3G5YA

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
b'DILMTQSPVSMSLSLGDTVSITCHSSQDISSNIGWLQQAPGKSFKGLIYHGTNLEDGVPGRFSGSGSGADYSLTISSLSSEDFVDYYCVQYGQFPWTFGGGTSLEIKRADAAPTVSIFPPSTEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSSTPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 175 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yA01
3QUXC 3RKDC 3LKNA 4P59H 1JGVL 4ENED 4UOW1 1IGCH 5DMKA 3MGTB 3U0WH 1MI5A 4HPOL 5KSBE 1YMMD 4LLDB 5F9DC 1NFDB 1CE1H 5MERB 1DEEA 1KCLA 5F1OB 4RFEA 5C07D 2DD8L 4UDTA 1Y18A 4J6RL 4ONHA 4KMTL 1IL1A 4WI5A 4PG2A 4WHYH 3V5KB 3B43A 4WU7A 1J18A 3O0RH 3TN0C 1RUPL 4HC1H 5BV7H 3D2UA 4HWBA 5GSVB 4KXZI 1GIGL 1EERB 5EU3B 5L8LB 1K8IA 1NUDA 4U6HB 4M4RA 1YMHB 4AIOA 1YN7A 4LU5L 1IC5H 2IAMD 5AZEH 1VPOL 2VL5B 3HG1B 2RGSA 1MAML 3G6DH 3MXVL 3OB0H 1SJEA 3OXRB 2VXSH 2AVGA 3LN5B 3GMOA 4LLQA 3GSUA 2CR6A 4OBRA 1CR9H 4YDKH 3D69B 1U2CA 3O3BA 5BZDB 2H2SC 4ONOA 1MHCB 1J5OL 4KWUA 5ADPH 2SEBA 1TMCB 1HH9A 3VH8B 2E8YA 5C6WH 5D1ZC 5TDNB 3MUGB 2VYRE 4EN3A 3F12B 2W1NA 2R29L 1A0QH 3KPRB 1A5FH 4YPGA 4DQOL 3RWHB 4GMSL 3RY6A 1TZHB 2APTA 1K4DB 4HDIA 4U1KA 1MWAL 4ZNEE 4QRQB 5KS9A 4HULB 2FZ3A 4M4PA 4X9BA 4MAUL 1BZ7B 1AO7E 4S1SH 5DK0A 2YUZA 3T0EC 5I73B 1TJIH 4ACPA 2VLRE 4NM4H 1T80A 3QUXB 2YKLL 4XNYH 1I7RA 3SCMA 1C1EH 4FFYL 2XZQL 3NTCH 3GDBA 1BP3B 4DCQB 3U4BH 3HZKA 1OW0C 1I7TB 4RGOL 1FYHB 3PP4H 4NQDB 1I1FB 2W9DL 4FQQB 3QQ3A 2YC1A 5JHDB 4Z0XB 1UA6H 3ESVF 1QFUL 1CU4H 5E8DH 1HI6A 3UJTH 3KPPA 2BNRA 1HQ4B 5D71L 3KYMB 3TA3D 4KRNA 3T4AA 1MCJA 1MF2L 1IT9H 2X40A 4MCYB 2KPNA 3TN0B 2XFXB 1GPOL 2MQCA 3CU1A 1C5CH 3ECBA 5C0AE 3CVHA 5AYQA 8FABA 4G6KH 4I5BA 1ORSB 1D5MB 5CBAA 4M7ZB 1PLGL 5F6HJ 1JZ6A 3MV7E 3HUJA 3HI1A 4HJ0C 4UDUB 4PJ5D 4OF6A 3GNML 3P0VL 3D39E 5CZXD 1QNZL 4HX1B 2AKRB 2VC2H 3LDBC 3CDCA 4HGMA 3UEZA 2F8VA 1MH5B 3QIUA 3MV9E 3P4OB 2OZ4A 2WQ8A 3C87A 5HI5D 3NIGE 3ES6B 3WCYA 5T1MA 3L5HA 1I8LC 1PDKA 3HS0B 4NQEB 4ORZC 3F5WA 4Y4FC 2R0KH 1N7ML 25C8L 1CWVA 4PJIE 5C09D 5ICXA 4EXPX 3NFPA 4NSKB 5DJCB 4NO0D 2IALA 2W91A 2A9NH 3CFJB 1DSFL 2GIYA 4YR6B 2XIDA 1QTYT 4KTEL 1T5WB 4G8GA 1XR9A 1KPVA 3S37L 1SY6L 3ARPA 5F8QC 4RISL 1A4KB 5M94B 1M71A 1RIVH 1EO7A 5D7JD 5DS8A 3BRGC 1YEJL 2P45B 1I9JL 4DGYH 4L8CB 4QOKA 5DJ6A 4KRLB 5FHBH 4HK0A 2XICA 4D3CL 5IW3A 1EZVY 3BPLC 4P57B 5FECA 4OCWL 1XCQA 3F62A 4B0MM 4OCXH 4K3EL 2UZXB 2NW2B 1A6TA 1QLFA 5I19H 1MQKH 1OL0A 4JPKH 1WTLA 1ZLVK 4F33B 5EBWB 3FQWB 1CDGA 3ZO0A 1QP1A 4XRCB 4DEPB 2J4WH 4MXWH 3UYRL 1QFWL 3WS6A 2ADJA 2Y06L 3WHXA 3I6GB 4OD2B 3U36B 1BBDH 2JB5H 3F7YA 4S0SD 5CBEA 4X6CE 4HJGA 5CD5D 3L3IB 1CD1A 4WCYH 5DI8A 5IROC 1GVIA 3QQ4A 4XVSH 1EGJA 4FQHB 1BD2D 4I0PC 1NL0H 2IMNA 3GJFB 1IKNA 1S7SA 4FQIL 3MV8D 1WIPA 1R3IL 3VD7A 1TZGH 2PNDA 5DMGD 1DQLH 4MMZC 3PWLA 5HDLA 1U91B 4PY7B 1HH6A 2AJVH 4LSSL 3VDCA 4U1JA 2X70A 4S1QH 3PUCA 4YWGH 2V2TA 4ZUUB 4WHCA 5HJ3B 2CSPA 3H9SD 3DO7B 3CFEA 1Y6MR 4NWUH 4EDXB 3TJEL 1A6UH 3O2DL 3QXAA 3DRTB 4HK3J 5HYQB 5I8CB 5EU6D 3MRIA 4LCYA 5HGBA 3O3DB 3G6JF 5K9OB 5I71C 4KGJA 5I15L 4J3SA 1FFQA 5IIEB 2ZSWB 3KWWA 5D1XB 3I85A 3RWCA 2P8MB 3IDJA 4BH7A 1IARB 2XYCA 2YXMA 4PY8I 3AMLA 5F7HA 1PEZA 4M00A 5B3JF 2Q3ZA 1JGUH 1IGML 5FF6B 1J87A 1AD9B 5DQDL 4JRYB 3SGEH 3VXSD 1WZ1H 2A6JA 3QFJE 4PGDA 3IJSB 2CJUL 1WAAF 1RFDH 2VDNH 4DKFL 1OY3B 1U6AL 4FG6C 2YD4A 5GGSB 3RGVD 4LNRA 3MO1B 5SWZE 2ENYA 1Q9OA 1T21B 4WUUE 3MRPB 1C08B 2VLLA 3B3IB 2AJXL 3DVGA 2YWYA 1NC2A 2F19L 3EGSB 4HUKB 1D6VH 3WJLA 4Q58C 3HZVA 6FABL 2FLRT 5I1KH 2PYEA 3FB6B 2Y4SA 3B5GA 1RURL 5FYJH 2FJFB 4AL8H 1KOAA 2J5LC 4NC1C 1AGBB 2YD2A 2PR4H 5GZOD 3RDTD 1ES0A 4FQJH 4PLNC 1X6NA 3LEXB 4C56B 1J1PH 3H3PL 3ZTJH 4LLMA 5FV1L 2R2CA 3QI9A 3QUZD 1X5AA 3C08H 5IMKB 4IMLA 1JGDB 5D1QA 4U49A 5AUMA 4IDJL 3BSZL 2AEPL 4U1HA 3QFDB 4FXKA 2XY1A 5E2VH 2WW8A 3WKML 2Z35A 5MHSE 4I0PB 3WNMA 1RV6X 1DQJB 1JE6A 1P5VA 4XC3L 2DLGA 3FFCD 3HFMH 1IAKB 3CPLA 5IJKC 1BQLH 1A64A 2CQVA 4R0LC 1YYMH 3QZWG 2FL5B 1ZWIB 4LLVB 1FORL 1X6LA 2AAVA 4E0RA 2N7BA 4E42A 4X7DC 3UJIH 1F4AA 3MRHA 4JHZA 5E8NA 4LK4A 3QZWB 5IEKB 4XZUA 3MYZA 4ALAL 3GSQB 1IGYA 4TN9A 3VXUE 4UILL 2F8XC 3K8LA 5DURD 3DBXB 3GEWB 5EULV 3JV4A 1CIDA 4IIQA 5I71B 3PP3H 5FYJD 4RGMB 4I3RH 4XBGB 3SDXA 2OL3B 3RX5A 2JJWA 3AXLB 4Z7WF 3Q5OA 3P9LB 4NKIL 4G80B 1KEGL 5EO0A 3DXAE 4HHAA 4GS7C 4N0FA 3D9AL 3OKEB 4BJLA 4P3CH 3BWUC 1OSPH 2A74A 4PJ9C 5D2NE 1H3TA 4OIAA 2PYFB 2WBJD 4PGEB 3RBSA 5JW4N 1JV5B 1QQDA 2FD6L 4HSQA 4UT7H 3RWGA 3IU3B 2PXYD 4HLJA 1FL6B 1KF9B 1KCUL 2JCCE 5LGKA 1E6OL 4POYA 5ABDE 3BEWB 2IFGA 2VQTA 3QG7H 1W72A 3L3HB 5DHYB 4CBPA 1QFHA 4PG2C 2J5LB 3RTQC 1KTDA 2VOTA 3M8OH 1T2QH 4P5TA 3QXDB 3MLSH 1PKQE 4HIEA 4OCNC 2AV1A 5IW1A 4PJEE 3FQXA 2X4SA 3LSOA 4H8WL 5ADOH 3HE7D 3SE4A 3FT3A 3SDYH 5L0QB 3MCLH 1FNGA 3VJ6B 3WD5L 4NP4H 4GG6F 1TETL 3T0WA 4ZODA 4DUXA 3FRUB 2DQDL 4LSTH 3Q1SL 2OSLA 1BFOB 5HDQH 1RK1B 5TDPA 1SM3L 4OUOA 5F1SA 4I3SH 1MFBL 1U8OB 1ACYL 4AZ8A 1AXTH 4R0LB 5HD8C 5EUOA 3W0WD 3ZE2E 5KSVB 4NO5A 4LSRL 3MR9B 4WNQB 4G7YH 4NYLB 4YBLC 2XWTA 5AYUH 3OJVC 1YNKH 3T1WA 4MCZA 3LPGA 5A16A 3BHBA 3CFKA 2Z4QA 2VZ1A 4PJGA 4O2CB 4U7KA 2XG4A 5DFTA 1DLHA 2ICWA 3RY6C 1F6AB 4A6YB 5CJXA 3D1MC 5ESAA 2CGRH 5IVZB 4G9DA 3DSNA 3S34H 4F7MB 3WJJA 4HKJB 4LPVA 1ZVSB 1G7JB 2R1WB 1UZ6F 3UAJC 2F54B 4Z76B 4Z7UF 4RRPG 3TYGL 3A6CH 5AG9A 2BNUB 4WHTA 3TJHD 1CIUA 5GRUL 5CGYC 3TVMA 4GS7B 5EG6C 5FGBA 5C0BA 5SX5K 4Y1AD 3NCEB 5LBSL 4P23D 4PJ9B 1A7NH 4IRJA 4M93C 4Q97A 1UVQA 1B6DA 3MRMB 4GLRH 1OAUL 3LKNB 3EO0A 1FAIL 5D9SA 1CZ8L 3SCMC 5DMKB 1FO0L 2ZPKL 1KCSL 2VWEC 3X3GL 5IVXA 1MI5B 3SDAD 5EC2A 2DYPA 2GYSA 5GS2D 3QO1A 3N06B 2DOCA 4KMQA 3ILQD 3PL6A 1DEEB 4JM2A 3VGGA 4RFEB 5JOPD 4UDTB 4H0HB 1Y18B 2YPLE 4ONHB 4UT6H 4ZOCA 4NNXA 3DV4A 1IL1B 4U1GC 4WU7B 1Z9MA 4ZUWA 3CVIH 2IWGA 4RMTA 4ZDHA 2BX5A 1RQ5A 4W6WB 3D2UB 4PLKC 4D0CA 3QHTC 1K8IB 1YN7B 4KDWA 3QT2A 1UWGL 1LO2L 2DDQH 1AE6L 1SJEB 3MLXH 5K93A 2HH0L 1EBAA 4OFYD 3GMOB 5I1EL 4LLQB 3O11A 3GSUB 1RZJL 3QIUC 2FSEA 3O3BB 3KS0H 2X6MA 2J6EH 4NQXA 1BF2A 2SEBB 3ZYIA 1HH9B 3FAXA 2BNQA 2VLJE 4YBLB 2DWDA 4NQCD 5TH2A 4UTAL 4P4KD 1B2WL 5F9JA 5L6YH 1F4WL 4P46A 4EN3B 4JRXA 5JW4R 2EEDA 3S36H 4DAGL 5TE6L 1IMHC 4YPGB 5GJTH 5GGUB 1P6FA 4HDIB 4R2GC 3OG6B 5DZOA 4U1KB 4RZCA 3MC0A 5KS9B 3PGFL 2FZ3B 2FDBP 3L7EA 1VESA 4XCNA 4DN4H 1HKFA 2AK4A 3FN9A 4UBDD 1JIBA 3TPUA 4OQTA 5DK0B 3KLDA 1T3FA 4QRSA 5DJYA 4ODHH 1KCVL 1IM9D 4AK1A 2O5XH 3MSPA 2FHCA 1I7RB 2A1WH 3SCMB 4JN2A 4AEHL 4LCUA 5CUSL 3QDGE 3MMEA 4PB9H 3HZKB 1CL7H 5D6DA 3TEUA 1RK0A 4YK4C 1MNUL 4JO3H 1FHGA 2CKNA 4ZYKA 1TXKA 2ARJQ 3QQ3B 1GL4B 2YC1B 4LAQH 5CEZD 5IFJA 4PD4J 1CGVA 5T1LD 4I77L 2R0ZL 5CINL 1HI6B 2EDQA 1EJ6A 4CU7A 3KPPB 4JFFA 2BNRB 4EI6A 4U1GB 4PRPE 5CSBA 4MXVE 5I75C 3T4AB 3ALPA 1FVEA 1J1OL 2FGWL 1J8HD 2XTJB 5EU7C 4WI6A 3I3EA 3ECBB 8FABB 3CVHB 3MQIA 1VEPA 4I5BB 1EAJA 3CXDH 5CBAB 1QSEA 4PJHE 4Y4HD 2FO1A 4WTZA 2OTPA 1IKNC 3HUJB 3CDGA 3HI1B 4I3GA 2ORBL 1BM3H 3MBXH 2UYLA 1QBLL 3FQTA 1JZ2A 2APFA 4J3UA 4OD3L 5I0ZA 3SE8H 3C8KA 3X12A 1XF5A 2BY3A 2AV7A 5FGRA 2CXKA 2V5MA 3QIUB 4U2YA 4EDWL 5F96L 2B4CL 4UT9H 3LRHA 3F7QA 5T1MB 3MFFA 2ADGA 5D7IE 3GO1L 5EA0L 3F5WB 4HT1H 3TC9A 3ARDD 1JI1A 4K7PH 3TWCL 5ICXB 4HGKC 1N26A 3EDKA 2Z31A 5EZOH 3NFPB 4G3YL 1MJ7H 4Z0BH 3KPNA 2IALB 1J05A 5IT2H 4TPRL 2HVKA 5BRZA 2WUBH 4G8GB 5I1LA 1XR9B 1YEIH 1NCDH 4R2GB 4PJDE 3LRSA 1KPVB 4KZEL 2JJSA 4NKMA 4EQ3A 2W59A 1JTTA 1HXYA 1M71B 4Z7QE 3MUY1 5DS8B 4L4TE 2LFGA 3GSNH 2KUTA 4NZJA 5MEPA 4QOKB 4GW5A 5DJ6B 1NGXA 4HK0B 1UFUA 2B0SH 3QUXD 4UNUA 3RKDD 2ZZUT 5FECB 2CLVA 1BMGA 1XCQB 2VNCA 1EPFA 4XX1E 1DQTA 4F9LA 4HJJL 5GGSY 2I60L 3WJLC 1A6TB 1U42A 2JJTA 4XTRC 1QLFB 4HWEH 3NBNA 4YK4B 3QDMD 4ONFL 4OZIF 5JQHC 1E4XI 2R39A 2ADJB 3WHXB 3ZDYF 4XCEA 2VR4A 5F7UA 3F7YB 1QR1A 5CBEB 3OHXA 3W5MA 4HJGB 5I75B 4M8VA 1CD1B 2IADA 5D1QC 5DI8B 2YD5A 4LDOB 4Z7VA 1IGJA 3QQ4B 4CVUA 2R56L 1LO3H 2PO6A 5IFHH 2DQUL 1BOGA 1PX3A 3VFPA 5EU4A 1FNSH 1XCTA 4WWKA 5HHOD 1S7SB 1EMTH 4NJAH 3RX8A 3CDYA 4M6NH 3EW3B 2DLIA 5D72L 3WE6A 3PWLB 4KY1H 1HH6B 1R3HA 1IJ9A 1YPZE 4U1JB 2X70B 2DQGL 2V2TB 1DBML 2LV4A 2CO6B 5J1SC 5D1ZD 3ZHKA 3CFEB 4UB0L 5E2UH 4F58H 5EH1A 3UMTA 5I1CH 4C59B 5KVGH 3QXAB 5EZLA 3DSFH 3JBG7 2FECI 3QHFH 4XPBH 1F4XL 3MRIB 3WHE0 4LCYB 5HGBB 1QHPA 2CDGA 4P9ML 5GZNC 3K4AA 5C0CD 3KWWB 1H8NA 3FMGL 3RWCB 2D4DA 3IDJB 4BH7B 1DANT 4Y5VC 5FUCC 2OMNA 4V1DE 3GJFH 4PV8A 5BVPH 3RZCA 3AMKA 4I8DA 4JZNA 2EYRA 4LCWA 2YA0A 4YPJA 4XPGL 3WS3A 3C9NA 4TUKL 2IJ0C 1VB9A 2YUXA 4JG1L 2VUYA 3T0ED 4W68A 2BSTA 5MI0C 2ZUWA 5DJAA 2A6JB 4PGDB 4MJ5A 5CLTA 2MSPA 3QPXH 5FM5M 4C58B 1NC4D 2EIDA 4LNRB 2V17L 1Q9OB 2WWKT 5IUSA 4ZO6A 1U0QA 2VLLB 3PNWA 1AGEA 4P59L 3DVGB 1X4ZA 1NC2B 3VXRD 2NY3B 1YC8A 3QIWA 1DZBA 5B4MC 5JMRA 2PW2A 4L3CA 4DVBA 3HZVB 1P7QD 3U0WL 3QEUA 2PYEB 3LY6A 3WNLA 4PR5A 3ULUD 5D7LE 1LO4H 4LFHD 3U7YH 2DM3A 2IANE 4P5TC 3QXUA 4FFWC 2AJZA 1S78C 2WMPA 4DUVA 4LLMB 4ZFFA 2X4RA 3SE4C 3QI9B 1UGNA 2NY6B 4IMLB 5D1QB 3BH9A 5AUMB 1QKZH 4U1HB 3RY5A 1T0NA 4FXKB 4HJ0D 2EC9T 3HI5L 2Z35B 4PRNA 1F45A 1H3VA 2LU3A 4HZLA 1IC5L 1EX0A 3CPLB 1D5IL 4Z77A 1M7XA 4WUKH 3V6OC 3L5XH 1F00I 1TITA 4E0RB 4OFIA 5DMIL 4E42B 4FZEH 4LGPB 4U6XA 3MRHB 5E8NB 3VFSA 4ZFGH 1WSST 5F9WC 4Y4FD 5IBLD 4XZUB 3QUYD 5ADPL 1P7KA 1IGYB 1YY8A 2VDOH 2GJ6D 4Z7NE 4H26A 1GZQA 3B8YA 5C70A 1DQDH 3JV4B 4IIQB 4PB0L 2M26A 3SDXB 1P2CA 1A5FL 3WJJC 5DJDA 3IKKA 5T3XD 3GRWA 3RPIA 5EB9A 3OGOE 1ETZA 4XP5L 1CE6A 3MRQA 2FHBA 3LMJL 2X89D 2XG5A 5EO0B 2ZG2A 4HHAB 3WDJA 1BJ8A 1BFVL 4N0FB 4NZUH 5FGBC 2DMCA 5I1GH 4MX7A 2JJVA 2V7NB 2A74B 1EHLH 1MHHA 4HBCH 3WN5A 4UTBH 4S1SL 5MI0B 1DUZA 1ZTXL 1IAMA 4MMXC 2D03H 3QDJD 4LPCA 1QQDB 4GRWB 4IMKA 4U7MA 3L1OH 1TJIL 4MS8C 3MREA 3RWGB 3GSVA 4KK9C 3KR3L 5SWSD 1MCHA 4Y19E 4LVOC 3PL6C 2UY6A 4JM2C 4LSPL 1C1EL 2AABH 3MRLA 1NCCH 4YDJA 5L88H 1MFNA 3TBYA 1HIML 1AR2A 2OL3H 2C1OA 1FFPA 2GTZA 5T5NG 3SO3C 3DX9A 4KK8D 2BHUA 4DW2H 1KTDB 3DUHA 4P5TB 1N64H 1UA6L 3ZKNC 3BN9C 1CU4L 2GI7A 2R0WL 5E8DL 4HIEB 3MLRH 4NN6C 2AV1B 1ZHBA 3BDBA 3UJTL 1ITBB 1SVZA 3L3GA 5IW1B 3UTSD 3BJLA 3FQXB 2X4SB 3DTXA 1FYTD 3LSOB 3FT3B 1FCGA 4IRZH 2GW5A 1S7VA 1FNGB 1S7QA 5C9KA 3EJZC 3VG9C 5D4QA 4LSUH 3MX0A 2OSLB 1E4KC 3N9GL 2VQUA 4OGXH 5TDPB 3T0AA 4FS0A 2ARJA 1F8TL 2M2DA 1RVFH 4MNQE 1CFNA 1GYAA 3MUHL 1V7MH 4GJTB 1II4E 2GHWB 5EUOB 1L9MA 2B1AL 1IAII 3O6LH 5C2BL 1KB9K 1KJ2A 4WY7L 5JDSA 3PDGA 4MVBD 4BELD 4NO5B 5DEFA 3CFCH 3ILPA 3BIAX 2XWTB 2NXZD 3NCYP 1UENA 5F9WB 4P46C 4RNRA 4MCZB 5A16B 3BHBB 3CFKB 2Z4QB 4PJGB 1N3NA 4OGYL 2EDLA 1A3RH 1DLHB 2ICWB 1AGFA 4XCFL 1G7PA 4PRDA 2EYTA 4FNLH 4FFVC 1EEQA 5ESAB 3NCFB 3P4MA 4ODTL 3RZWA 1JGEA 4HQQH 4G9DB 1EH9A 3QCUH 2FWOA 2IGFH 3RWIA 1ODAA 1U8JA 4JB9L 1DFBH 3F6IA 5IESL 1AD0A 4KTYA 2R0LH 4WHTB 1I3VA 3SE9L 3TVMB 5T33H 4ETYA 5C0BB 3VRLF 5I30H 4K3DL 3WFEH 4DGYL 4IRJB 4JFDE 1UVQB 3EO0B 5EZIL 1OP5H 5D9SB 4R97C 3E3QC 4N8VA 4EI5D 1N6QH 3QDHA 5I8KL 3BQUC 5IVXB 5EC2B 2DYPB 4G8FA 3HR5A 5D6DC 1U3HA 3QO1B 3I9GL 3P11L 1TQBB 5F9AC 3PL6B 4A6YH 4JM2B 3EJYC 5IB1A 1H8SA 4PGBA 2EDOA 3DURA 1D9KA 4XPFH 4K94C 4L4JA 5JW3H 2DM4A 3KPSE 4JDVA 5EC1A 1OTTD 4NNXB 5F7WC 3INUL 3DV4B 2X1QA 2J4WL 4MXWL 2DQCH 4PJCE 4XAWH 4ZUWB 4M1CC 3OF6D 4DOHE 4ZDHB 1J1XH 1BBDL 2DJSA 4XP9H 4DTGH 5JPMA 4HUWA 1KYOK 4D0CB 1QA9A 2BY1A 3ARYA 1EFXA 4P2OA 3GMPA 1KXTB 3V52H 1RUAH 4ETQA 1NL0L 4ZNCD 5E4IA 3O11B 5J1AA 2FSEB 4YEEA 4AYFA 4O58H 4X80H 4NQXB 3P77B 2IMMA 4L8BA 3O3AA 1A7QH 4S1QL 2BNQB 5D2LA 4J4PD 1FJ1A 2DWDB 2EDFA 5F9JB 1JWSA 4P46B 1JYVA 4JRXB 1A6UL 4N0RA 3SDXF 4HWBH 4N1CA 5EBMA 4M43L 2A0LC 5TPWH 4ELMA 2BFVH 3UO1H 1IKFH 5E2TL 3D3VA 4FQ2H 4RZCB 5AZ2H 3L7EB 4XCNB 1BJ1J 4OFKA 2AK4B 3TPUB 4NZDA 1JGUL 1T3FB 4QRSB 5DJYB 1MCQA 3CSYA 4UOW0 2ESVA 4S10A 4QRRA 2NX5D 2GCYA 4KI5C 3ZTNH 1OCWL 1Z9OA 1WZ1L 2QSCL 4JHWH 4F9LC 1S5HA 1RFDL 5GRJL 1IGFL 4R97B 4DGVH 2WUCH 4JN2B 4JQVA 4LCUB 2JJTC 5I6XC 1NFIA 3MMEB 3CH8A 1RK0B 4ZTPH 3SOBH 1EFQA 2B39A 1VHPA 1AGDA 4ZYKB 3BWAA 5I1KL 5IFJB 4D94A 4ZOBA 4HUVA 3RTQD 1FH5H 5FYJL 4R26H 4AL8L 4JFFB 5IVOA 4EI6B 5BVJA 5K9JL 4XNMA 2PR4L 4BSJA 1FVEB 4FQJL 4WTZG 2ERJC 4RQQA 4GH7B 5J06A 1JP5A 3O9WC 2GSIA 5C7XH 5BOPA 1QSEB 1D5XA 2DKSA 3CDGB 3EZJB 2AW2A 1CLZH 5LAXA 3C6LC 3OQ3B 1UADC 2UYLB 2ZUYA 3FQTB 4XVJH 5E2VL 5HDBE 4Z18A 1T89A 1NUFA 5EUOF 3C8KB 3X12B 4HS6A 1XF5B 1EVUA 3O41A 2AV7B 4KROC 5HD8D 4R3SA 5GQBA 1BQLL 2NY0C 2AXFA 1FG9C 4FABL 4U7SA 2ADGB 4PJGF 5A43C 5EDXA 4HH8A 1PYWA 2Z31B 3ARVA 3KPNB 1MCIA 3CVHH 4K2UH 2COQA 4MAYC 1J05B 3UBXI 1PW3A 5BRZB 2HVKB 1AR1D 2NY4B 5IBTH 5I1LB 3RZCC 3UAJD 4WFGD 1F90H 3LRSB 4NKMB 1M05A 1HXYB 3EJJX 3QQ9C 2I9TA 4MA8H 3VFMA 5CGYD 3NCJH 3MRGA 3VFVA 1XR8A 5MEPB 4GW5B 4NZTH 2VN4A 1NGXB 1JPTH 1IZKA 2OZ4H 4K7FA 3RA7H 5TQ2L 3VFNA 1ADQA 4EZMA 2RAMA 1KULA 3W82A 4P3CL 2CLVB 4XMLH 2MHAA 1DTUA 1B9ZA 4P2QA 2WWMD 1LEIA 1IILE 1A7PH 4UT7L 5FO7A 1G7MA 5I6XB 5JIIA 4JN1H 1P4LA 2XWBA 3B9EA 3HZMA 1M7DA 3LV3A 2QBWA 5L7XH 1BWWA 5HHMD 5C0RL 1QYGH 4XCEB 1EJOH 5CCKH 3CU7A 3WLBA 4HG4J 1QR1B 1DVFC 3OHXB 3ZE1F 2DLHA 5DC9B 1MCBA 2CK2A 4N0YH 1HHJA 2IADB 3WIHH 4LPUA 4Z7VB 1IGJB 4TVSa 2Q86A 2PO6B 1BOGB 5ADOL 3VFPB 1E27A 4AMKH 1NBYA 5EU4B 1XCTB 1HYRC 4WWKB 3MCLL 3JV6A 1C7TA 3AS2A 2ADFH 1IC7L 1JZ5A 1J10A 5HDQL 3DVFA 4LSDA 3WE6B 1YY9C 1QSFA 1FIGH 1KLUA 1R3HB 5EBGA 3TBWA 5HYJE 4I3SL 3T3MF 4X99A 3SGDH 4KZDH 2NY0B 3QULA 3RVUC 1AXTL 1ZLUK 2OR9L 5C08D 1TJHH 4YHNA 3TT3H 4YBQC 5EZLB 2NY1B 3LKSA 4PRHE 2X2YA 2CDGB 4LSVH 1J8KA 4X6BA 2EDEA 1Q1JH 3BIBX 1CF8H 1EGJH 2DLEA 4R2GD 4D9RD 5ETUA 3GBNL 5D5MF 4HS3A 1CFSA 1JMZA 4G9FE 4L3ED 3O4LE 3Q6FA 4PV8B 3RZCB 4OV5A 3S34L 4JZNB 3ARFC 5CFHA 5FM5O 2EYRB 4LCWB 4TSBL 1LDPH 4OM0L 3WS3B 3C9NB 2BSTB 3A6CL 5DJAB 3ZSSA 4MJ5B 1BLNA 3QUMA 5DQJA 3RUGF 2XTLA 3PNWB 1AGEB 2HMID 3QIWB 2PW2B 4L3CB 4DVBB 4JG0L 2OJZH 3QEUB 4KFZC 3OX8A 4PR5B 1AP2A 4GBXA 5FYJE 3LAFA 3HCVA 3KPOA 4ZS7H 5CIPA 2FJHA 4I13B 4NC0B 1GOHA 1DQQA 4WGWB 2ZUSA 4MQSB 1E4WH 5DR5H 4UT6L 3OV6A 4Z7OE 1OAQL 2Y9RT 2NY2C 1OAKH 2AJZB 5L2KD 3SY0A 4ZFFB 1G9MC 2X4RB 2DLFH 3CVIL 3FO9A 2EH8H 1KV3A 3BH9B 3NIDF 3O2VL 3NABH 1TVDA 3KLHD 1T0NB 2DI7A 4PRNB 5CEYA 1J0IA 4HZLB 2AQ2A 1ZA6A 1ZLSH 4Z77B 2DDQL 1DBJL 4XMPH 3S88L 1NH6A 3VCLA 3SHSA 1L4IA 4U6XB 4KUZH 3VFSB 4HS8H 3H3BC 1P9MA 1WFTA 2H6PA 3GI8H 1RIUH 2P5WA 4QRPA 5TDOA 2OI9C 5MP6L 4MJ2A 4NOBA 5E6ID 4Y7MA 1P7KB 3V7AE 1YY8B 3OKMA 5CEZL 3MLPA 3VMNA 1PVHA 4H26B 1GZQB 4ZO7A 1OQXA 32C2A 1ORQA 1AIFA 4Q9BA 3DO3A 1P2CB 3QSKB 4OZGF 5DSCA 5DJDB 3P4LA 2HFTA 3W2DH 4E41A 4PRID 1ETZB 1CE6B 3MRQB 1XGYL 3D18A 4PJXF 3MUZ1 3PHQA 3QEQE 3WUWA 5D6CA 4MX7B 1OT2A 1MHHB 1PBYA 3WN5B 4UIKH 5KW9H 1DUZB 4EIZC 3B6SA 2GY7B 3CNKA 2YSSA 3MREB 1K85A 2FIRT 4GT7A 3GSVB 1BJ1H 2QADD 1X4YA 3EBAA 4ZOEA 3MTRA 5LXGL 1JK8A 5F7LB 1KC5L 3ZKMD 2VSDA 4DGIH 3MRLB 4YDJB 1D9KC 2GJJA 1JI2A 3TBYB 4M6ML 1CL7L 2C1OB 1FFPB 2GTZB 3DX9B 4JO3L 4YZFE 2GJZA 2AEQL 2EE6A 4K71B 3CJJA 2ZOLA 5ESQA 2KKQA 2CRMA 5CZKA 1I8IA 3THMH 4UOJA 1ZHBB 2NY2B 3L3GB 1SMOA 5D1QD 3EYFA 3ULUF 3DTXB 3MLTA 3QWRA 1EAPA 1AQKL 1EXUA 4GRWH 4JO2H 2F53E 1S7VB 1S7QB 1GJIA 3K4ZA 1G0XA 1F4YH 4HMCA 3K2UH 4JFEA 4PBWD 3UTTE 5J7CC 4CVZA 3OL2A 1PG7L 4OI8A 2ARJB 4RMUA 2KQMA 3NACH 1CFNB 5ISZD 4DVRL 2RB8A 2XN9D 4PJAF 1KJ2B 5JDSB 3LH2H 5EOCJ 1MCWW 4RAUA 5T1KD 5DEFB 1ZLWH 2GAZA 3H42L 3ILPB 3CZFA 3HMXA 1OF2A 5E9DA 4RNRB 4UT9L 2NR6C 1FNEA 2W38A 1N3NB 7FABH 1OB1A 5JA9A 1AGFB 4HK3N 1BVZA 4HIIA 4K7PL 5DEGA 1INEH 1G7PB 4PRDB 2EYTB 1KN4H 3P4MB 4FQ1H 1JGEB 4WI3A 4YFLF 5JIKA 1A7RH 3BGMA 4J3VA 1OAXL 2ZCLL 3DX7A 1X4XA 2FWOB 5IT2L 2P7TA 4M1DH 4MQ7A 2WUBL 3RWIB 2F9BT 4I2XE 2QQLH 1U8JB 1YEIL 1AD0B 2AERT 3OZ9L 2VLKD 1T66D 4N8VG 4XPTH 2QLVB 3GSNL 3SE3A 2CLRA 5DJ0A 4LHUD 1XGPA 4WO4A 5KN5A 1TJGH 2BXZA 4N8VB 3MRCA 1A6ZA 1MJ8H 1YEHH 3WEXA 5E2WH 2GTWA 2NMSA 3BDXA 4G8FB 3HR5B 4NZRH 4DK3A 1U3HB 4GAJL 4F7EA 4UAOC 4PREA 3S4SA 5IB1B 4NBZB 4TVPH 4PGBB 3DURB 1D9KB 1SEQH 4JDVB 4HWEL 4ZOAA 3O8XD 5DC4B 5EC1B 4B41A 5AAWA 3ARBA 3CK0L 4JHBA 1NEUA 4ODVH 4FFWD 3MBEA 1S78D 1HXMA 4Q74A 1E6JH 3EUUA 3O3UN 2ARWA 3ZT6A 3D5OF 5DGQA 5JPMB 4HUWB 3RI5F 3R06A 1QA9B 3MXWL 1JF6A 1IBGH 4DN3L 4DFIA 1EFXB 4P2OB 3CXHJ 4Y4KD 4FTVA 4LAJH 5DDHA 3QO0A 3GMPB 4LRNH 5IFHL 1L0XA 4N5UA 4YDIH 2IBBA 3BIKA 1NFDE 4LCIH 4OCYH 4ETQB 4YHKH 5EO9A 4P2RA 1BZQK 1N5YH 2KBGA 4MDIA 3DETC 1EMTL 3WMSA 4NJAL 4M6NL 4U6VL 4L8BB 3O3AB 3FB7A 5D2LB 3ULUL 3AY4A 1FJ1B 1MPAH 3BUYB 3WLWC 5E2UL 2L4OA 4JFQA 1EZVX 1JWSB 2W9EH 5I1CL 3WNNA 5IM7A 3PQYD 5EBMB 2VXQH 1DBAL 3GM0A 4OLVL 1FFRA 4ELMB 2CKBA 1KN2H 2ZG3A 4K3GA 3HG1E 3D3VB 4BQBA 4EBQL 1CDYA 1P4BH 1ZEAH 3S97C 5CMAA 5IB3A 4KVNL 3I50H 2AQ1A 4M7LL 4IBLT 5HI3C 5FA4A 5T3ZD 1FFOA 5L9DL 3CSYB 2ESVB 4QRRB 2GCYB 1JWMA 4NN7C 5FYLE 4CKVX 5DD5H 4MS8D 4P5MA 3CX2A 1S5HB 1V3LA 1XIWD 4KUCD 1TVBA 4KAQL 1S7TA 3WYRA 1WZKA 5LG1A 5B3NA 3SKMA 1NFIB 5A2KH 2YA2A 2VO5A 1OSZA 5ALCL 5C9JA 3LEYH 1AGDB 4UAOB 1FPTL 4Q6IA 3BWAB 4CAGA 1E4JA 4HUVB 3AS1A 3DMMA 2RBLA 3U7YL 4WI9A 1I1RA 4XP6H 5BVJB 2DLTA 4XNMB 5T3XL 4OGZA 4OQTH 1MCEA 3BAEH 3SDDA 4RQQB 4YHZH 4QHLA 2GSIB 3HRZA 4WIQA 3EJZD 4XP1L 1D5XB 4LF3A 1QKZL 5LAXB 2X1WL 4FQLH 1J86A 3IRZA 3VA2C 1QD0A 3EDDA 3KVQA 4NQDE 4HS6B 2VJXA 3O41B 4X9IA 4R3SB 4HIXH 5JHDE 3IS0X 4OLYH 4ISVA 2AXFB 4K94H 2EEAA 4NO2A 4FZEL 1FRGL 3D85A 1G9NL 3MJGX 3MLUH 4KVCH 2FH6A 1IGIH 3SGJA 3I2CL 5IFAL 4KPHL 1PYWB 5ITFB 1WGOA 3EDJA 1DR9A 3NIFF 1FCCA 2OTWA 1S9WA 2Y23A 1ONQA 4KJWD 5D8JH 2UVFA 2FB4L 3LB6D 5FFLA 3A67H 5IVNA 1Q9WA 1WCQA 4OD1H 4GRLA 1M05B 2I9TB 1UCBH 1FSKC 3VFMB 1MEXH 3MRGB 3VFVB 1XR8B 3EDFA 4K9EC 1RD6A 5DJ8A 5I2IA 4K7FB 1GSMA 3I3DA 3RI5K 3VFNB 3RVVD 1EHLL 4MWFA 3G6AA 4NQEE 1LNUA 5KVFL 2MHAB 4UTBL 5F7NC 4HLZG 4P2QB 1M7IA 3BQUD 2D03L 1LEIB 3L1OL 3G5ZA 5FO7B 4KI1A 3QWOA 4YHYB 1G7MB 5HGDA 1L9NA 4GBXC 3EJYD 5I8EA 2X41A 1P4LB 2XWBB 1A02N 5I1HH 2VN7A 2UZIH 3HZMB 1GOGA 1RZIA 1M7DB 3LV3B 2AABL 3HC4H 3RIAF 3U7WH 1UACH 1ZAGA 1P4IH 1WBYA 3U1SL 4K55A 4M1CD 3WLBB 5BS0A 4DW2L 3MLYH 3IYLW 2AK1L 1HHJB 1HHKA 5GRWA 3MLRL 3PWPA 3NA4A 5JW4Q 5KANI 2Q86B 2VLRD 1N6VA 3ZL4H 1CGSH 1E27B 5HTSA 1NBYB 4IRZL 2FEDC 3JV6B 1I3UA 3VXRE 3WXVH 3EDEA 4N1HB 4S1RH 4MD5A 2BVTA 2DKUA 2ZOKA 4UV4H 5C6TH 1CG9A 1QSFB 2VXUL 1KLUB 3TBWB 3IVKA 2F5AL 4OLZH 1BVKA 2IQ9L 1A2YA 4X99B 4UV7L 3QULB 3BXNA 3IJHA 5H2BA 1RJZA 4JKMA 4YHNB 3HZYA 2HKHL 5ICYA 1CFVH 3LKSB 1TZIA 4PD4K 3HAEA 1AJ7H 3AVEA 1RIHH 5IR1A 1NKOA 4X6BB 5TF1H 2Y6SC 3EOBA 5EOCH 3ZE0F 7CGTA 5GS1A 5E6ZA 1A3RL 2I24N 5ETUB 2FX8H 4X7SL 5C0AD 4HS3B 4FNLL 1NDGA 4LQFH 3Q6FB 4OV5B 4CMHC 3MV7D 4I0KA 3NFSL 1RU9H 4O02H 3SKOA 3MV01 3CIQA 4PS4H 1FSKB 3D39D 2DQEL 3V9FA 3GKZA 1W0VA 2R0LL 1BLNB 3MV9D 3QUMB 3JSSA 5DQJB 5I30L 3N85H 4K3JL 4FMKA 3BKYL 1MRFL 1BZ9A 1MLBA 2L7JA 3S36X 2R2BA 1MVFA 4U0QB 3QJFA 3OX8B 1AP2B 4GBXB 4WEUD 4NNPH 4JRWA 4BFBD 2YMXH 2FRGP 3HCVB 5J13B 3KPOB 5CIPB 2FJHB 4JY4A 4PP2A 15C8H 1BPVA 1DQQB 4R7DA 4F3FA 5IJVA 2GFBA 3QG6A 1KIPA 4JRYE 1REIA 4MA1B 1Q9KA 3SY0B 3VI3F 2DQCL 3O9WD 3CLFL 4N0CD 3TO4A 3FO9B 4OCRL 4LBEA 1QRNA 4U1SA 1ZGLP 1MWAA 2W0FA 3C6LD 1IZJA 3K0WA 5CEYB 1ZA6B 1BECA 2JIXA 2R8SH 4E5XA 1LEKA 4KROD 3ULVH 3TGXA 3LRGA 2D7MA 5J6GB 1HWHB 3C8DA 4OIIH 3VCLB 2CRZA 4YC2C 4AIZA 3PJSA 5KZCD 3QFJA 2H6PB 2P5WB 4QRPB 5TDOB 4C56E 1UWXH 1GGUA 2DIBA 1GGTA 3OKMB 5SWZA 1HKLL 1OARH 4M6OH 4OF5A 32C2B 1ORQB 5JOFA 5FGSA 1AIFB 4MAYD 4UQ3A 1PQZA 5IB2A 1CDCA 5DSCB 4F57H 4NNYA 1HILA 3WUWG 4E41B 1LQSR 1UEMA 5EU5A 5TPWL 1H3PH 3OJMB 2BFVL 4X6DA 5CJBA 3RIAK 4EIGB 2DL2A 3D18B 4LNVA 1U8LA 1IKFL 3QQ9D 3SGEI 1C7SA 2A83A 4FQ2L 3PHQB 3WUWB 5AZ2L 3CFBA 1HEZB 5D6CB 3EO9H 4LGRB 3HNSL 1YEGH 2DM2A 3KXFA 1DQML 3B6SB 1VA9A 2Z9TA 4N5ED 2YSSB 3NCCB 2JLLA 3ZTNL 1DBKH 3BD5A 3BI9X 4YH6A 4WFEE 2A9MH 4JHWL 1H8OA 1HN1A 4K7PX 5JQ6L 1JK8B 2FIKA 4DGVL 1KIRA 5C0IA 4AEIH 2OP4H 2ITDA 3GRWH 4NKDA 5D7SL 4LKCB 4ZTPL 3R4DA 3SOBL 3ARBC 3FQRA 1MQ8A 4OB5L 2GJZB 1A4JA 3QEGL 1OAZH 4U1NA 3VXTA 2ZOLB 4XWGL 5ESQB 4M1GL 1DVFD 1I8IB 2F5BH 2BVEA 5DMYA 4POZC 4R26L 3EYFB 3MLTB 3TT1H 1EAPB 4AENA 4JQXC 4QTHA 1EXUB 1L0QA 2NYYC 4WI2A 3F65A 1Y6NR 4JFEB 4M3JA 1SY6A 1NCAL 3CZJA 4CVZB 4MA7H 4WUUD 4HXBH 2C1PA 3B9KA 2E27H 4XVJL 3T65A 2DJUA 2HWZL 1EIBA 4TRPH 2YHGA 1LD9A 1Q0YH 4NC1E 4RAUB 3V4UH 2GAZB 1J11A 1UB6A 2CRYA 3CZFB 5FKPA 1OF2B 5F7FA 4DJMA 5E9DB 4GFTB 4PYGA 4O4YL 4BK5A 1FNEB 3O4OB 1R5WA 4JCLA 1OB1B 4X4ZA 1G9MH 2YEZA 5DEGB 4JZOA 4HIIB 1OGTA 2AJUH 3P9WB 3BGMB 3IKCA 1NSNH 5C0FA 4MYWB 1NKRA 3DX7B 2V9TA 3ARFD 2P7TB 3U7AA 1PX4A 4MQ7B 5IBTL 3T2QA 2WANA 5MHSD 2VLME 1JHLL 1JVKA 4L8SC 2WIIA 2VZ3A 5LVEA 5IW6A 2VXVL 4MA8L 1JN6A 3NCJL 1KJ2H 2CLRB 5DJ0B 1XGPB 4WO4B 4WJ5B 2B7DT 5KN5B 1IRAY 2XZCH 3RA7L 4OZFA 3MRCB 1A6ZB 1NGPL 3QIBD 3S4SG 3WEXB 1RZFL 4XBEH 2GTWB 3BYTA 3WDHA 4QRTA 3VXUD 1A7PL 4V2BA 2DWEA 4F7EB 4PREB 3S4SB 3FN0L 4IS6A 3EYVA 2P5EA 4JFOA 3WSQH 4HUXA 3BKCH 1YEFH 2F54E 4O51A 1CLOH 3ARBB 3O2DA 4X98A 1MCNA 5IOPA 2XQYK 1MRCH 3MBEB 3DV6A 1HXMB 1NAMH 3SDDC 1EJOL 3DXAD 5F7MC 3OPZL 5DHVA 3LEVH 3X11A 2ADIA 1U3YA 5B21A 5HHQA 1MCRA 4ZD3H 5BMFL 1QEWA 3R06B 3HB3C 4TSCH 3WNPA 3WIHL 4FTVB 3GI9H 1MI5E 5DDHB 3QO0B 3ZT7A 3VWKA 3BIKB 4AMKL 3MRKA 5EO9B 4P2RB 4MDIB 4YE4L 2ZUXA 2CUHA 5IHBA 1CT8A 3RVXC 4XCCH 1I9IH 2G9HA 5ACMA 4Y16A 4CJ0A 3FB7B 2PCPA 4OCSH 5FUZH 1T1XB 4TNVF 5JR1H 2FGZA 4D9LL 4JFQB 2H32A 1BQUA 1K8DA 5IM7B 1X5IA 3TT3L 1ZV5A 3OSKA 4RWYH 4XVTL 2X05A 1A9EA 4LSVL 2CKBB 4JKKA 4J23A 1KEMH 1BFSA 1Q1JL 5MENA 1C8PA 5CMAB 5IB3B 1MY7A 4Y89A 2ED8A 4PJ7E 3VWJA 1YECL 2NTFA 3MLZL 5FA4B 5GGVH 1CTNA 1RZ7H 1FFOB 1HHGA 2DTML 4GLRI 2AI0H 4L3AA 2FBOJ 2CMRH 1ZKAA 4U1MA 4JFHD 1JWMB 1LP9F 1ZGLA 3IT8D 3S35H 4P5MB 1EEUA 4P4RA 4F15C 5CWSA 3V0WH 1FIEA 1NAKH 1TVBB 5TQ0H 1S7TB 4K23H 1X5XA 4QXUH 3SKMB 1GZPA 4NOFA 4QEGA 1OSZB 4Q9QH 2QHRL 4KRPC 3HE6A 2DBLH 5C9JB 5D96C 2OXHA 1IE5A 4Q6IB 5KS9E 5EZJA 1YEEH 1HYSD 3DMMB 5C6PB 2HLFD 3MRJA 1U8MA 1QFPA 4RDQF 3IDXH 3HPLA 3C5ZA 1NQBA 4M7KH 3SDDB 4YEFA 5F8RC 1F2QA 2VDML 4QHLB 3T8XA 3TV3L 2APWA 3HRZB 4KDVA 5ALBH 3HC0A 2I5YL 4S1DC 1GRWA 4LF3B 2ZUTA 1ZVHA 3NABL 2X1PA 5DFVD 2VDLL 1FBIH 5F7YC 5CILL 1Z3GH 1JTOA 1DBBL 1MJUL 1LO0L 4ISVB 2XKNA 4NUGH 5IHUH 1YNLH 3ZLQC 3G6JA 1MHPH 2BNRE 4NO2B 2YPLD 3D85B 3FO1A 1QBML 2LE9A 3KJ4B 3NA9L 4NRYA 3Q0HA 2FCBA 1MIMH 5GS1C 2IBGA 2XZAH 1HK6A 2OTWB 3B2UC 1S9WB 3HUJE 1ONQB 4XAKE 5FDWA 1KNOA 1V7NL 5TE7H 1Q9WB 1TCRA 4GRLB 3W2DL 4OF3A 1WAAA 3L95A 2VITA 5E08H 2NQCA 4N8PA 4TTDD 2A38A 1IFHL 3ARED 4IM8A 5DJ8B 4LP5A 2VUOA 5I2IB 3PDOA 4M61A 4MWFB 1M6OA 3G6AB 1LNUB 4UIKL 4MJIA 1LE5A 1WV7T 1UYWH 1M7IB 4F15B 1TCMA 3QRGH 2VLJD 1CL7I 4PJHA 5ILTL 3G5ZB 3QWOB 2LTQC 3FAWA 4OLUL 4L4VA 5HGDB 4G5ZH 5I8EB 4LPYA 4G8GE 5E2JA 1RZIB 4DGIL 2XQBH 4KUCF 4RX4D 4LVHC 5JUEH 1WBYB 3RAJH 2C4FU 3WV0A 4QOKE 5BS0B 1BEYL 4QY8A 5JOEA 1T4KA 1RHHA 3TO4C 5IMLA 1HHKB 1ADQH 3PWPB 3THML 1EK3A 3CX5J 1RJYA 4Q2ZA 4OCMC 3C2AL 1Q94A 4RMWA 4YXKH 3H8NA 3B2VH 4J2XA 3SN6N 4XGZA 1UM5L 4ZAKC 4WEBL 2NW3A 1IC4H 2NY5L 2ZOKB 1CG9B 3QDGD 4JO4H 3WFZA 3IVKB 3SQOH 4R4ND 2YS4A 5KTEH 1BVKB 4PLOB 4KRMB 1A2YB 4XNXH 3CMOL 1LK3H 3BX7C 3IJHB 1NBVL 1RHFA 3BXNB 3HAEG 1RJZB 2QSQA 1FO0A 3BPNC 4KKAC 5H2BB 1OP3H 4H88H 3GK8H 3HZYB 2ILLA 5ICYB 1I9EA 5CS7A 1TZIB 5KSBF 3STZA 2DKMA 2VZOA 3HAEB 5B39A 4PRPD 3PGCA 4Z7WA 4Q0XL 1FDLH 4HPYL 1IAOA 2UWEB 3EOBB 1OOAA 5GS1B 1O5DT 3QYCA 4GMTH 2X10A 1DCLA 5FM4A 2UUDH 5DD0H 3K2MC 1INEL 2IPKA 3EIFA 1WISA 1NDGB 3KHOA 2B20A 5F71A 4M9OA 1HNGA 2MPAL 3DWTA 3SKOB 1FZMA 4D0DA 3GHBL 2AEIT 1W0VB 1T83A 1ZLWK 3MZGB 4XPHH 1CLYH 4NIKB 3ME0A 4K8RC 3P0YL 1TJGL 5E56A 1G7QA 3HHRB 1BZ9B 4YHOH 4GG8A 2GQHA 1MLBB 3JVGA 4O9HH 2E9IA 2R2BB 2HT3C 5E2WL 5L8KB 4L9LA 2B2XH 1EVTC 3QJFB 5FYKH 5F1KC 3KYKH 3OAZK 4G7VH 4DFHA 4GAGL 5HHVH 2IH1A 4JY4B 4PP2B 3Q5TA 4R7DB 4LVHB 1SEQL 4F3FB 5IJVB 2GFBB 3QG6B 1KIPB 1VDGA 3C60A 3HTLX 3ARZA 4WV1C 1Q9KB 2C3XA 2WBKA 4L4TD 2K1MA 1S9YA 4K9EH 3TO4B 4N0UA 4LBEB 3QUMH 3GUTB 1T03H 1QRNB 4U1SB 3VGHA 5T3ZL 1MWAB 2XOTA 2W0FB 3BRFA 2VABA 3OKDB 1IBGL 2JIXB 4E5XB 3LD8B 2PYEE 3UJJH 1LEKB 1BBJA 4LRNL 1CFBA 4YDIL 2BDNH 4QF1A 1B0RA 2DQIL 2QQNH 3X13A 4FP8H 4ZUVA 12E8L 5TFSH 2R4SH 3PJSB 3QFJB 4BQ6A 5HYSA 3UZVB 4MLIA 3BPNB 3VW3H 3VA6A 4R96A 5F7EH 5SWZB 4WI8A 3QUKA 3VXMA 3GJEA 2XA8H 2Y07L 2RQ8A 3WKNA 5JOFB 2W9EL 3I6LE 4JZJA 4UQ3B 3IDYC 1PQZB 2Q8AL 1MY5A 5IB2B 4Z7UA 2VDRL 3T09A 3AM8A 3SKUD 2VXQL 3VI4E 2YK1H 4ZXBA 4NNYB 1HILB 1HSBA 5C71A 5I9QC 2HKFH 5EU5B 2BJML 1KN2L 4X6DB 3X17A 5I18L 3FOMA 1I1AD 1U8LB 4TOYH 3SJVA 5GIRA 5JIHA 1CQYA 3CFBB 5TE4L 1X44A 2QSTA 4IOFC 5KSAD 3B5HA 5CJOH 1KFAH 5JXAH 1LWRA 4HKZA 3KXFB 3PV6A 1VFAA 3M45A 1AXSA 3NZHH 5FUOH 1MCDA 3Q6GL 5ACLA 43C9A 2FIKB 1KIRB 5C0IB 3SDXE 3GHEH 1VEOA 3K3QA 2ITDB 4NKDB 5FUCE 3FQRB 3NIGF 3MNZA 1A4JB 3LEYL 4U1NB 3VXTB 2EH7L 4AH2A 3PABA 4V1DD 1QVOA 4CVXA 5KG9A 1OTUD 1JF1A 4GQ9H 4PJIF 2VZTA 1UWEH 2VDPH 4WV1B 5HVHC 1YQ2A 3TFKC 2C26A 4AENB 3LKOA 4GRWE 4QXWA 5E6YA 3BAEL 2N56A 4QTHB 3BW9A 4MZ2A 1FN4A 1CN4A 4CDHA 3UROR 3TLRA 1ZVYA 3HC3H 4PJ8A 5CGTA 2C1PB 3B9KB 1Q0XH 1JL8A 5J11B 4FQLL 1U8PA 3T65B 2ICEA 2NY7H 4Q6YA 1LD9B 4OZHA 3QB7C 4OLYL 2ITCA 5D7LD 1UB6B 5FKPB 4K94L 1OHQA 2IAND 1V05A 1RI8A 2PW1A 4KK6D 1R5WB 3V4VL 4QGYA 1KB5L 2AJ3A 3GSOA 4KVCL 4HXAL 2YEZB 3FB5A 4JZOB 5LWYH 1R5VA 3RQ3A 4ONGH 3JWOC 1OGTB 3BKMH 1YEKH 3MOBL 4M9PA 3IKCB 2Z0BA 5C0FB 5I9QB 3BN3B 3VWJC 5GS0C 4PIRF 4KQ4H 5HGAA 3V6OE 4X6CF 2WIIB 4OCLC 1UCBL 5IW6B 3WFDL 1I85A 1JN6B 2Y7QA 4TULL 1G6VK 4GXUM 4RFOH 1ZE3C 4GW4A 5EORH 4JVUA 4QRUA 4OTXH 3HMXH 4OZFB 3EOAA 1UJ3A 4PJGE 4RCAA 2DICA 1G6RH 1MCOH 1FP5A 3TBVA 4R7NA 4QRTB 4X7EC 2RCSL 4TVPE 2DWEB 1U8NA 4IS6B 3EYVB 2P5EB 1YMMA 3VMPA 4JFOB 4HUXB 5HVWA 4PBVC 4O51B 3V4PH 4RBPK 2VXTH 3SQBA 4X98B 5IOPB 5EWIH 5LKNA 3HC4L 2MQ3A 5C07A 3AROA 4NM8H 4RMRA 3DYPA 4YGAB 3DV6B 4RMQA 5C0BE 3U7WL 3VG0H 1UACL 1P4IL 1MIEH 5DHVB 3X11B 4WW2F 4NFCA 2ADIB 3IETA 5HVHB 5HHQB 1QEWB 2F58H 2FX9L 4APQD 2XRAH 3ZYOA 1DUYA 1WFUA 4BFGA 3BDYL 5GGTH 5IVXE 1GHFH 4KKCC 3VWKB 2Y5EA 1WFOA 4GKNA 1CGSL 1KELH 3MRKB 4J3OC 4P9HL 4ZFOL 2IAMA 2ZCHH 4Y19D 1WBXA 2A77H 5J6HA 5FCUH 1BJMA 1CT8B 5F72S 3S7GA 3UPRA 4UV4L 2G9HB 2BERA 4Y16B 1FC1A 2PCPB 3RGHA 1CDHA 3QCVH 5DVKA 1Z6JT 1F58H 4C4KO 4X9HA 1JRHH 2H32B 1K8DB 1LEGA 4WI4A 1F2XK 1VFUA 3QXWA 2OS7A 3OKOA 2X4TA 3NCMA 4JHAH 5I73C 1A9EB 1AJ7L 1SEBA 2J1KA 3P30H 4X6DF 4YXHH 4F9PA 2E8ZA 2JJUA 5EOCL 2E7LA 5MENB 1H15A 5ID1A 4M3KB 1GAFH 3WFBH 3VWJB 1EV2E 2NTFB 3ALXA 5HGGS 1CBVH 1HHGB 2ICES 4MNQD 2MQ0A 1VFOA 4PS4L 4U1MB 2BNQE 1ZGLB 3RJQB 5DJZA 3A6BH 4P4RB 5CWSB 2H3NA 2X09A 4FQCH 4JRXE 3K8KA 4WGVB 3ORJA 3EYQD 3N85L 3ESUF 1LHZA 5FO9A 1GZPB 1WCBA 1TQCB 4OZIA 1WITA 4XI5D 2CKBH 3HE6B 4I18A 4EOWH 1L7TL 5ITBH 4JY5L 1X5ZA 4GQPH 4NNPL 4M7ZC 4JY6A 4WFHE 3G9VA 1ZS8B 2DQTH 3MRJB 1U8MB 3QA3A 2AK4E 4QHMA 3C2SA 3DNKA 3HPLB 3C5ZB 3FHQA 4DKAA 1BAFH 5GJSL 1WUNT 4YXLH 1X5YA 3BP5A 2NYYD 4OM1H 5EPMA 3TA3A 3VH8G 1KCKA 3T8XB 3HI6H 4PGZA 1PG7W 3HC0B 3E3QE 2NTSP 3QCTH 2HTKC 4JFDD 5IQ7H 3KPQA 4G42A 4HWUA 2PUQT 3OAUH 2X4QA 5DUMH 4XMKH 4XC1H 3A0OA 3IAQA 4PJ5A 2R8SL 4QHNA 1K6QH 2XKNB 5I1IL 1FFNA 4RIRA 3JV0A 1XFPA 4HIHA 3G6JB 4JFFE 3MA7A 3SKNA 3KPSD 1DL7H 1XH3A 3ETBF 3FO1B 4KKBC 4NT6A 4HUNB 5F1NA 3MGAA 2JCCF 4NRYB 3K1DA 4X4MA 1G7LA 3BZFA 1OARL 5IWLA 1ROWA 1QSEE 4QKXB 5C09A 5DUPH 2DJ4A 4D8PA 1QPXA 4GKOA 1NMCB 4NO0A 2EXWC 5FDWB 1KNOB 1XF1A 3D48R 5C0DA 3LN4A 4F57L 4Y2DD 1TCRB 4U31A 3L95B 1H3PL 2VITB 3SBWA 4NN5B 3WFCH 6CGTA 2MMXA 4QHUA 1JNHA 4PJEF 3IU4H 1KT2A 1YJDL 1KBGH 4WU5A 5D7JA 3PDOB 3X3FL 1NBQA 4M61B 1M6OB 3VRIA 4DEPC 3S3JA 4MJIB 3P4NA 1LE5B 3UTQA 3JVGC 4PJHB 4S11A 4PLJC 1DBKL 4OT1H 1B4JL 4L4VB 2A9ML 5BRZE 2D7QA 3WO3B 1HZHL 4KMLB 4QNPE 3R1GH 2E7CA 3Q48A 3ZE2F 1DE4A 3DX6A 4AEIL 1EHAA 2OCFD 4I9WE 4FOMA 4Q9RL 3BESR 2MCPH 3L9RA 2LU7A 2HFGH 2NPLX 3HMWH 3GKWH 5HPOA 3FFDA 1A6VL 4QY8B 3PG2A 3HRPA 3REWA 4X8XA 1RHHB 4RAVA 5HY9A 5IMLB 3UC0H 1JPFA 4KI5E 3BOVA 5DLML 3CUPA 1RJYB 4Q2ZB 2DMKA 2P46B 1Q94B 5E24E 2D7TL 1YYLL 1IM3A 4PG9A 4RWHA 1ZT4A 4PP1C 4XGZB 2R69L 3WL9B 1BD2A 1K4CA 2NW3B 1FLRH 1CICC 1H3GA 4MA7L 4XPAL 4ZUTA 1FAKT 1IAIL 4GXVH 4HXBL 2J7LA 4IJ3B 4X5XA 4BZ2H 3IFLH 1A3LL 3MV8A 1JNLH 4QLRA 5D1XC 2E27L 3PDDA 4HKXA 5MEOA 4TRPL 1FO0B 5B39G 2EDYA 5IMMA 2JELH 5FOBA 3H9SA 3IFOA 2AS5M 4RGNC 3STZB 5BXFA 5B39B 3PWJB 4Z7VE 3PGCB 4HV8A 4Z7WB 2Q6WA 1SJHA 3H3KA 1IAOB 5EU6A 1U36A 1R24A 1YA5A 4ZXBC 4A2LA 1G9ML 2BRRL 3O6KH 5JXEC 2IPKB 2D7OA 3TO2A 2AJUL 2BOCA 3IF1A 1NSNL 3D25A 1NCNA 5DT1H 4D0DB 1FZMB 3LZFL 1MRDL 2P4AB 3VGDA 2D0FA 1UH2A 4CN1A 1GGCL 1JCKA 1OAYL 4LRIA 4R8WL 5JPNA 4O2FA 1U41A 2DQHL 1JGVH 1NCUA 3TCLA 3VXSA 3GSXA 5D7KE 1T6WA 1CS6A 4R4BA 4HPOH 4N9GA 3KLSA 2XNAA 1KPUA 3RGVA 1G7QB 4GG8B 3VGAB 3DI3B 4XBEL 4KRPD 5J89A 4L9LB 3LPFA 2DD8H 2PKDA 3KDMA 1MJJA 1KLFA 4KMTH 1RUKL 2IH1B 1H9VA 1IEAA 3T1FA 4LCWE 3PIQA 5GISH 3KS0J 3MACH 1NGZA 3BKCL 1RUPH 3C60B 3PWVA 2H41A 2W60A 3GMNA 1MRCL 1UM4H 3MZTA 4GG6B 3RDTA 1OGAD 1GIGH 3K4DA 1S9YB 1NAML 2GEEA 2H8PA 4L29A 5FAAA 5FDYA 3EFDL 3GMQA 4N0UB 4S1DD 1NMAH 1QUNA 3QUZA 3MXVH 4ZD3L 2VABB 4PJ8C 1SYVA 3GI9L 3ULVE 2YUWA 5GRZA 1BBJB 1ZOXA 2D3VA 4R6UA 2Q8BL 2VAAA 4QF1B 3SGDI 5HYSG 1CICB 1AY1L 4KJPC 1JNNH 3FFCA 1J5OH 4H25A 1B0RB 5E5RB 3ARQA 5LCVH 3X13B 4ZUVB 1X7QA 3K8MA 4RGMC 4XHJC 2VISA 1T2XA 5HYSB 4XCCL 5EUKA 2XA3A 4NPYA 4F7TA 4JJHA 5GHWH 4R96B 2R29H 4FN0A 4OCSL 3QUKB 5FUZL 2BVQA 5K59E 3H7BA 3VXMB 1JPSH 5LJYH 5IK3A 3GJEB 3O2WH 4G6FD 4AG4H 4RGNB 1INQA 4GMSH 1JYWA 4JZJB 3LHPL 4Z7UB 3BKJH 4CNIA 4ZXBB 1MWAH 4YBHA 4RWYL 1HSBB 1B90A 1CXEA 1ZXQA 2IQAA 1AKJD 3FOMB 3EYUL 1DDHA 4M7JH 3SJVB 5GIRB 4MXVF 3FN3A 2BY2A 3F7VA 1BQHG 2CR3A 1BVLA 4IRSD 1LILA 1RZ8A 5GGVL 3O6MH 4YHPA 1RZ7L 1NPUA 4EXKA 5BW7C 4HKZB 5HYJD 2YKLH 3PV6B 2CMRL 2N7AA 1VFAB 4CVWA 1U8HA 4PJHF 1BQHB 2ID5A 2WBJA 1AXSB 2XZQH 2XPGA 2E5EA 1FZJA 1VGEL 4FMFA 43C9B 1R3JA 2PXYA 4K23L 1CTOA 2W9DH 2BZDA 4PRHD 2VTFA 1KLGA 1MFEH 4ZUSA 1S9KC 1GGBL 1QFUH 4Q9QL 1T6VN 5L0QC 5I74C 4U05A 3BISA 5TF0A 3MNZB 3B9DA 1MCLA 3ARSA 4AH2B 1MF2H 3PABB 2YWZA 4G9FD 1QVOB 4CVXB 3O4LD 5KG9B 1GPOH 1JF1B 2NXYB 2JB6A 3IDXL 2O61A 3LKOB 3BW9B 1FZKA 4HCRH 4PPTA 1FN4B 3TZVD 4ZAKD 3DYMA 3HE7A 4UMGA 5JIPA 4PJDF 4XXCA 3VD3A 3P0VH 4K8RH 2IAMC 4PJ8B 1QNZH 4Z7QF 5CJ5A 3L7FA 5JZ7C 3UZEA 4OV6F 1U8PB 3KGRA 2ICEB 4HEPG 1Z3GL 4OGAC 4OZHB 4KKAD 3E6FA 3BP4A 2ITCB 4NUGL 5KVMC 2X4NA 4MZ3A 5IHUL 25C8H 1ZANL 3W0WA 5J9PA 2MNUA 1MHPL 2PW1B 3IXTA 5LQBL 2AP2A 1QOKA 2AJ3B 3GSOB 1U8QA 2UVEA 5C0GA 1DSFH 3FB5B 2I27N 1R5VB 4RAHA 3WDIA 4F9PC 3GM8A 3PWNA 1HDMA 4BSVA 2E7LC 5FHAH 5EBLA 3S37H 2HLAA 3AFLA 4RISH 1ZLVH 2X4UA 4TNWF 3JWDL 4ODBD 1I9JH 5E95B 5HGAB 5TE7L 3ZYZA 4D3CH 1HCVA 4AY0A 5E08L 2Y7QB 3E8UH 4M02A 4BZYA 4OIBA 4GW4B 1R0AL 2IH3A 4QRUB 4Y1AA 4K8RD 1MFAL 4P23A 3EOAB 4DWHA 4JDZA 1UJ3B 2FHFA 3TIEA 4XWOC 2AXHA 5DD1L 1UYWL 4ZPVA 1BIIA 5HHNA 3TBVB 4R7NB 4NQVA 4YFDB 1U8NB 3SDAA 1YPZF 3NCBB 1YMMB 1QFWH 4G5ZL 3U0TA 2Y06H 4BFIA 5I74B 3EKCA 1IQWL 5C07B 2EIEA 4P49A 5ANMA 4YDVA 3RAJL 3QEQD 4LVNB 3IETB 3BZEA 4JFHE 1DUYB 2WP3T 2IEPA 1INDH 3EOTL 1XGQA 4GKNB 2XWJA 2FEEL 3LCYA 4JQIH 2IAMB 4EKXA 4EN3C 2CXGA 1WBXB 5CZXC 3K46A 2UV3A 5J6HB 4OFYA 3SDCD 1IC4L 2BY0A 3ARWA 3UPRB 4JO4L 2E9WA 3SQOL 3VFRA 5HI5C 5F93C 1X5GA 5GGQL 1I4FA 3T2NL 3OWEA 4G6ML 1LEGB 5I15H 4Y2OA 3RU8L 4M5ZL 1S3KH 2EDDA 3UTOA 5IWLC 4NQCA 2X1XR 3PHSA 4P4KA 3OKOB 1P5UA 2X4TB 4TQEL 5FGCB 1SEBB 3ZKXC 3QXTA 1SBSH 1FDLL 5H35B 5JMOC 2VH5L 1UG9A 1H15B 2BVOA 2F53D 3O81A 5ID1B 1DLFL 2ED9A 3I75A 3PGDA 5IQ9A 3UTTD 5DQDH 1A6WL 1P1ZA 3AUVA 1UJTA 5CP7A 3R8QA 3HN3A 4LSQL 4M62H 5D7JC 3CDFA 4DKFH 2OR8A 2Z8RA 1OQOA 3HKFA 3VRJA 3S3PA 4LASH 5D2LE 1JHKH 5DJZB 1IM9A 4MXQD 2H3NB 3RPKA 4XPHL 1F3DJ 4N9OB 3P40A 3CLEL 2F19H 4AJ0A 1CLYL 2H32H 4NQSA 1WLHA 3EHBC 6FABH 5FO9B 1WCBB 5DFWH 4ELME 4OZIB 3T3PE 4XH2A 2XTJC 4O9HL 3D3VE 5CAYB 4I18B 3JWOH 1HWGB 1YEDA 3KYKL 3T0VA 4JY6B 3GIZH 4CADA 5HHVL 4QHMB 3H3PH 5GS0H 4BKLA 5T1LA 5A2IH 4Z95L 4MQXD 3TFKD 2ESVE 4CN4A 2Z92A 4QRRE 4S2SA 1OTSD 2J8UE 2EDJA 3KPTA 4IDJH 3TA3B 3BP5B 3BSZH 5EPMB 3OAYK 4OUUA 4UU9A 3WKMH 3N1FC 1J8HA 1KUMA 5DYOA 4HUMB 3MRBA 4XC3H 3KPQB 4G42B 1ZT7A 4TNWK 1OD9A 4Y4HA 3BZ4A 1FVDA 2X4QB 1QLEL 4PJ5B 4OZHF 1VERA 5DMGC 5EOQH 1H3XA 3OB8A 1FFNB 1A7OL 2C9AA 4RIRB 4KQ3L 4JPWL 4AQ1B 1PFCA 1FLTX 3OMZA 3W39A 4HIHB 4OLXH 2QQNL 4BZ1H 4ALAH 3MA7B 3SKNB 1XH3B 5E1HB 4NT6B 4QHKI 5F1NB 2RFXA 2IPUK 3FJTA 5D5MA 3VW3L 4QTIH 1G7LB 1CXIA 3ARDA 3BZFB 5C09B 2FH8A 1KEGH 4NKIH 4MGXA 2P8LA 2R9HD 4D8PB 3ZKXB 3U9PL 1D6EA 3OKYA 4NO0B 1KIUA 4V2CB 5C0DB 5GS0D 3LN4B 5FYLH 2C3VA 2HKFL 3D9AH 1X5FA 1FZOA 4BH8A 3RUGA 3EYSL 5I8OL 4QHUB 1JNHB 1KENL 1KT2B 2AJYL 2CDEA 4MD0A 4WU5B 5D7JB 4MNHA 1XMWA 3VRIB 3S98A 2LQRA 3P4NB 4JLRA 5CJOL 3UTQB 5JXAL 3QUXA 1KCUH 1KPRA 3WS6C 1TVHA 1IQDA 3MJ6A 4KJQD 3BFOA 4NHUA 4NCC2 4PTTA 3NN8A 1AFVL 1CGYA 3W81A 2A6IA 1GGIL 3GHEL 3FRPA 3KHQA 1DE4B 3DX6B 3HG1D 1J7VR 1C16A 2YRZA 1HHHA 1CDJA 2WNGA 1KTLA 3L9RB 1PSKH 5DRZA 1WIUA 5C92A 3QDMA 2WM0A 3FFDB 5GZOC 3RDTC 3REWB 4RAVB 4R90H 5HY9B 2H1PL 1PGRB 5ERWA 5SX4H 1JPFB 3WD5H 3H9YA 2HA1A 5JHLL 3CUPB 1QHOA 4P2QE 1U92A 3H0TA 2E7HA 4X8JA 4XHQA 4OSUL 1IM3B 4KKCD 4PG9B 1ZT4B 5FYLD 9CGTA 4OZ4A 2X7LA 3QXVA 3V0VA 1BD2B 1K4CB 4MJ4A 1ACYH 5GRVL 2DQFA 4G8IA 3KPRD 4ZUTB 3NGBB 2GITA 5HHOA 4X5XB 4JFYA 3GSNA 3MV8B 1WT5A 1Y0LA 4LSRH 4HKXB 3N1PC 5SX5H 5MEOB 3BE1L 4DKDC 1MCPL 2NY7L 5IMMB 1BX2A 5FOBB 2EKSA 1K9TA 5L2JA 3AS0A 3H7LA 3H9SB 5D1ZA 4OAWA 4OZGA 3IFOB 1NDMA 5BXFB 5IP4A 4HV8B 2Q6WB 1SJHB 5EU6B 1Z0NA 1R24B 4PJXA 3RKPA 1HE7A 5GRVK 4LVEA 5C0CA 2MWCA 3TO2B 2BOCB 3IF1B 3U30B 4YQXL 1OLZA 3D25B 4PJCF 1KACB 1ED3A 5GRUH 5HHXH 2QV2A 2NY3C 1QSFE 2QJDA 5E70A 5LBSH 3DHJA 5JPNB 4NQDD 3DARA 4O2FB 1T7VA 1OAUH 1FAIH 2AQ3A 3FZUC 1VEMA 3TCLB 1CZ8H 5JHDD 3T0EA 3KLAA 3VXSB 2AJSL 2WBJC 3G04A 4JDTL 1KCSH 3GSXB 3X3GH 1I3GL 4R4BB 1CGXA 4DKEH 1I1YA 5EORL 1NC4A 4N9GB 2XNAB 4OTXL 1KPUB 4B7IA 3RGVB 2PXYC 3V5HA 1JJUA 4P2YA 3TN0D 1GC1L 5I1JH 3LKRA 5FYKE 1G6RL 2WK2A 2DI9A 3S96A 3VXRA 3QI9C 3MROA 3KDMB 5DA4A 1MJJB 4YHML 2NY6C 2X9WA 3H2WA 1P7QA 4OF7A 4GAYA 2RJMA 1IEAB 3T1FB 3PIQB 4M48L 2VIRA 1NGZB 1CDUA 5DVLA 3PWVB 2W60B 1CVSC 3GMNB 3RDTB 1FVCA 3VG0L 2H8PB 4L29B 1BGXH 3GMQB 1MIEL 2H2SD 3S35X 4XXCC 1LO2H 3QUZB 4XNUH 1AE6H 2Z93A 4NQED 2HH0H 5I1EH 1MFCH 4C55A 3GSRA 1SYVB 4PJAA 5GGTL 5DC0A 3WO4C 4JPVH 5DJ2A 2VAAB 3RWJA 1KELL 4O2EA 4GSDL 1V5JA 3FFCB 4H25B 5K9KA 4LGSB 4IIQC 1X7QB 5HBBA 2A77L 2VISB 2DL9A 2J3SA 2ATKA 4Z8FH 4KKBD 4UTAH 2O93L 5EUKB 1B2WH 2M8XA 1OPGL 1F4WH 1NANH 4NPYB 4F7TB 2MOVA 1GCFA 1I8LA 4DAGH 2BVQB 3MJ9L 3H7BB 1TDQA 5IK3B 4Y4FA 3MUJA 3QUYA 1INQB 3N0PB 1JRHL 2YPVL 2GJ6A 3IRPX 1SYSA 2ZUVA 4JGUA 4CNIB 5DURB 3TYFA 4Y8DC 1XGRA 3PGFH 2IQAB 4XNZC 4YXHL 3ZYJA 3C6SA 1DDHB 4Y88A 3LS5L 4HFWA 4ODWA 1A6AA 3LQAL 1ND0A 1KCVH 2X89A 5FF6A 3F7VB 1IGCL 5MEQA 1BVLB 1RZ8B 3TJHC 4YHPB 3HA0A 1F11A 2P5WE 4QRPE 4P23C 2H26A 1U8HB 1CE1L 1WWWX 2WBJB 2XPGB 3ZDXE 5CUSH 1N8ZA 1FZJB 3QDJA 4F8TA 3TESA 5HDBF 1ES0B 1R3JB 2PXYB 4CRPA 1KB9J 5SWSA 1KLGB 2OBGA 4E41E 3LQMA 4ZUSB 1VKXA 3ILQC 3AAZA 3O0RL 1F3DH 3ABZA 2APBA 5CINH 2NNAA 4HC1L 1HINH 4LLUA 2DMBA 5BV7L 2OXGA 3VMOA 2C5DC 5ITBL 2P49B 2FGWH 1J1OH 4QCIA 2DQTL 1XF4A 4TSAH 1NEZA 5AZEL 4LDEB 2JB6B 2O61B 3G6DL 4J3XA 1VFMA 5FM8A 2VXSL 1FZKB 3V8OA 4JVWA 3UTSA 5IROA 4YXLL 1FYTA 3ARXA 4LIQH 1CR9L 4G6JH 4YDKL 3HE7B 5DJXA 3HI6L 3V8CA 2R23A 1NGQH 4YDLB 1CICD 3EYOA 3L7FB 2DTSA 1F3JA 3TP4A 3WO4B 2EDBA 3S5LA 2G2RA 5DUML 5D1XD 5F96H 5EOTA 4LLVA 5D70H 3RFZC 5CJXC 5DHXB 1IVLA 2BVPA 3E6FB 3GO1H 3BP4B 1A0QL 2BHZA 2X4NB 1X5KA 2Z8VC 3OB0K 3W0WB 5J9PB 3TWCH 3PXHA 3DVNA 3IXTB 4HF5H 2FR4A 1FNLA 4G3YH 2BVYA 1BHGA 4JRYD 4P4KC 3V6ZA 1U8QB 2C3WA 3QP3A 5C0GB 4I48A 3TVMC 3PWNB 1VENA 1HDMB 4BSVB 5JXED 4JFEE 1JNJA 5I16A 4IRJC 3DGGA 5EBLB 4NGHH 2HLAB 2X4UB 5I1AA 1WK0A 5IMOA 4XNZB 2GSGA 2C7UA 4NM4L 1WVZA 4PRBA 3WFHA 1TQBC 1WEJH 4UBDC 4XNYL 5JLZA 3RBGA 3NTCL 2JK5A 3IU4L 2IH3B 3U4BL 1F6LL 1W72B 4Y1AB 5E9DE 2EDTA 4P23B 2AXGA 4JDZB 2K7QA 3TIEB 3PP4L 3OKLA 3IGAA 4C56D 5E8OA 5GRYA 4ZPVB 1QLRA 4BFEA 1BIIB 2W0PA 5HHNB 3P9MA 4EI5A 4NQVB 1SBBA 3SDAB 3E6HA 1MAJA 4ONFH 4D0BA 3U0TB 4YO0A 3WUZA 1IT9L 1S9XA 4BFIB 3WIFA 3U2SA 3R1GL 4I0PD 1WWAX 5TJWK 1C5CL 5ANMB 4G6KL 2MCPL 3STLA 3OTTA 4YDVB 5JO5A 5INDA 2HFGL 4ELKA 2R56H 4FXGA 1LVEA 3BZEB 4RA0C 4PJBA 1RJCA 3UC0L 1T7XA 2VC2L 2P42B 2EECA 1ZK9A 3BP6A 1H3WM 1XGQB 3MLWH 2XWJB 2QL1A 5D72H 5E0QA 3QQNA 4WFED 4KJPD 2DQGH 1DBMH 4HZAA 1J88A 1FLRL 1O0VA 3HNVH 2R0KL 4UB0H 1R3KA 2CO7B 3IFLL 1HSAA 3VFRB 5KSVA 2CLZA 1F4XH 5CZVH 2A9NL 4QWWC 1I4FB 4P9MH 1D7FA 4JGMA 3ARDC 4J4PA 2W92A 3FMGH 2YD1A 3BRDA 4NQCB 2IFFH 4P4KB 2WP3O 4PYHA 1UXWA 4FTVE 1RIVL 1XGUA 5F89A 2BVOB 4FG6D 4OI7A 2P43B 2ZCKH 4YX2H 2DS4A 4P2RE 5FHBL 4XPGH 1DN0A 3I75B 5CP3A 3PGDB 4TUKH 5IQ9B 4Z7OF 1P1ZB 5CP7B 1XEDA 4OCXL 1VFBA 5DT1L 2IC2A 5BOZG 3VRJB 4KTDH 3VFOA 4BQ8A 4KHXH 1IM9B 5I19L 3T2OA 1MQKL 2NX5A 4JPKL 1TTGA 3BEVA 4NQSB 4C57C 3NMEA 4LLYA 3UTPE 4GW1A 4YHIA 5FO8A 3QAZB 2CIKA 1D5BA 4XH2B 3W11C 3R0NA 3MODH 2JB5L 2I25N 2FJGA 2KZ1B 1YEDB 2B1HH 1WQVT 4WCYL 4CADB 1M4KA 2YA1A 1CDIA 4XVSL 4BKLB 5GISL 5T1LB 5J12C 3RTQA 3MACL 3FTGA 5C86A 4U6YA 2VLMD 2Z92B 2OR7A 4S2SB 4OQ1A 5CSZA 4OUUB 1UM4L 1QR4A 4BSWA 4UU9B 3HI5H 1TZGL 1J8HB 4N90E 1DQLL 5DYOB 3MRBB 3O45A 4NFBA 2AJVL 1D5IH 1IEBA 1G0YR 1NMAL 1ZT7B 5BQ7A 4YWGL 5JZ7D 4Y4HB 3BZ4B 1FVDB 1T2JA 4MB4A 5TH2B 4NWUL 4PJ7A 5DMIH 2Z31C 1WT5C 4W70A 4OGAD 5D93C 2NZIA 1YN6A 1JNNL 3R0MA 3W39B 5LCVL 2HN7A 2ZUQC 2NY4C 3S6CA 2F54D 2JJSC 2RFXB 5CD3A 4L1HA 2HFEA 5D5MB 3MNVA 4PB0H 5GHWL 3U9UA 3ARDB 4YIQA 1JPSL 4PJ9D 5GGUA 5T1DH 4YHLH 3O2WL 4X7TA 4AG4L 1AI1H 4XP5H 2P8LB 3LMJH 2V2WA 1D6EB 2O5ZH 3H9HA 4YZFF 3BKJL 1IC1A 4F7CA 1BFVH 2C3VB 1MI5D 2VDNL 1A1NA 1FZOB 4BH8B 5JW5A 3RUGB 4M7JL 1U93A 1ZTXH 2CDEB 5KOMC 4MD0B 1ZT1A 4KGLA 4MNHB 3FQNA 1D6VL 3O6ML 4JLRB 3KR3H 2GK2A 4XWOD 1KPRB 1K3IA 1VACA 1TVHB 1IQDB 4LSPH 4Y5YA 3FRPG 4NHUB 3QPQC 1HIMH 3D2UD 3NN8B 4PTTB 1G1YA 1GOFA 2A6IB 1J1PL 3ULUC 2V5RA 2PO6C 3ZDZE 1MFEL 1C16B 1HHHB 3IDIA 5DRZB 2R0WH 1KTLB 3C08L 4M5YH 1FL5A 4WWKC 4AT6A 3KNBA 5KJRH 3QDMB 3SEPA 5J12B 4FFZH 5ERWB 3ROLA 4H0GA 1BQSA 3HFML 1M1SA 1U92B 3H0TB 4GKSA 4X8JB 2N4IA 1YYML 3N9GH 4HCRL 4OZ4B 2X7LB 1F8TH 3MFFB 4MQTB 3V0VB 4EN3D 3UJIL 2NY1C 1P7HL 2DQFB 4G8IB 4K8RL 5HHOB 2GITB 5ECJE 2B1AH 3IS1X 5C2BH 4JFYB 3GSNB 4W6XB 4WY7H 4ORGA 1U95A 1Y0LB 2XT1B 1CVRA 5D93B 1X5LA 1RMFH 4HW6A 1BX2B 2BOBA 2ICCA 5BS0E 2ZUQB 2EKSB 4I3RL 3IDGA 5L2JB 5D1ZB 4OGYH 4OAWB 4OZGB 5IBLC 3QUYC 1NDMB 4O5LH 4XCFH 3PWPE 5C08A 2NCMA 1OGAE 4ODTH 2FLBT 4PJXB 2DI8A 5DK2A 2ICWJ 5C0CB 4KDTA 1OSPL 4JB9H 5FHAL 3SCMD 3V95A 5IESH 1ED3B 3VFWA 3SE9H 3QIWC 5K9QG 4L3EA 2CK0H 3FB8A 4K3DH 2C3HA 1LE9A 3PP3K 3ULVC 4J3WA 4P48A 5EZIH 3VDAA 3WIHA 1NGWA 3T0EB 3KLAB 3G04B 3E8UL 1RAMA 5I8KH 2YXFA 3QG7L 1I1YB 2Q7NA 2BNRD 3EHBD 1NC4B 4P2CG 3P11H 3I9GH 1NFDF 3V5HB 3L5IA 5IHZA 2UWEE 5F3BA 5C0NC 3LKRB 2XTJD 3T0DA 3S96B 3M8OL 3VXRB 1T2QL 3MROB 4LFHG 3MLSL 4PLKD 1P7QB 4GAYB 3INUH 1G9NC 3I02A 1AQDA 3BJ91 2VIRB 2HT2C 4MJ6A 1SVCP 2W0KA 4XAKD 4KK8C 3SDYL 3JUYA 1UB5A 4ZMAT 3TNNA 4NP4L 5CEXA 3QEHA 5HGHA 4IOIA 3QIUD 1FVCB 5C1MB 4LSTL 2FEEI 5L2KA 2VZSA 4NHCH 2OMBA 4QHKJ 1KXVC 2P44B 2Z93B 4OJFH 1CXLA 4PJFE 4BUGA 3GSRB 1OD7A 5F70A 4PJAB 3NAAH 1INDL 4X9GA 5HI4C 4JR9H 5DJ2B 4G7YL 3RWJB 1E28A 4O2EB 4JQIL 5AYUL 5K9KB 2N1KA 1YNKL 3LDBB 1VADA 4X4YA 5ACZA 4O00A 4G8GD 4LLAA 2ATKB 5ESVA 4KHTH 4OFPA 4MVBC 1Y6KR 4MNGA 3PHOA 4KV5E 2CGRL 2NXZC 5FK9A 4M43H 4Y4FB 5E6IA 5EIIA 4QOKD 3QUYB 1QRNE 2GJ6B 3WN5C 1SYSB 5E2TH 1S3KL 4NCC1 4PGJA 3TYFB 5JDJA 1XGRB 4G8EA 1G1CA 4IMKC 3MCG1 1SBSL 3C6SB 4HFWB 3U46A 4ODWB 1A6AB 1A7NL 4PRIA 3W9EA 1ND0B 5MEQB 2F8OA 5F44A 3VE0A 1OCWH 2H2PC 1F11B 4M62L 2QSCH 2H26B 2ENSA 5GRJH 2KZWA 3CGTA 1A8JH 1IGFH 4NBXB 5HVGB 3BPLB 4UZGA 1QSVA 4LASL 4K71C 1JHKL 1N8ZB 3QDJB 2CUMA 2XACC 4EI5C 5JTWA 1MREH 1J0KA 4MHHG 5SWSB 4K3HA 1VKXB 2XY2A 3AAZB 4X6DE 2NNAB 4LLUB 4MA3A 3UP1A 1NEZG 1QSZA 5K9JH 3JWOL 5H37G 4ODUA 1OTTC 4BM7A 5AEAA 4WVRA 2ZNWA 4QCIB 3GIZL 4B7LA 1XF4B 1NEZB 5GS0L 2P24A 4WWID 3KXFE 3T08A 3MLXL 3UTSB 1WICA 1XF2A 1FYTB 4WDIA 1A6PA 1OP9A 1EDQA 5DJXB 3RWEA 4GRMA 3S5LG 3FT4A 3NCYS 2I07A 2R23B 4L9DA 2J6EL 3ARTA 1F02I 3EYOB 3BVNA 3FL7A 1F3JB 5IBUG 4Q7DA 3S5LB 2G2RB 3QH3A 5EOTB 2EDXA 4FABH 3W9DA 3P73A 5L6YL 5IBUB 2C4FT 2BVPB 5ISZA 3UYOD 5EOQL 3PF2A 3S36L 1QZ1A 2HP4A 2XN9A 5GJTL 3RPIB 4OLXL 3DVNB 4BZ1L 5T1KA 4J4PC 3IAPA 4UUJA 2FR4B 1TPXC 3MRRA 2NXZB 3V6ZB 3N1MC 2X4OA 4HWNA 4Y8AA 4I48B 5BO1H 2P48B 1N0LA 5KAQG 3L6FA 4QTIL 5I16B 2Y36H 1B0WA 4DN4L 2J12B 3DGGB 3QISA 5I1AB 3GZKA 4ODHL 3FO0H 5IMOB 1I3RA 3HNTH 1NC2D 2O5XL 4Y5VA 2NY3D 2VR5A 2APVA 2GSGB 4HMDA 1LP9A 2C7UB 4PRBB 2OJEA 3WFHB 5FYLL 1U3HC 5FV2A 2PYED 5TQ2H 3V5DA 4XTRD 2A73A 2A1WL 2V7NA 5JLZB 3FZUD 5I17A 2VLKA 2EE2A 2JK5B 4PB9L 3IAGC 5DZLA 2AXGB 3BGAA 1KJ3H 3B9VA 4LHUA 3OKLB 3IGAB 5E8OB 3LKPA 4LAQL 1QLRB 2QQKH 3P9MB 5H8DA 4EI5B 3H9ZA 1TNNA 3MLVH 3UTZA 3QI9D 3E6HB 2NY6D 4C83A 5C0RH 2J8HA