I8CA 4OLYL 4TULH 4UNVA 4JO2L 5EU5B 3VJ6B 4F2MA 5I18L 3W0WE 1G7JA 3VGAB 2VDLL 3HE7D 4UI2A 5MP6H 5CKGA 1EPFA 2HJFB 3KLAB 4P2RE 4MGXA 4U6YB 5JOPD 1A5FH 3SDYL 1Z0MA 3EOBA 3MRLA 4YHOL 3HI5H 1KPRB 4K8RL 5C07D 5B38G 3PL6A 3NCJL 4UBDC 2CUMA 4AT6B 1KC5H 3TH3T 3ZTJG 5E94A 4FP8L 3GIVB 3SKMA 5I8OL 1GJIA 5CEYA 4BQ6A 1GGCH 1W0WA 5AEAA 2RAMA 3GI9L 4JM2D 3FONB 1YUHB 3DRTA 3MLVH 4XXDB 5B39B 4H1LG 4WENB 3R8QA 3RVWC 3MA9L 1I1AA 4OI9A 3CU7A 1NBZA 4PRDA 5JHDD 3IYLW 1I7TB 4XP4L 3A6OA 2HRLA 4Q6YA 4TTDD 3B9KA 4W6XB 2BMKB 3BESR 5EZOH 3H7LA 4QHUB 1BEYH 3PDOB 4LU5L 3BPCB 1K4DA 3QDHA 3RZCA 1P7KB 3VFOA 1FH5L 2EZ0D 2H32A 1H3WM 3BN3B 4EBQH 3QXAB 2OP4L 1A47A 3TP4A 4GMSL 2A9NH 1ROWA 2VAJA 3C6SA 3NABH 1I8MA 1KCRL 2VR9A 2O26U 1U8QB 4HULB 1TITA 5SX4I 2VDNL 5D7LB 1BBJB 5CAYB 1K2DB 1JPFA 1T04A 3OKKA 4LLUB 1A3RL 2G9HB 4ZFZA 3I9GL 4NKOB 3PGDB 1T1XB 2NXYD 2K7PA 4D0CA 2IANB 2NY1D 3P9LB 3KPSE 5D2NC 3RUGA 4L3EE 4DW2H 1A6PA 2G5RA 3BP5B 3WUZA 4O58H 1NFKA 3VRIB 2DQDL 1XFPA 3WJLA 3QNXB 2E3VA 4GG6A 3VFMA 3P0YH 4H1LH 4LLQB 4NKMA 3WN5C 4P3DA 5TF1L 3CU1A 5CBEB 1LEIA 4KQ4H 3SE8H 3ARBB 2ZCKH 4ZXBA 3S37L 3PWNA 2OR9L 3FT4A 1C5CH 2VXQL 2GTZA 3K4AA 3WE6A 1HZHH 2PO6D 4LLVA 4ODHH 4Y16B 4M6ML 5SX5K 2FEDC 4XNUL 2IPKB 3PJSB 3SGJA 1KLFA 2VDMH 4L3EB 4NN5C 3TYFA 5JMRA 3SDAD 2D2OA 4CDGC 2AGJH 3KR3L 3FRUA 5MHSE 2Q20A 1QQDB 1NQBA 3MV7D 3HLAB 2D31B 3P11L 1ZGLB 1JGLL 1XGRB 4OZFG 1RZ8B 2X4UB 5JHLH 2A1WL 2CK0L 3QFJD 1DQQB 1J0YA 1H5BB 1FO0H 1MNUH 4PJIB 3AB0B 5HVWA 3PWVB 3UC0H 5ALCL 1T6VN 1KTDB 3O45B 4KJWC 4V1DA 4XCFL 1G7PB 2HAZA 1HCVA 2BRRH 3MROB 3GSQA 1IL1B 4NO0A 5J57B 2YWZA 4W6WB 4F7CB 1MH5A 4KMTH 5EU6B 2YD5A 3HZMA 4P5MA 5T3XD 3BO8B 4PS4L 3SCMA 1DUYB 3WUWA 3QIBD 2NY0B 1GOGA 4JRWA 5C07E 3SDCD 2R0LH 4PRID 2VITA 3RWFB 4I0PB 2Z91B 4OKVA 3SPVA 1JHKL 1U41A 2DJUA 4U1MB 1L9NA 2MPAL 3N1FC 3V6ZA 4IBLT 3QP3A 1ONQB 2FWOB 2PKDA 5ADPH 4RSVA 3LKPB 1CCZA 4TTGA 3BUYA 4YR6B 1T22A 2ZSVB 2VISA 1RHHB 5F7DB 5HHVH 3RPIA 5C0AD 1IFHL 3PHQB 2CIIA 3BP6A 1XF2B 1PG7W 4F8TA 4MNHA 5FA4A 2G60H 4CADA 4U6XA 4GAYB 1A6VL 2VIRA 3C5JA 3NCBB 3O8XB 4M4RA 5C07B 4U1KA 3UX9B 2GSIB 1G7IA 1RUKH 3FOMA 4RAUA 1FN4B 5ICXB 4FQXD 3UMTA 5T3ZL 3VFRB 3LEVL 3LZFH 5KSBA 4OLWH 4L8CB 2XZAL 2OJEB 3QUZC 5F7KC 2DYPA 4JQIH 5BW7A 5HJ3A 5E7BA 2CLZB 3A6CH 3T2NL 3FRPG 4ESKA 2FH8A 3VA2C 1VGEL 1U3HC 4EN3C 5JDSB 2BJML 4ZOCA 3JWOL 1FFOA 3A6BH 3CC5A 1B0GB 5FDWB 2ERJB 4EIZC 3T2PA 2FB4L 1RIHL 3BPOB 3CDGA 1F58L 1QVOA 1CLOL 1JHLH 4MAYA 4DVBB 3OG6B 1QFPA 1PG7L 2EDNA 2OZ4H 5HYSB 2QBWA 4XNXH 1CQKA 4OF0A 3TO4A 3W9EB 2OBGA 1E27B 2R4SH 3LEXB 3WS3A 3CFCL 5DEGA 3C5ZA 2BC4B 1HH9A 2VDOL 1W72H 2DKUA 4UNTA 4DQOH 4QRPD 4LBEA 1SQ2N 2HTLD 3VXTA 4EDWL 3QXWA 2JLLA 4L8BA 1KFAL 2QEJA 3I50L 4XX1G 4L4VA 5F7NC 3ZYZA 3F5WB 1AKJD 3CFJB 1MCOH 1I4FA 1QSFD 4C55A 1GCFA 4IRSD 1YPZF 1PZUB 1WIUA 4GMTH 4TULL 4NUGH 3WCYA 5HPOA 4NQUA 1UKSA 3LSOA 1B88A 3H42H 5MP6L 3NFPB 1KCLA 3EOTH 3EIFA 3VCLA 5IFHL 1HH6A 3D2UD 5HPMB 3QFJE 4YO0B 3VD9A 3OXSB 1ZT4B 1GGIL 3HI5L 4LSRL 3SJVD 1WFOA 4H0GA 1ZVSB 5IVXE 2NY3C 1KC5L 1P2CA 4XZUA 5DF0A 4P57A 5ID0B 3ULUH 4MX7B 4KRPD 4UBDD 4YK4C 2R56H 3SDAB 3IAGC 1X6LA 3MLVL 4F7TA 3RP1A 4JFPA 2A6JA 1FIEA 5T3XE 1JGEB 4K3HA 1BX2B 3ZDYE 3K46A 4OJFL 4V2CB 5ITFB 3QFJB 4QTHB 2UZYB 1PLGH 5FK9B 1KCVH 1UWXK 1ZV5A 5I1CH 1WWBX 5IVXB 3TWCH 2ITDB 1A3QA 5EZOL 2OK0H 1BEYL 3ZKXB 3X11B 1QA9B 4MB4A 5ACZA 3CZJA 1NLBH 3VFPA 4TVPL 2OTUB 4EBQL 4GUPB 2WIIA 4CAGA 1EJOH 5HDQH 2A9NL 3VXNB 3IT8D 4F15C 1BOGA 5I8EB 5C0AE 3P4MA 2YUXA 1KIRB 1EVUA 1VA9A 4LCYB 3SDCB 2AJZB 3CDYA 2BNRB 4K7PL 2P5WD 5F1NA 2AXFB 5EBMA 5HDBF 2J8UB 1VKXA 1ERNA 2NW2B 3E3QC 3TV3L 4ELMF 4F58H 5M95B 4OIBA 3PWPA 4IRZH 3HNTH 4FG6C 5CJ5A 3MYZA 5T5FH 1H8OA 4JPVL 1QLEH 4YHIB 1ZOXA 3FQXA 3F7VB 5C0AB 4GRWF 4KQ4L 3RHWF 5IROC 5JQ6L 4ZTPH 3SE8L 3AU1B 4KJYB 3OAZH 3OJDB 3KDMB 1HQ4A 1ITCA 4HKBB 1ZHNB 4RNRA 1AGCB 1OF2B 2IADA 1DEEA 1A6TB 1A4JB 5FECA 1LD9A 1BQHG 1HZHL 4ODHL 2CDGA 3RWCB 1YNTA 3SE9H 3K81A 4HFWA 4NC2B 4FQXB 3G6AA 1SJVA 3FAWA 3S6CA 1OAUH 1IGMH 3AREA 5DVLA 1NMCC 2IH1A 3EDKA 3LKRB 3X3GL 3V4VL 5SWQA 1B6DA 4NKDB 3LIZH 1II4E 4PLOB 1DBJL 5FKPA 3MPCA 3MLWH 4WHTB 4P2CG 2BZDA 3U2SA 4PJ8A 1JNLH 3MRIA 1FSKB 4HFUH 4UT9L 4OZFB 5E8EB 4Z0XB 1Q72L 4QRUA 1MNUL 4MAUL 1QSFE 3GSRB 4Q6IB 1DBAL 4MHHG 4I2XA 5BW7C 2UWEB 2BSTA 1X4XA 4OZGF 3UC0L 5JA9A 3LN4A 3WIHH 4WI9A 2H45A 2BRRL 1LO0L 1D5XA 4KMTL 2VXTH 4KJWD 4PG2C 4NJAL 3GMOB 4E0RB 1R3HA 2VABB 2EDHA 3UAJC 1JK8A 3HMXL 1ZTXL 2YBRA 4MA3A 3SJVE 2R0LL 4XCEA 4LIQL 5FUCC 2GTWA 4FXGA 4HIXL 4IMKC 1QSFB 4OZIF 3MUHL 1EIBA 2IPUK 3AS3A 4ZPTB 3BHBB 4IRSB 3PGFH 2V6HA 1D5BB 5HGGS 1BVLA 2M8XA 5M7QA 2FIKB 3O0RL 3LAFA 4DKFH 2IPTL 3O6FB 2LU3A 5IEKB 3ULVC 1JPTL 1SM3H 4XBGB 3KXFD 3QRFM 2YD7A 3D2UB 3I6KB 2Y7QB 4PJ9A 3RKPA 1GL4B 1MPAL 4GQ9H 4Y4FA 4ZOAA 2XPGA 1OPGH 2X4NA 1UB6A 4KDTA 4OF8A 1VEOA 4GJTB 1RUKL 1QR1B 1BZ9B 3LZFL 4KRPB 5EIIA 3K2UL 4Z7NE 5SX5H 2I24N 2X4OA 2YA0A 2DMKA 3DETC 3KS0J 5HGAB 1FNGB 1DJSA 1A7RH 4F33B 1F11B 4NFCA 4MXWH 1U8PA 5GHWH 2KZ1B 3KLHC 4JQIL 2EYTB 3EAKA 3BT2L 5KSVA 5J9PA 4U1SA 1BF2A 3H3KA 3RX7A 1Q9KB 2GSGA 3QUZD 3ARFA 4XNQB 2X10A 2EYSB 4HX1B 2VAAB 3A6BL 4UINL 5DQ9A 5IB3B 3NCEB 1CICA 1XGTA 2HJKB 5BZDA 5D5MA 2P5WE 2FECI 3WS6A 1JHLL 3RIAK 4W4OA 2WIMA 3OAUH 3WFZA 4IRJC 4IMLB 3UDWC 4P2OB 1V3JA 4XNXL 1GGBL 2LVCA 2QSVA 1RJZA 4F7EA 3VDCA 4RRPG 4LCCC 2QL1A 3QPQC 3TBYA 4NDMB 1QFUH 1HHHB 4NNYA 4JRYA 2P8MB 4DQOL 1YPZA 1NLDH 5DHVA 1T89C 3I75A 2HKHH 4XPAH 1KG0B 5DJ2B 4DZBA 1TVBB 4MS8D 4PIRF 3U48A 5ID1B 1EMTL 2X9XA 2OI9B 3HI1A 3CFKA 5K9KB 4JZJC 4NUGL 2ZOLB 1FYTA 3V9FA 3DI2B 1HHJA 3KNBA 4WW2A 1YQ2A 1V3KA 4FOMA 5DUBB 4EI5A 4QNPF 5JIIA 3T1WA 1F45A 2WBJB 3CVIH 1ZHLB 2X7LB 3EOTL 4TUOA 2EE9A 1KJ3H 3GMNA 3VFGH 5IB4A 4U2YA 1QEWA 2GJ6A 4B5EA 5KVEL 1A1NA 3LRSB 1OGAA 4D9RE 2Y06H 4GAJH 2J6EA 4LVNC 5DJZB 4AIZA 4WWID 3U30B 4XP9H 4HIEA 2OL3H 5C92A 3D85A 3GSXA 1U8IB 4M93C 2NY3D 1UWEL 4UT6H 1JWSA 1GHFL 4ZS6C 4NYLA 4JO1H 2IQAA 3MNVA 4I48A 4H88H 4Y8AA 2FEEL 2CIKB 4H25A 4GXVH 3G5ZA 4JFOA 4F7MA 3GI8H 3K4ZA 1H15A 1BFTA 4LSUL 1PLGL 3UYOD 5I1CL 1CWVA 3TIEA 2FO4A 5DK0B 4QCIA 2MQ0A 3PF2A 3Q5TA 1NCBH 3U0WL 3V6BR 1H0DB 1XCTB 4JJHA 5IF0A 4YZFE 5E24E 4JG1L 3FQUB 1EJOL 4O02H 5HDQL 1OAKH 4JANB 3VRJA 4NC0B 3PABA 4QRSA 3IDYC 4P2YA 2MWCA 1YN6B 5I76B 3RU8H 5ECJE 3KXFE 5TPWL 5EN2A 4ELMA 5D1ZC 1WTGT 4O51A 3T0DA 4PP2A 3F58H 4GKZA 1TZHB 4YX2H 2IAMD 5CHNB 1A9BB 1T5XA 1XZ0A 4S2SB 3SGEH 3V6OE 3T65B 3B2VH 1PKQA 2NY2C 4ZUWB 3WYRA 4F58L 4I3SL 4NJ9L 4IRZL 1AD9A 3HNTL 5IMKA 4N8VG 5T5FL 3UJIH 5F7MC 3T3ME 1IC4H 1WAAE 5DMGC 3WFCL 5BRZD 1VCAA 2MCG1 4P2QE 3KXFB 4ZTPL 4FG6D 3Q5YA 5C0BA 3S35X 2BVTA 3V8CA 2ZKHL 4U6HA 3GKZA 2UY6A 4GSDH 4HZAA 3VXRD 2LFGA 3EYFB 3MXVL 1YJDL 1YEFL 3GMQA 2Q86B 3SE9L 4R3SA 1IGML 2HRPL 1BQHB 3ZL4L 3FN9A 4XBEL 2EDKA 2XTJC 2XXMB 1MHPH 1ORQA 3HI6H 4PREB 4FABH 2Z31C 3CSYA 4ODUA 3LIZL 1MWAH 1CXIA 3X17A 4B7IA 4HIJA 4MDIA 1T0MA 4E42A 4HPYL 4P2QB 3K3QA 2H26A 2B0SH 4FFYH 3T4YB 1JNLL 5A2LH 5IJVB 4HFUL 1B4JH 4GW4B 5JNYB 3VXOA 2DKSA 2LTQB 4OGZA 4X4ME 2BVOA 3H0TB 4OZHF 4XI5C 4LPTA 4ERSH 3V0WH 5INDA 4Z7WE 2AJ3B 4NZTL 3CCHB 1CICC 3MJ7A 5DTFB 1OAQH 5EU4B 2CKBA 2VXTL 3FAXA 2NX5D 2BNUA 4X6DB 3WS6C 2VE6B 3UTTB 4KI5C 3D6GA 3OGCB 1T0NA 5CMAB 1G7MA 5CZKA 4ZFFB 1OP9A 5KTEH 4LEOB 4K7PY 2EDTA 5GGTL 3INUH 3VWJA 5E00A 5FB8A 1EAJA 4NFBA 3UAJD 4YBLC 1WEJH 3TLRA 2VQ1A 3VU2A 3O9WC 1PX4A 2KBGA 4X6BA 3IDNA 3PGFL 3L3JB 3MRPB 1FZOA 3LQAC 1KIUA 2DTSA 3TJHD 2JK5B 4DKFL 1JWUB 1SYSB 2XKUA 1WIOA 1FLRH 1A21A 3EO9H 1SM3L 1WCQA 1U3ZA 2Y07L 1SYVA 1CXEA 3QNZB 2Z4QA 5DJ6B 1DQTA 1PZ5B 2ADJB 4ZDHB 4GQ9L 4DGVH 4D94A 2CLRB 4NUJA 2B4CL 2MOVA 3NPSC 3NCCB 3S7GA 1UXWB 1EBPA 4R96A 1S7WA 2YEZA 2X1OA 4L4JA 3IFOB 2YR3A 1LHZA 1A7RL 4ZAKC 5GJTH 4MXWL 1MVUB 4M1GL 5GHWL 3GSNH 1OP5K 1VHPA 2LQRA 3QYCA 3CDFA 3VGFA 1ZWIB 3DETD 4MA1C 1S9YA 4KZEH 1I9EA 3KPPB 4PJIF 3T8XA 1YC7A 1IZKA 5DRNA 4ZNEA 4NSKA 1OSZA 4BK4A 4MD4A 3RDTA 1QUNA 2R0ZH 2CXGA 4RISH 3MRMA 4QXTA 5E6IA 5H94B 1XIWA 3RVUC 3QUKA 2CR3A 1KEML 4MD5B 2DBJA 3RWGB 3LV3B 4I5BB 1RJYA 4BUHA 3S88L 4N0UE 3WNPA 4S10A 1CIUA 3WNLA 4OZ4B 3D39A 3E3QE 4Y1AA 4EI6B 4OGAC 3SQOH 5BRZE 4HLJA 2F9BT 4QGYA 3L3HA 3BZDA 1NLDL 4YHMH 4NOBA 1KT2A 2FLBT 1HHGB 1JPSL 2HKHL 4LSDA 4QT5A 3I3EA 5KSUB 2DTML 3MGOA 1I9RH 1DE4B 3VXRE 2CO6B 3TZVC 5I66B 2IMMA 5FO9A 3ARDB 4H5SB 5SWZA 5LAXA 4ORGB 5J12B 3QWRD 3GGWB 4HMDA 4WCYH 5IMMB 4DN3L 5HSFA 1BBDH 3NCYS 4JDVB 4JY5H 2ADFH 3SGKA 1KJ3L 3H8NA 3VFGL 1HI6B 3OL2A 1AGBB 1NEZB 5FYJD 1RZJL 2EYRB 5CJ8A 5TDPB 2ADGA 2NTSP 1N8ZB 2Y06L 4EUPB 3AMKA 4OV6F 3DX9A 2GYSA 3VXRB 4JCMA 3MRQA 2QQNH 2W60B 2PCPB 2D4DA 1R24A 4UT6L 3NMEA 1Q9WA 5CGTA 2J4WH 4MD0B 1F8TH 4XHQA 2BVYA 2BOCB 3NFNB 4H88L 4JFDA 2AK1L 5FIEA 5FO7A 3WMSA 2NX5E 4XPHH 2RFXB 4ZS6D 4JLRA 4OF7A 3V5HA 4ZOBA 2ZP0T 1JNNH 5K93A 4PD4J 4DK6A 1L7TH 2C1OA 3VH8G 2QADC 4NZRH 3O2DL 1YEDB 3QJHB 4L29B 3U4EB 1P5VA 4G7YL 5FUCE 1FZMA 1U91A 1ZA3A 4M9PA 5E1AB 3NIGE 4U1JB 5DZLA 3TT3L 4O02L 3ALXA 1MFAL 4R4BA 3K8MA 1CK0H 1KIQB 5HGBA 1BQLH 4WI2A 3S4SA 3QXDB 1BMGA 3MMEB 1CBVH 2XQBL 1NC4A 4S1SH 2DL2A 3JV4B 2HTKC 3C60A 4JN1L 4Z5RA 5C70A 4OD1H 1K8IA 2HVJA 1UEMA 1U8OB 1Z0NA 1IM9A 1JYWA 4D9QE 3F62A 3QULA 2D7MA 2BVPB 3FO1A 5DRZA 1YEHH 4HUVB 1ULVA 1P7QD 2G75B 3SBWA 3D0LA 2RHEA 1FZJA 4Y4HB 3B9EA 4M02A 4CVUA 2NY2D 3NACH 1I8LC 3E2HC 1R3LA 4OCYH 1A7OL 2GKIA 2HFGL 5D96C 2C1PA 4WV1B 4YFLF 1HEZA 5HVFB 5FHAH 1RJLB 4GSDL 1EEYB 4HCRL 4RWYH 4BFGA 3NIFE 3BP7A 4L9DA 4WHYG 4UQ3A 1AXSB 3H9SD 5EPMA 2D7TH 3RWJA 1TJIL 3QIWB 3KJ4C 3GMLA 3KLDA 1DLHA 3M1BA 1D6VH 2LVEA 3MR9B 1MHPL 4FABL 5IJKA 1TTGA 5GGUA 5I17B 3IKKA 4OF3A 4O9HL 3SDXE 3VI3E 3PQYD 2ADIA 3RA7H 2MNUA 5EU3B 3OR6B 3VFNB 4M7ZC 4OZHA 5DQJA 3UP1A 1Q9LB 3FO0H 5DUMH 3MRDA 4FFYL 2VLJA 5EO9B 3T0EB 2BHUA 4LLYB 3VI4F 3P30H 4K3DH 3RWDA 1FVDB 1J8HB 4BSVB 1CF8H 4N1HB 2B5IC 5IM7B 4X4XA 3GM8A 5DS8A 1BFVH 3V0WL 3DVGB 3QH3A 4C56D 3QO1A 2P24B 3QZWB 3BSZH 1NCCL 1G1CA 4N0FA 1G9MH 1HK6A 5FYJE 4NQVA 3M07A 5E6IC 2B1HH 1BFOB 2NY5C 2D0GA 1XGPA 4P9HC 4N9OB 4F57H 2J8UF 3EOAA 4KI5D 3DIFB 1YEIL 1ZKAA 3E6FA 2ZJSH 2AERT 5F88B 1CGSH 4F3FB 5C0NC 3HC0B 5I30L 2BNQD 2PYED 5DRWB 2WINA 3O9WD 2YN3A 5J11C 1JFQL 4WTZA 3MRJA 5FYKD 2XZCH 3KLSA 3PDDA 4P5TB 3AM8A 3LKNA 4UAOB 3T0XA 2CRYA 2ZNXA 4IOSD 2MQ3A 2W92A 3E6HB 4KMLB 1Q1JH 3BH8B 5C8JB 1X44A 1Z3GH 2GT9B 1KXQE 3VDAA 4HZLB 5GGVL 3RBSA 1I7ZB 1C1EH 1OTTC 5A2FA 4NGHH 1EV2E 2BVQB 4UQ2B 4XRCA 3EO1B 3FTGA 3GSNL 4ONGL 2OTPA 3IGAB 2CSPA 2HMIC 4ZAKD 1E6OL 1S9WA 1PSKH 4CVZB 4QHNB 1F4AA 4OGXH 4KZEL 3W82A 3VRLF 3PHOB 2UWEF 3QNYA 1J1PL 4RISL 3VFTB 1SJEA 5CSGA 4BZ1H 4GRMB 3KYNA 3G5XA 1OP3K 1E4XH 3ZE2F 5HVHB 5GSRB 4L8DA 2WANA 5E99H 1XR8A 4QYOB 4MSWA 1DBBH 3R06A 3SQOL 4RFNB 2W0FB 1G9NC 3R8BB 2RCSL 3UPRA 3DXAD 4OGAD 4N9GA 1LE9B 2DQIL 3H9SE 2OSLA 3O4OC 1JRHI 4WFFE 4NQDB 2WUBH 1UCTA 1BD2A 1BIIA 2A9ML 3MQIA 5CILH 3REWB 5FKAA 4WCYL 4QF1A 1BBDL 5IB5B 3PQYE 3KPMB 4XCYA 5D71H 4OQTH 1P1ZA 4PJXB 1J86A 1FL6B 1AR2A 4TUJB 3A0OA 4P46B 1NGYA 1XGYL 4HUMB 3TPUB 4HH9B 5I9QB 4NRYA 2VDRH 4YH6A 2FSEA 1JGDA 1PJ9A 3BD5A 4KU1A 1A6ZB 5TDNA 3GUTA 2NZIA 2E9JA 4I3RH 4OSUH 1QFWH 1KTLB 2NNAA 4FQ2L 2HJLA 1WFTA 3SDDD 2J4WL 4C56E 1KTKE 3HRZB 3VFWA 3U46A 2D9QB 5CGMA 3W9DB 3OKMB 4HW6A 3BGFB 1HKLL 4PRPB 4XPHL 3MBXL 5D1XC 4G8FB 2VZ3A 1OP5H 3MO1A 4XWOD 1VEPA 4I18C 1BZ7A 1MREH 5T5NG 5IBLD 1T80A 3PV6A 4ACPA 5D1QA 3GIZL 5E4EC 4ZUUB 3SOBH 4KI5E 5IJKC 3I85A 3RY6C 1OCWH 4OCXL 3DMMC 4WO4C 3VH8B 5JR1L 5A2KH 4FN0A 4HK0B 5ESAA 3K1DA 2ZOKB 1ETZA 3L3DA 3PXJA 2BNQE 2PYEE 2CLVA 4C56B 1H3XA 1T7ZA 1YYMH 2A0LC 3TN0C 3CLEL 4GBXC 1S9VA 4M7LH 3BIKA 3CLFH 4P4KC 1N2RB 5FYKE 1J12A 1YQVL 4PRHA 4S1SL 1HXMA 4L4TA 4KK5D 2FHCA 5I15L 4OD1L 1RK0A 2DIAA 3IJHA 1X5FA 3VWKD 1JP5A 3AMLA 4R2GC 3EDJA 4HLZG 3BH9B 1JNJA 2XOTA 25C8L 1I8IB 2R1XB 32C2B 3QEHA 4PJ5D 2BNQB 2VN7A 4X6EA 2PYEB 5B38A 5DHXB 4IJ3B 4M4PA 3QB7C 4KV5E 5HYEA 1KSRA 2J12B 4YDJA 4EVNA 3X3FL 5ILTL 2JJVA 2EDLA 1MOEA 1ORSA 4F9PA 4H1LA 3MBEC 4HBQA 1VGKB 2JTDA 1AIFA 3I02B 3BE1H 5E0QA 4JFEA 2C4FU 3REVA 1RV6X 4P3WA 1D6VL 1A1MB 4NWUH 4OV5B 4GKSB 1JL8A 4ISVA 5EBLB 4J2XA 2DM2A 4P5KB 5MEOB 1MAML 3RA7L 3BRGC 2B20A 5T1KA 3QG6B 1EHLL 5DWUL 3FO0L 4HHAB 3DXAE 3OQ3B 5DDHA 4XB8A 5C6TH 1N6UA 4NT6A 1I7RA 3CVHB 2PW2A 1I1FB 5I1JH 3P30L 4K3DL 4HUXB 1FFNA 2QSCH 5IBTH 4LDLB 3QIUC 3Q6FA 2IEPA 4PJDE 5CEZE 4HLZH 3QWQB 1UFUA 1UXSB 2OQJA 4Z7VA 4RX4D 3DHMA 3LDBB 3UROR 5ETUB 5DYOB 3T1FB 1G6VK 3TPKA 4OLUH 5E4IA 1FO0A 3BSZL 2FD6H 1D6EB 1G9ML 4Y5YA 3P73B 8FABB 5GZOC 3V6FB 4UILH 3UTSB 3CH8A 3KGRA 3ARGB 2B1HL 3DXAB 1N4XH 5EO1B 4NM4H 3E8UH 1MFBL 1J1OH 3GMPB 4TVSa 5JLZA 2E7MA 3LN5A 1CLCA 2NLJB 4WRLA 2ITCA 5A16A 1EJ6A 1I7UA 1M7XA 4Q9RL 2ZJSL 5F7LB 4PJDB 4RGNB 5IESH 1UJTA 4Z7OE 1CGSL 1MCNA 3JTTA 3HFMH 4BFIA 1A6WL 3WNNA 1T2QH 4OFPA 3S36H 5I73B 2A6KB 1T2JA 4HWZA 2BP3A 4PGDB 4HEME 2XZCL 5FV1L 2ZCLH 1GC1H 1EFXD 4G6JH 4G6MH 4TNWK 4U1IA 3FQRB 4JFFB 3QDJB 2AXJA 4JFZH 2YA2A 2X4SB 4B53A 3RGVA 4YXLH 3C6LD 4J3XA 4KKCD 4Y2DC 2X9YA 3BZ4A 4OCNC 3RFZC 4E41D 4IOIB 1ES0A 3SDDB 1RZFH 1ZT7A 4OD2A 1OTTD 3BZEA 3IRPX 1K4CA 3GB7B 2YD9A 3DVIA 4NM8H 1MAJA 4ZUSA 5GS1A 2AABL 1PSKL 1ZANL 2R2HA 4OGXL 1V7NL 4M61A 4O2CB 4M9OA 4X8JA 1EVTC 2WM0A 3O6ML 5KN5B 5I1HH 1M05B 1JYNA 3ZE1E 2HMID 3C08H 5FHBL 1FQ9C 3B3IB 2YPLD 5CP3A 4BZ1L 4OTXL 4YXKL 4PJ5E 5EU7C 1A6UH 2EDRA 4KRMB 1NFDF 4X6DF 3DUSB 1S3KH 2OZ4A 1U3JA 5C86A 5IMOA 1DVFC 1IGTB 3GSWB 3MV9A 4JQVC 5IMLB 2FATL 2J8HA 5C3TA 4RFEA 2LU7A 3U9UB 2R29L 4K3EH 4KROC 1ED3A 3VWKB 1YDPB 1BLNB 1J0IA 1JWMB 4QHKJ 1W72A 1MRDH 5T1LA 4Y5XB 3ROOB 1IGFL 4M1CC 4G8GD 2WUBL 5EB9A 3MJ9L 3PWLB 5CILL 3ARTA 3BZFA 1FG2B 2O5ZH 2X70B 5BVPL 4XPGH 5D71L 4HS6A 4NO5A 4HDIB 3KPNA 1YA5A 2VDRL 3CUPB 2X4TB 3MJ6A 4KH2A 4MA7L 2J3SA 4YHNB 1N6VA 1BJMA 2IH3B 5D2LF 4F9LC 1B3JA 3GMRB 3FRPA 4CU6A 5GGVY 4LCWD 1JYXA 1LEKB 5FGRA 2L7JA 2HP4A 1SEBA 4JKLA 1F6LL 1K8DB 1QFWL 1JMZA 3BFOA 4YEEA 2O5YH 2YMXL 1XF5B 4GKOA 3BQUA 5C0JB 2XWBB 3U4BL 4L1HA 4RZCB 3C09B 1SMAA 3OG4B 3DLQR 2C3VA 4YE4H 1J9CT 5IQ9A 3FN0H 4HS3B 1ZK9A 1KLUA 2FJGB 1KB9J 5DD5L 4QHLB 1U0QA 1KYOJ 1VFMA 2DQGH 3DV4A 3MOAL 3VFUA 5GIRB 15C8H 4XC3L 4TSAH 3VA6A 4R7NA 5LXGH 5D1XD 4DKEH 3O6LL 3HUJE 4X6CF 5BZWA 1MF2H 2OYPA 1JF5A 2Q8AH 4ZG1A 4B7LA 1AXTH 3MYJA 1CFVL 3B9DA 3L3KB 3NGBC 1OP3H 3SKOA 4CVWA 1BPVA 1HDMA 3LPWA 2KDGA 4G6KH 4XVTH 5IIEA 4WO4D 3S37X 2Z93B 1YY9C 4M7LL 3CLFL 4PLNC 2X6MA 2EE3A 4XXCC 3S97C 3W2DH 4MQ7B 3BISA 4PJGE 2NY6D 3TN0D 2HFFA 5EUKB 4M48H 4M00A 4P4KD 4XCNA 4BZYA 5IHBA 2GJZB 2F54B 2W9EH 3ILPA 5JUEH 1JUFB 3DROB 3GKWL 5GGRB 4E41E 5HBBA 4JVWA 5F1IB 1OM3H 1IMHC 1UVQB 2VDQL 1MLCA 1T5WB 3MRBB 2RB8A 4ORZC 4GAFB 2DI8A 3GNMH 4HXBH 1ADQH 3E0GA 5F9JA 2AAVA 2YPKA 5F9OL 3HAEH 4G8IA 5JW4N 3S3PA 1T03H 1CS6A 4KVCH 4OCRL 4OFYD 4X7DC 5F6IB 3WIIH 4JVPA 5LQBH 2YPLE 4ELKB 4LFHG 1U6AH 3ARPA 5HHPA 3LQMA 3BE1L 5DJDA 3C6LB 1OVZA 4LRNL 3HTLX 3TC9A 4BH8A 2EDWA 3CIQA 2Z0BA 1S8DB 4N8CL 3UYRL 4ZQKA 3L3GA 1LO4H 2NYYC 2Y5TB 5ITBL 3QSKB 3JV6B 2I60L 1W0YT 2OXGA 3TBWA 5FYKU 1NGWB 4GW5B 3TBSA 3LS5L 2IBZX 1YY8B 4KHXH 1QLRA 1PBYA 4DN4H 3IDMA 3HB3C 1NL0H 4DKDC 3BYYA 2YD3A 4PJCE 4KUCF 2HT4D 3ZDZE 5C6TL 4RIRA 3OR7B 3QCTH 5DEFB 3DX8A 5E2JA 2QSCL 1F97A 5IBTL 2YD8A 1A0QH 2VL5B 3IVKA 1EEZA 1C5BH 2DM3A 3GSOB 4CMHB 4G8GE 1RFDL 3UTZB 3FO2B 5IGXH 5CHNA 3BPNB 3MLTB 1I1YB 1ZLVK 3QHTC 4U6VL 3QIUD 3HC3H 2H8PA 1K5NA 5D8JL 5D93C 4RAVA 4PV8A 5FOBA 3JXAA 4ONHB 4BQBA 2Y36L 1N4XL 5AUMB 5GZOD 4NNPL 2CRZA 4EZMA 4NM4L 3E8UL 4IM8A 4NC1E 3DYMA 5C9JA 3SY0A 2ARJA 3NTCL 4RA0C 4LCWE 5E8OA 1CFNB 3QUMB 5FFLA 4Y4KC 3OXRA 3B9KD 4G8GB 5AD0B 4EXKA 5IESL 2MQCA 5D7IE 3GMMB 2DQTL 3QJFA 3VG9C 2H6PA 3HZVA 2I07B 1RZGA 4G3YL 3MODL 3KYOA 4TQEH 1QR4A 2VDPH 4PGEA 3A67H 4NCDA 1PG7X 1DBKH 5D2NB 3JV5A 2ZCLL 5GS3A 5C2BH 4G6JL 3MREA 5CCKH 5ALBH 2R0KH 5E5MB 5EORH 1N0XH 1O5DT 1ZMYA 4ODWA 5KSAC 1L6ZA 1SY6L 4AYFA 3CXDL 4P23A 4ZSOE 5I8KH 3EYOA 2VWEC 4TSCH 4LOUC 1SJHA 2QQKH 4JDZA 1BF8A 1AC6A 3CSGA 4FQHB 2HVKB 4YXLL 1J0HA 2Y6SC 4XVJL 2NZ9D 1MJ8H 2BK8A 3OJVC 4NO2B 3HPLA 1EGJH 5IG7B 4WFHD 4QXWA 3IETB 4QRTA 4NZUH 1MJUH 3SGDI 1TQCB 4RGMB 1W8NA 3F7PC 1TZGH 3U7YH 5D4QA 3O3DB 3H9YA 5I1HL 2OMBA 2B1AH 3OJMB 1C08A 1NFDA 3B6SB 2Q6WA 2EXYD 4OLXL 5ERWA 1C16B 1MQKH 3C08L 4U0RB 4ZSOB 1TPXC 4QY8A 3BQUC 4ZO6A 2QHRL 4ZXBD 3L3OA 4KKLC 4MJID 2DAVA 3MV01 2BCKB 3ULUC 4K9EH 1A6UL 3FQNB 5I74B 2ZUSA 3ZTNH 1BZQK 2KQNA 1D9KB 3V5KA 1S3KL 4OIIH 2UYLB 3DGCR 3IJSB 1P4IL 3THML 1S7VA 1SEQL 5I19L 4PRAB 2NY6B 43C9B 2FJHB 5MEPA 4PGZA 1YEEH 2DKMA 1W0VA 2KUTA 4EUPH 1M71A 1DVFD 3S34L 4MJ5A 1MRDL 4NPYA 1WBXB 2V2XB 5H2BB 4OCSH 3QI9B 3BW9B 5DO2C 1QSEB 4KROD 3RVXC 5FA3A 2F74A 1WISA 3WLWD 1CD8A 1HHKA 1RK1B 2QR0B 4LEXL 5D2LA 1UACL 1U8JB 3OKEB 6FABH 5FAAA 5E6YA 4I9WD 5HHMD 3DARA 1IARB 3T3PE 1AGFA 3DRQA 5I71C 3C2AH 2HG5B 3IDUA 4L3CB 4CMMB 5E70A 3BKYH 2VLLA 1QFWM 5EZJB 3IB4A 5HD8D 2VLRA 3O2VH 5TE6L 1J05A 1WGOA 2UUDH 1YZZA 2ICWJ 4ZMAT 2O5YL 1NJ9B 4J3OC 2GI7A 3TO2B 4POYA 4K7PX 3ARXA 4OT1L 4PRNA 3EHBC 3IFNH 4WIQA 4X6CA 2W1NA 4D0BB 5I8CB 3FN0L 2OL3A 1QBMH 4F2MB 4ZUTA 1VFAA 1G7JB 2OXHA 3HE6D 3X13A 3SO3B 3RI5K 4N5UA 5JXEA 2J5LB 1CVSC 1ZT1A 1JPST 1R3IH 15C8L 4HBCH 4RRPA 5LXGL 5D7JA 4OUOA 3ARVA 1N5AA 4KTDH 3VD7A 3EOBB 2ICCA 3MRLB 5DJAA 1NAMH 3PL6B 4FQ1H 1FAIL 2PF6A 1AXTL 5JIPA 3HCVA 5E94B 3SKMB 2OR8A 4G6KL 4FQCH 5CEYB 3IDGA 1W0WB 2H41A 3O2DA 1J5OH 1HQRA 1EA9C 1J7VR 3DRTB 2ARWA 4M48L 1YY9D 5CLTA 5CINL 1I1AB 1KJ2H 1JF6A 2RBLA 2QLVB 4KHTL 1NBZB 4PRDB 5E8DL 5JPMA 5JUEL 3D3VD 2R1WA 4NQCD 4N1CA 1U8LA 3B9KB 4MAYD 3QUXA 3AY4C 4PJXF 1K4DB 4WFHE 3NZ8A 4HXBL 3UTOA 3RZCB 3VFOB 2H32B 3K8LA 3W11C 1WVZA 4I13B 3C6SB 5BO1H 4LSQL 1I8MB 3C5ZD 3WNMA 4FFWC 1P69B 3WIIL 4G5ZL 3HN3A 2WWKO 4OLEA 1JPFB 3HG1A 1T04B 3OKKB 4MJIE 5FM4A 4ZFZB 2I9LA 2QSTA 4HCRA 4D0CB 5L2KD 4KDWA 3WFEH 4C58B 4M6AA 1LO4L 3RUGB 3HR5A 2JCCA 4ZPVA 4P23C 4KHXL 4GG6B 3F7QA 3VFMB 3K0WA 4HXAH 1NL0L 4NKMB 3BXNA 4P3DB 3U7AA 1P9MA 1LEIB 3QCTL 3WNOA 1MWAA 1XF3A 3HB3D 1A0QL 3IRZA 4HAGA 4ZXBB 1FYHB 3PWNB 1HN1A 5IGXL 3FT4B 2IBBA 3WE6B 1UC6A 2GTZB 3N1MC 4LLVB 2XZQL 3LKSA 4IDJL 1P4BL 3TYFB 4I9WE 3IS0X 5HHME 3HA0A 3ZZ1A 1SJXA 3I3DA 1DTUA 3Q3GA 3FRUB 2VDKL 4G9DA 4EEEA 5C0CA 4WWKC 2GIYA 5FYJH 1JHTA 4G9FA 5F9WC 4WNQA 4Z0BL 3QG7L 4N8VA 3CD4A 1HXYA 1UZ6E 1N6QH 1JNHA 4F15B 1KTRL 4AQ1B 3RIFF 1K3ZA 4HG4K 4HGWA 1A9EA 1T6WA 4GAGH 4E5XA 2ZUVA 1X6NA 5GS0C 4Y4KD 1E4XI 4TQEL 4V1DB 1CLZL 1X5KA 1BFSA 4Z77A 3A67L 1DBKL 4IIQA 1UA6L 2EIDA 4HWEL 3GSQB 4NO0B 1CU4L 2R0KL 4R97C 5ALBL 1MH5B 2Z8RA 4XB7A 5FGBA 3HZMB 3V5DA 4P5MB 3SCMB 3WUWB 4TSCL 1I3GH 2QQKL 4LARH 4AL8H 4TNVF 2N4IA 3FB7A 1T66C 1F4WH 2VITB 3GBMH 2HFTA 2AW2A 4OKVB 3SPVB 3GRWH 3V0VA 1EGJL 3FQWA 2DL9A 1TJGL 3V6ZB 5KSBE 2L0DA 2P49B 2Y6SD 4APQD 1I85C 3PWPD 5BQ7A 3TVMA 5ADOH 3BUYB 1T22B 2VISB 1NAKL 3BKCH 4R7DA 4LPVA 3RPIB 5CD3A 2CIIB 3BP6B 3GSNA 1JPGA 1WWAX 2N7AA 4TUKL 1MQKL 4MNHB 2D03H 1NMCB 5FA4B 1RI8A 4CADB 4UIMA 4U6XB 3D3VE 1F90H 4NQCE 1T21A 2VIRB 3C5JB 3CAFA 1RIVH 2IGFH 3W39A 4U1KB 1DFBH 4HUNB 5ABDE 1KENH 1G7IB 3GBLA 3FOMB 1MCDA 2XY1A 4RAUB 1DR9A 1EXUA 3RWHA 1ZLVH 4RWHA 4K3JL 5C0IA 1OW0C 5KSBB 3SKJH 1E4KC 1QKZH 5EWIH 1TQBC 4LKCA 2DYPB 5HJ3B 5HI3C 4GRLC 2W9DH 2YKLH 1YEEL 4GS7C 3ZE0F 3OF6A 4EJ1C 2I9TA 3DO7A 1FFOB 2VZVA 3CC5B 3ABZA 1L0QA 4OCSL 5C3LD 4HV8A 3TYGH 3CDGB 1QVOB 4LSSH 3FMGH 4MAYB 5L2KE 1IBGH 3QUYA 6FABL 3TIDA 5IWLA 1AHWA 8CGTA 5LGKA 3TO4B 5B8CA 3VE0A 3P4LA 3C2AL 3WS3B 1BAFH 5DC9B 5DEGB 3C5ZB 5T33H 4LLAA 3BKYL 1I75A 5BV7C 3GBNH 1HH9B 3FZUC 4UZGA 3R0MA 3W0WA 4LBEB 3VXTB 1G1YA 3SE3A 4L8BB 5MERA 1BECA 4L4VB 4X9IA 1KN4L 2C9AA 3S3JA 4P2RA 1YEGH 2V7NA 2Q1EA 1I4FB 5KZCD 5CP7A 2F8VA 1JYVA 4PJ7F 1BVZA 3LSOB 3OKLA 3RTQC 1LE5A 4JZNA 4QHMA 2I5YH 2CQVA 4LP4A 5J1SC 5I16A 1R3IL 4GG8A 3VCLB 3MNWA 1TIUA 1HH6B 4PJ9D 5GGSY 1NAML 4MCZA 5ICZA 1F3RB 1L0XA 4H26A 1HINH 4BK5A 2P5ED 3HHRB 2VXUH 1P2CB 2ESVD 4R9HA 1YEKL 2DQJH 4FZ8L 4XZUB 3EYQC 1BJ1J 1BJ1H 4P57B 4YHKH 1J5OL 1FIGH 1LO3L 4OFKA 2OJZH 4F7TB 5FYKH 2X89D 4JFPB 5J1TC 4XAWH 4YBQD 4CN4A 2BSRA 4FFZH 5E95B 3ULVL 3F65A 2A6JB 1KJ2L 3NAAL 2ORBH 3ARFD 1U8KA 3L7EA 2ZPKL 1WBYA 1UH3A 1Z5LA 5TH2A 4KY1L 4PV9A 5FM5M 4M6NH 2ZG3A 2VWEE 4R0LA 2X1XR 1IKFL 5DD3H 2N7BA 1V3LA 3MNZA 5ACZB 3B4NA 2FJFA 3TA3C 3VFPB 5JORA 3PWPE 1R3JA 4JFYA 2WIIB 4IHOA 3KPSA 2KPNA 1JVKA 5BO1L 1OGTA 1BOGB 1FGNH 3ARWA 1T1ZA 1M6OA 1TTFA 3P4MB 1UH2A 4PTTA 3IFLL 2C7UA 2NY4B 3W11D 1RZIA 3V79C 1RHFA 3GFUA 5JA8B 2Y23A 1FNHA 2AEWA 1REIA 3C5SA 4YIQA 3BI9X 4U3HA 2MHAA 3C8KA 1QOKA 4RMVA 1KEGH 4LCUA 5F1NB 2YRLA 5EBMB 7FABH 3WFEL 1WJ3A 1FNFA 4XC1L 1VKXB 1UJ3A 5F44A 2E7BA 4U0QB 1ZGLP 3NN8A 3PWPB 3AC0A 1F4HA 3ARRA 3L95A 5CKAA 4HXAL 4EI5D 3FQXB 5T5NF 5B3JF 1FFQA 2KH2B 2NXZD 5MI0B 1NCAH 2FL5A 2GJ6D 3ZT5A 2I26N 1XEDA 2X4RA 1Y0LA 1HQ4B 2PXYC 3FQTA 4RNRB 5GZND 2BY0A 2IADB 1DEEB 5FECB 3QDMA 1LD9B 2CDGB 4UOW0 1YNTB 5C09D 3BWAA 2OS7A 3D85D 4HFWB 3G6AB 4YGAB 3AREB 2BY2A 3L1OH 1RULH 2IH1B 5E2WL 3P4OA 4KRNA 5SWQB 2XKNA 5FKPB 4NQED 4OUUA 3HE7A 4L8SC 5BMFH 3MXWL 1A64A 3FB6A 1TXKA 1CFTA 4PJ8B 3U2SB 4WWKD 1FRGL 1L6XA 5E2UL 3MRIB 2ICEA 1M1SA 4QRUB 1IC5H 3KPLA 4RQQA 4JPWH 2MCPH 3P2TA 4I2XB 1DQJA 3VXPA 4OLZH 4Y19A 2BSTB 4NFDA 1JIBA 1L7IH 3LN4B 5DA0B 3V7AG 3VGAC 3P40A 5TGBA 2O5XL 3MRRA 4JM2A 1D5XB 3F8UB 2DBLL 3VD5A 1TDQA 3JUYA 1IAII 4LNVA 1KNOA 1R3HB 2X9WA 5LWYL 1LEGA 1JK8B 4AG4L 2YBRB 4MA3B 4AL8L 4J3TA 4XCEB 5MEQA 2GTWB 1VPOL 2P5EE 4FXGB 2ZCHH 5IWLC 1JE6A 5JHDA 5IQ7H 3GBML 2GITA 3HZYA 2P44B 2ESVE 5KZCB 3NZHH 3SKNA 3GRWL 3OMZA 3MLSL 3EBAA 1KPVA 1BVLB 4Y5VA 3MLRH 3BJLA 4FQJL 1RPQA 3WFHA 5ADOL 3VG0H 1CGTA 4I3GA 4ZYKA 3T77A 1EBAA 4JQXC 3BKCL 5C0BD 5L6YH 2D03L 4PJ9B 1G9EA 1RIVL 4Y4FB 5C08D 5DI8A 2XPGB 5HI4D 5IEHA 1XR9A 3WJJA 2X4NB 1UB6B 3OPZH 1CDIA 5EUOF 1CGXA 3AFLA 4U1NA 5EIIB 1IE5A 1H3VA 2X4OB 1QKZL 3MJGX 1ZEAH 2IG2L 1U8PB 1U8NA 3H7BA 5KSVB 5J9PB 2W9DL 2YKLL 2AJSH 4U1SB 1YPZE 2GSGB 3ARFB 2R4RL 1P84J 5DQ9B 4GH7B 4FQQA 5E56A 1CICB 1XGTB 5BZDB 5D5MB 3IDIA 3I2CL 3LS4L 4ODBD 5IW6A 1IBGL 1GAFH 3GSUA 1OWWA 3WLBA 1MIEL 5JW5A 1MCSA 3T2OA 1QRNA 3ISWA 4M5YH 4POUB 2PO6A 1RJZB 4F7EB 1OARH 4QTIL 1Q94A 1QNZH 3GSVA 1JN6A 1KULA 3MJ9A 1BAFL 3MLZH 3TBYB 5T33L 1OSPH 2V2TA 2GCYA 4NNYB 4PJ7A 5DT1H 4JRYB 4J4PC 1YPZB 2ED9A 5DHVB 2GJ6E 3ARBC 1IT9L 3I75B 3MV7A 3FZUD 4UV7H 4DZBB 3RNQA 3EO0A 4Y16C 3EYVA 4XPTH 1CXKA 1RURH 2VH5L 5C09E 4BFBD 1MFEL 3HI1B 4JN2A 3CFKB 3BKML 3GO1L 4O4YL 2HT3C 1FYTB 1OAXH 2HFEA 1HHJB 5E08H 3H9HA 3KNBB 1YMHA 4WW2B 4EI5B 4TUOB 3GMNB 5IB4B 3RTQD 2NXZB 1QEWB 2GJ6B 1H5BC 3MRKA 1A1NB 4CKVX 1OGAB 2NY5H 4HMEA 1PGRB 3AB0C 1P5UA 4P9HH 4LRIA 5KVDH 4AIZB 2AQ1A 3QIBA 4HIEB 2FZ3A 2H2SC 2JJTA 4JRXD 4NRXA 3H2WA 4PRIA 5HHNA 3VFSA 5KVFL 3D85B 1KCUL 5DD0L 3GSXB 4YHKL 1FIGL 1ZS8A 3F7RA 1JWSB 3QEQA 4CUCA 4YHYC 2OJZL 4NYLB 3LQAL 4WFGD 2IQAB 3MNVB 4I48B 4M43H 4MHHI 5HDBE 4FFZL 4H25B 4ELME 1DDHA 3G5ZB 2ORBL 4M62H 4JFOB 4F7MB 1WF5A 2NY0C 1H15B 3ZLQC 1DZBA 1HNFA 2O61A 2XKSA 3TIEB 4M6NL 2FO4B 2ZNWA 2FHFA 1TCMA 4QCIB 5HHOD 3FO9A 3RDTD 4JGJA 2MTPA 2H3NA 2W38A 3U1SH 5HHXL 4GRWE 4N68A 5IF0B 1BM3H 4LGSB 4MLSA 2WBKA 1XCQA 5GRVK 4LLMA 3BEWA 5J6GA 2FNBA 4LF3A 5F70A 3HE7C 4AY0A 3VRJB 1RIUH 3HMWH 2R39A 3DGGA 3D39D 3PABB 4QRSB 3EFDH 1FGNL 1J11A