3G5YA

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DILMTQSPVSMSLSLGDTVSITCHSSQDISSNIGWLQQAPGKSFKGLIYHGTNLEDGVPGRFSGSGSGADYSLTISSLSSEDFVDYYCVQYGQFPWTFGGGTSLEIKRADAAPTVSIFPPSTEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSSTPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 175 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yA01
3GB7A 3CVHL 2ZCHH 3DMMD 5HI3C 1SBSL 1NDGB 4U3CA 1RZGA 4X0KB 1HNGA 2JTDA 1D6EA 2VDPL 4UI2A 3U9PH 5L88L 2R2HA 5C0IB 3MBED 3WIHL 3AREC 4MQXC 2XWJA 3QDHA 4L8CB 3THML 5EOQH 4ZAKA 4H8WH 4IRZH 5D8JL 5DYOB 3GO1H 1GGBL 3ZKXB 1QLEL 1QTYT 5SX5K 3IDXH 4PRAB 6CGTA 5I1AB 5T33H 1G7JA 4KI1A 3H9SD 4HUNB 3BD3A 3CFIC 2Z35B 4N68A 4WW1B 2K9UA 5HDQL 1NEZB 3MV7B 4GBXA 1I1CA 4S2SA 4NQEA 4Z7UF 5JXEA 3MNVA 3G04A 2NR6D 5C07D 1SEBA 3REWA 5DMYA 3D18B 5IB3B 5FCUH 4HQQL 2VR4A 5FM4A 3MA7A 4MDJA 3MJGX 2EKSA 3GHEL 1BIHA 1RV6X 5ECJE 5I1GH 4JB9H 4Z76A 3QXDA 4KVNL 2PO6C 2ZP0T 4LIQE 4PJXB 3RL2B 5A3IC 4JRXB 2G9HB 4FQIL 1G0XA 25C8H 3NACH 1BBJB 4IRSA 2XZAL 5F21B 2KPNA 2R2EA 4W6WB 4J8RB 3WLBA 2RQ8A 1GIGL 1EVUA 3EO1B 3O8XB 1T22A 4NKIL 2D7NA 3GRWH 5T3ZD 3AB0C 3MRFA 4LCYA 3C2AL 2OI9C 5GRJH 2OTPA 2ADFH 1QHPA 4FTVD 4LCWD 2P8PA 1G84A 5IQ7L 4F58L 2R39A 4WHYH 1IC4L 4N5EC 1H3XA 4NWTH 1MWAA 3SKNB 3U46B 4Z6AT 4PBWD 4KRPC 5FYJH 1WWAX 1SVCP 1P9MC 1EK3A 2YBRB 4WI6A 5EOTA 4B5EA 1U42A 5DA4A 4NN6C 1AHWA 5JPMA 3BZEA 2CIIB 4G8FA 1AKJB 1C5DA 3MLSH 4HFUL 4ZFGL 3W39A 2A6DB 1CFBA 4KQ3H 2CRMA 4E0RB 5KZCD 3WJJA 1OAKL 2R1YB 4CNIB 4YFDB 1KENH 2R2CA 2NXZC 2PYEA 4TSAH 1JGDB 5E2TH 5GXBB 3WL9B 3PL6C 4TN9A 3SDXB 4L3ED 2HJLB 1CFQA 5J11B 5HYJA 3D39A 3UBXI 5F6IC 2WAHA 5DJ0B 3U30B 1UEYA 5I19L 1OT2A 2DQGH 4YR6A 4XPAH 1FZOA 1MCDA 4FFYL 2XIDA 3TCXA 1S7QB 1I7RA 2C4FT 1HQ4A 3TIDB 1U3HD 1RZ8A 1KULA 3QULA 3BDBA 4WUUB 2J6EA 2P48B 3C09C 5B39B 5CP7B 1UEMA 2EH7L 4I3SL 4A6YH 1GZQA 5I66B 5IGXL 2Z0BA 4O2FA 4F7TA 3GFUA 4JPVH 5HJ3B 3VWJB 2FECI 4D8PA 4M7LH 2NY2D 4YHYB 1OTTC 1RZFL 1I8MA 2RHEA 1RPQA 2AKRB 2H2SC 3KYNB 3OKKB 5IVXE 5TDNB 3TYFB 2QADD 2HG5A 5BOZG 1BLNB 3IKCA 5DRZB 1XF2B 1KTRL 1TZGH 1FG2B 3HC0A 4YQXH 1MCSA 5JHDB 1GGIL 1KNOA 3MGOB 3L5HA 5TJWK 1WITA 3D9AH 3QUXC 1F2XK 4P5TD 4OI9A 4QRPD 1MREH 1T03L 1PQZB 1EGJA 4BJLA 2XN9B 4UZGA 3RVUD 4HUXB 1IQDB 4MJ5B 4ZNEE 1YJDH 4KFZC 3M1BB 5HYSG 5D1XB 1A02N 3OBAA 3P4OA 4NQUA 3UBXA 4BFBD 3QQ3A 5ELIA 1U0QA 4IOFD 1ETZB 4AT6A 5CBAB 2XRAL 1JZ5A 5BCAA 4Z7QE 1F4XL 1T04A 1YNKH 1UZ6E 4FQHB 5DC9B 4U6VL 1GC1H 2ERJB 3LEXA 5FGBA 5D71H 2FGZA 1FZMA 1JI1A 1M6OB 2C26A 3WFZA 3UAJD 4ELKA 3LS4H 1TTGA 4HUUB 3WD5H 5LAXA 1JPFA 2LVEA 3WNMA 3D5OF 4QTHA 1A5FH 3FT2B 5IG7A 4QRTA 3SPVB 2DWDA 4GQPH 5IWLA 2BSSA 3GGWA 3MRJB 1C1EH 1K2DA 1IRAY 3BN9D 3VG9C 4BH8A 4JO4L 5CJXC 4OCRL 1CGSL 1A1OB 3MCKB 3O3UN 1CLOH 1X5IA 5BVJA 5I1DB 4JY6A 3VWKA 1EEZB 3DBXB 3G5VB 4D0BA 4EDWH 1S7WA 1OP5H 5L2KA 5IEHA 3PABB 1JGUL 5IW1A 1JWMB 5HYFA 5D1ZB 5SX4I 2AEPL 5FEBA 2KDGA 5C09B 4G6JL 5MENA 3MLWH 3OAYH 4UILL 1EERB 3P30H 4OLUL 4YHPA 4ZFFB 2X4QB 4U1GB 4GMSH 3FZUD 4GRLB 1ZHLB 4D2NA 4XNZB 5C7XL 3QEHB 4ZFOL 4PYGA 5IHZA 2YK1L 1MAMH 4RFOH 5TPWL 4PRPD 3V0WH 2GSGB 5AZEL 3MYZA 4JO2H 3VFSA 1M7DA 3LRSB 4PJHE 2XV6B 4JQIH 1RUPH 2ZNWA 4LVOB 1BQHA 3ESVF 4GRMB 1DQDH 2V2XA 4PJBF 5TDPB 3ZKSD 1MQ8A 3EO0B 2BRRH 5J8OA 4LFHG 2XWBB 4ELMB 3VW3H 5DZNA 3O4LB 1I8LC 2AP2A 4JDVB 4JFED 5E2WH 3S96A 4KJQC 1TJGH 4XI5D 1T2XA 2EYRA 3TF7C 5CHNB 2G75A 4L9LA 3U4EB 5T3XE 5JDSB 3QT2A 1F2QA 5EU6B 4G8IA 2GKIA 1TFHA 1X44A 4M6AA 3O6FD 4R97B 3ILQD 5I1JL 5INDB 2KL6A 2VJXA 3ARGC 1DBML 2QTEA 1T0NB 5GS2D 1S7SA 4JVWA 1NEUA 4EEEA 3BJ91 4M3JA 3V2AR 1YEGH 3EFDL 3MJ9H 1ADQA 2P5EA 5GGUA 4AEIH 1CR9H 2EECA 1F4HA 3SEPA 5JO5A 5ERWA 4NO0B 1EFXA 1L0XA 1JNNL 4GRWB 4RDQF 4JDTL 4HWZB 3TA3B 3NFNB 2DMCA 4P2OB 1T89C 1ZWIB 1CICB 4XCCL 8CGTA 2PNDA 4S1SH 4HH9B 1S78C 4LCUA 4JPIB 3VXSE 1I1AA 4KJYB 3BZ4B 1MOEA 3UEZA 2UWEF 1TETH 4NO3A 2IH3A 3MOBL 4P3DA 4ZS6D 3SDAB 2F5BL 2FJHA 5CSZA 4ZODA 4YHOL 2W92A 2F5AL 5TQ2H 4RMQA 4X80L 4QRRA 5E8OB 1I1YB 5JOPE 3H3PH 1C08B 2OL3L 4PGBB 2OZ4A 1MJ8L 3O9WB 5JA9A 3G6DH 4WU7B 1A3LL 3IXAA 3RY6A 2E9IA 4JPWL 4L3CA 4TUKL 3ROOB 1BMGA 4PLNC 5F1IA 2OBGA 4S10A 5C0EB 2OMNA 3IETB 1AGCA 3MREA 4XXDB 1CG9A 4MQ7A 3I2CL 3BOVA 3OGCA 4LMQI 1U58B 1J8HD 3BXNB 4N1EA 4YFEA 3O2VH 1KC5L 4OGYH 5AUMA 5FV2A 5DJYA 3GJEB 3NABH 1CDYA 2E5EA 5GGRB 4AQOA 3C5SB 4GG6B 5HVHB 4HK3N 4LSVH 1ZT4A 4JHAL 3UTZA 1HKLL 2JJVA 1GZPB 2X09A 4GKZB 1WUNT 2E7MA 1CT8B 4RGNB 3B9VA 3L7EB 4P4KC 2GK0B 4GSDL 2A6KB 1I1RA 3BP7A 5IEKA 2I5YL 5DO2C 4NZRH 2Z8RA 1NGPL 3L5IA 1K8DA 4CADA 2ZPKH 4NRXB 2GQHA 4G6KH 5IFHH 1JWUA 2P46B 3TO4D 3ZLQC 3DO7B 1CI5A 1LO4L 3MFGB 4GXUM 5CCKH 5BMFH 2QSQA 5FM8A 2FRGP 3BP5A 1IAKA 4N8VG 3MV8A 4XP4L 5F88B 4M8QB 1Z3GH 4X6DA 1M05A 1T4KB 3HE6C 4ODWB 4HS8H 4PRIA 3T3MF 1PSKH 5I71C 1RJZA 1I1FB 1R24B 4PUBH 5KVGH 4OZ4A 5DQJB 3QFJE 2XTLA 2DQTH 4QCIB 2DQEL 1CFSB 2YN5A 4D9LH 1IGML 3QWQB 1I3RB 3QO1A 4GLRI 1R3HA 1U2CA 3D25A 1VADA 2HJFB 3L5XL 3MROA 4C56D 4FQ1L 5I1EL 3SKJL 4JFQB 3PHOA 2AJUL 3CFJA 1T20B 1II4E 4M5YH 4AH2B 4XBPB 1OF2B 4ZAKC 3T8XA 4AEHH 4UT9H 5DJ2A 2BOCA 5BO1H 4ZXBA 4X98B 1WIUA 3EO9H 1J05B 5EBGA 1S9KC 1JZ7A 3GI9L 1XR9B 3S3PA 2VDQL 3LEYH 2RIKA 4KROB 2ZUTA 5DJZA 4GBXC 5DR5L 2EXYD 2EO1A 4MJ6A 4JANA 1DEEA 4NQEE 4CMMB 2F54A 5JXEC 2XA3A 1QBLL 2W65A 3T77A 3C8KB 2YUXA 4XVTL 4YUEH 4NFCA 5ACZB 2GJZB 3QJHB 2X4OB 1J1XL 4UDTB 3DYOA 1U8IA 4RWHA 3JWDH 3UTQB 3I02A 2X89D 3AREB 5MERB 3C08L 4HGWA 4RMTA 3ULSB 1CVRA 5ISZD 2Y5TA 3TO2A 1P84J 1FPTL 4OZIB 4MNHA 4IRSC 3T1FA 1DL7H 3UBXG 3F5WB 1CD0A 1YMHA 4LSRL 5M95B 2DQHH 5HHOA 4UV7L 2XPGB 7FABH 3UTTA 4WENB 4ZPVB 5MHSE 1S9WA 5FYJU 3I6KA 2VRAA 5CEZE 5FYLE 1TPXC 3FL7A 4TSCL 4YE4L 2AJ3A 5JORB 5C0JB 4YHLL 1BFVH 4DUVA 1RZ7L 2DQCL 4ESKA 4QXWA 5KVEL 4YZFE 4AENB 2DI9A 1NQBA 3B9EA 1D5XA 1QLRB 1MJJA 4ZO8A 3L3HB 1U8JA 1G7HA 1L7IH 3CMOL 4XWOD 4E9LA 2PO6B 3GJFB 3S35H 1E6OL 1WZ1H 1AHWC 3RVTD 1G9MH 1UWEL 3X12A 2DICA 3SJVA 5L6YH 4YWGL 1MFBL 4OCYH 3FCTB 4UV4H 5TE7H 3U0TA 1AIFA 2PXYD 4TQEL 1BGXL 3RKPA 1CGWA 3AB0B 3RIFF 3RTQA 1U93B 1Z9MA 5BOPA 2LU4A 1MHPL 4ZO6A 4GMTH 2PYEE 1QRNA 4LGSB 3GMQB 3TESA 1KCLA 3K80A 3FOLA 4B50A 3HE7D 1XH3A 2VH5H 4X6BB 4WWKA 3PJSA 1JE6A 1WAAE 5GHWH 2XTJC 4P57A 4PJ8A 5HYJE 3D39E 2XTJE 2A9NL 1HYSC 1KIPB 2OR9H 4P2CG 4NN6B 2HWZH 3L3DA 4DN3L 2I60H 3QUMA 4OCWL 2VLJB 3AROA 1BQHG 3FO9A 1RJYA 4U2YA 2LU7A 4I77H 3MOQA 3KPLB 5DUBB 2QQLL 2V7NB 1QSZA 5EBLB 2VITB 4NQDE 4UDUB 1PYWB 4LSTH 3OJ2C 4NCC1 4OD1L 5CFHA 4XGZA 4L9DA 3PL6B 4I0PB 4Y4HB 2IALA 4O2EA 3VDBA 1KTLA 3UPAA 2DIAA 4MD0A 1A7PH 3IJSB 5F6IB 4BK4A 4JG0H 4G9FB 1A9BB 1MF2L 4A2LA 1IILE 2BDNL 4NKDA 4UT6H 3SE9H 1HQRA 4JLRA 1CS6A 1T5XB 2AJVL 2DKSA 2Y7QA 4M48H 2VXQL 4KV5F 3V6ZB 2MOVA 2Q3AA 4DGVH 5EC1B 2J4WH 3P0YH 2DMKA 3JWOL 3LKSB 3FO1A 3MA9H 5IVXB 4UINL 1A6ZA 1LD9A 4KI5C 3GZKA 4XWGL 3O41A 4KI5E 1N5AB 4N90D 3MRMB 5GGQH 5FGBC 5HDLA 4WI3A 1P1ZB 1DBJH 3RIFK 3AM8A 1VA9A 3QIUB 3AAZB 1BZ9B 4K3JH 1IBGL 3MLVL 4JHWH 4U1IA 1KJ2H 4D9RE 3CVHA 4UU9B 1JV5B 1QSED 3QUXB 3ULVH 3AMKA 3QIBD 2ZKHL 1A6AA 2J7LA 4JFZL 5B38A 5IK3A 1CDJA 1YNLL 3BPNC 5IWLC 1XGPA 2E6QA 3BH8B 4OIIH 5IB5A 3WFHA 4KKBD 1QPXA 1E4WH 5IB1A 4OAWB 1RIUL 2O26U 2LAGB 2PCPA 4Q7DA 2BVOA 3VWKC 1BZ7B 1AQKL 3BE1L 2EIDA 1N6QL 3GUTB 3UJTH 2EDJA 4OKVB 2GI7A 1CBVH 5KN5A 3P0VL 3MRRB 3E6HA 2D4FA 5MENE 3TBWB 3OQ3B 1G1YA 2RCSL 5GSVB 3CH1B 1BJ1J 1KB5B 4HUWA 4LSPH 1EFQA 2EDDA 3KHQA 4QKXB 3M07A 5GGTH 2FATH 3MRHA 4RSVA 2DMBA 2QKIB 3PWNB 1A1MB 4PLKD 3VG9B 1MUJB 3R06B 1QFWL 3WKNA 5IROA 3JBG7 3RWJB 1KCKA 4KH2A 3WSQL 3FKUS 3RDTA 4PJGF 3NIDE 3RZCA 5DFTA 3S5LA 3V4UH 1AD9A 3W9DA 4HWNA 2CO6B 1L4IA 3EUUA 4XXCA 1NBZA 4UIKH 5JW4N 2EYTA 4RNRA 3S35X 5C2BL 4CN1A 4NYLB 3B4NA 5EO0A 2NX5A 2Y6SC 4LLUA 3QISA 3LH2H 4DGIH 1MFAL 2R9HD 1B2WL 3DRQB 5ADPH 2E7HA 4M7JL 4NHUA 2R0ZL 2HLAB 2RJMA 3S4SA 4Y4KB 2J1KA 4WTZA 2FBJH 4L9LC 1YYML 1FZJA 3ARBB 4I9WD 5E9DD 1LK2B 4DFHA 3W0WA 4LP4A 4HBCH 3S34L 2X4TB 4ORGA 2X4SB 1GXEA 3HNVH 2C5DC 4AM0B 2IH1A 2EDRA 4KHTL 2BVPA 1JHTA 2BZDA 4PJHB 3N1FC 1T7VA 4ZTPH 4YEFA 5IBLD 4QXUL 5CD5C 1QSFA 3QHZH 3VXRA 2R0KL 5M7QA 2AXJA 3C60A 3UP1A 4TSBH 1A4KA 3WMSA 1FC1A 4OSUL 4HWBL 2FL5B 3VGDA 3TN0D 2Z93B 1CLYL 2BSED 2P5EE 4GW5A 2AK1H 4L3AA 2W0FB 3BUYA 5L7XL 1NCCL 1HHHB 4X4XB 3G6AB 5ALBH 1HKFA 2IBBA 4WY7H 2AABL 4OIAA 1AXTL 1CZ8L 4BQ6A 4Z77B 3BQUB 4CN6A 2OQJA 4HC1L 3O81A 1I1AC 4WW2F 3EOYG 2BNQA 3GSWA 3HR5B 4EI5A 1BM3H 4MLIA 4N0YL 1MI5A 3EKCA 4K2UH 1IZKA 4LNRA 4G42B 5IBTH 5EN2B 1XR8B 4HKJA 12E8H 1S7XB 1FH5H 5C0RL 5A16A 3C6SB 4QRRE 5LWYH 4P9MH 1NCBL 1JZ8A 2JE8A 2FX9H 1JPTH 5EC2B 3RY6C 1LO3H 1W8OA 2PETA 5C0NC 5MEQB 3WXWH 5J6GB 1HH6B 2H1PL 4RMRA 2B8OT 1BEYL 3MGTB 2AV7B 1UKQA 1X5HA 1PG7L 1A6TB 1F58H 4LCCA 5DJCB 1Q1JH 2HVJB 1WVZA 2DYPD 3GSNB 1IM9B 5EZJA 3HRZB 3U48A 4NQXB 1C7TA 3E6FB 3B9KA 2YPVH 3VXSB 1CFVL 3H0TB 2QR0A 1AY1H 2NXYD 5EU7E 2MCPL 4F2MA 1RUAL 5EH1A 2VDKH 4I2XA 3PQYA 3IU3B 3ZYZA 2YA1A 4FQJL 4OLXH 4U1JA 4DZ8B 3QPQD 3IDNA 4D9QE 4GS7C 2YHGA 1Q72L 1HXYB 2NY1D 3KS0J 5I18L 2A83A 3RNQB 3I6LD 2P42B 4NQSB 1F45A 3MV8E 4YFLI 3TJHC 4OD2A 3IFNL 4AL8L 4X6DE 4PRIE 5C6TH 4KHXH 4LLWB 2DQDL 1IAOA 3F8UB 5I8OL 4KXZH 4G5ZH 4HX1B 4W4NA 4Y2DA 4U4BA 5LG1A 1A3QA 3GSVA 1QEWA 3AMLA 4CN4A 3KWWA 4OUUB 3D0VB 1Q9KA 4Z0BH 3FONA 1I3VA 3KR3L 4CVZA 5A40E 2DWEB 2V2TB 4JM2F 4LMQE 3TM6A 4NNYA 5CINL 4LSQL 3K0WA 4ZXBC 4MJIA 3V9FA 5MEPB 2V7HB 3UC0H 3TBTB 4P2QA 4GAYB 1WT5C 2FWOA 1JI2A 1R3KA 2VE6B 1CK0L 2F53D 2AK4D 3CVIL 5F6HJ 2QHLA 4OD3H 4D94A 3HE6B 1B0GA 3MRIA 3QCVH 5DK2A 1R0AH 1UM4H 1HEZB 4DVRL 1EAJA 2X4PB 2A73B 3LKNB 3PV6B 4L4TB 3GB7B 4XAKD 2F54E 2CRYA 1D7FA 1NPUA 2DD8H 4IOIA 4NKMA 1NC2B 4KMLB 2VL5B 1LP9A 3BPCB 4HIEA 1YYLH 3WYRA 4HPYH 2Z8SA 1V8HA 4X99A 4N0CC 4HLZG 4Z5RA 2R2HB 5IV2B 1I85A 1Y6NR 2PUQT 2C3VB 4LSUH 1D5MA 3QA3B 1K85A 2XWJB 1AFVH 5F8QC 5ACMA 3TYGH 4ZFOA 1P6FA 5D93C 1KLGA 1TENA 5E5MA 4ZQKA 5DRNA 4C83A 4ZYKA 4RAHA 4NPYA 3FRPG 1RUML 3KLHC 4JAMA 5KSAD 1IAII 4RBPH 5HHOE 4WI2A 4LLYA 3UTTE 3EYUH 4GBXB 1N3NA 3OL2A 4NO2A 4NQEB 2PTUA 3DV4A 4PTUA 2NY7H 2XNAB 4RA3A 5HI5D 2ORBH 5AYUH 2BHUA 3MNVB 1T1ZB 3REWB 4KMTH 5DHVH 1TTUA 4B0MM 2I07B 4LAJH 3ZL4H 1TZHA 2J12B 1AE6L 4S1QH 2RBLA 3X17A 1NFKA 3WFCL 2VXVH 1B6UA 3BN3B 3CX5K 4MDJB 3CJJA 5KOMC 4WV1B 3INUL 2DTML 4Z76B 3MLRL 5B38G 1JNHA 3QXDB 4P9HH 5CGTA 3ZDXF 4PJFF 3MC0A 3Q5YA 4P4RA 1CTOA 1DN2A 2X7LA 3Q5TA 3U7WH 3SJVE 1J0ZA 3BKYL 3WLBB 3DPBA 3RWDB 2R0WH 3TVMD 1F42A 1KEGL 1JF6A 2IBZY 5I17A 2NPLX 1Q9WA 4Y8AA 3RTQC 1D6VH 4LPTA 5GS1B 4QRQA 1NGQL 1TPXB 3JTSA 4N8CH 4ODVH 1QRNE 2A6JA 5E2UH 1F6AB 4DGYL 5B8CA 2NW3A 4GUPA 4XHJC 3MXVH 43CAB 2IQAB 1MWAB 4WWKC 2P24A 1HDMB 3ECBA 1XCTA 1P4BL 3K7UA 4MX7A 3HI5H 4PJ8C 5F9JB 4J4PA 3ARFD 4NHCH 2VB5A 4HIHA 2A6IB 4XVJH 4XMLL 3P11L 1K5NA 4G8FB 3EJZD 4W81A 1C5DB 3QWOA 3W39B 5KG9A 4Q9BA 1MPAH 3S5LG 3NIFF 5E2VH 1LGVA 2HKHL 5C0BD 3S9DB 2PYEB 2OL3A 4E42A 4RFNB 5I1KL 4K7PH 3VGAC 1QRKA 1T0MB 5CZXC 5EA0L 4FQPA 3TCLA 3TPUB 3HC3L 1LO0L 4ZUUA 4AEEA 4HUVA 4ODTH 1IGJA 3S4SG 1I9IL 1CFQB 5HYJB 3CH8A 3D39B 2XTJB 2NY6D 4KTDL 1YEKH 4WTXA 2DM3A 1FZOB 1NCUA 4O58H 5HGBA 4DZBA 3MQIA 4FHBD 1U8KB 2ZCHL 3D1MC 1DSFH 5J6HB 1RZ8B 3SQBA 3ULVD 1P6AB 2SEBA 3U9PL 4Y5VA 3G5YA 4NQCA 3OKOA 4NQDB 3F7YA 1GZQB 3U79A 5ILTH 1SMAA 4PTTA 5EOQL 2Q7NA 4H8WL 4IRZL 3GO1L 4KDVA 4RWYH 1XIWD 3IDXL 5KSVB 5B22A 5T33L 2FJGA 3QQ9C 4KKAD 1WFOA 5ESVA 4LPYA 3QIWD 4Y19A 4PJ5D 3GMOA 3QUYD 3WS6A 4RGOH 2OSLB 3HC0B 2IBZX 3EAKA 4M3KB 1KNOB 4I18A 1XF3A 1IT9H 3T0VA 1MCBA 5EIQA 5FCUL 5B4MC 4X6EB 2KZ1B 3Q1SH 4P46D 1KBGH 1QBMH 1T7WA 1OAYH 3EFFA 1KCSH 5C0CB 1U41A 1URLA 4JB9L 4G43A 4UB0H 5D1QA 3TFKC 3B83A 3KXFB 3UBXB 3S3JA 3QQ3B 5BW7A 4QY8A 3OR6A 4JG1H 25C8L 2ICWI 3NACL 5EIVA 4HK3J 4WI4A 5I16A 1JTOA 1VKXB 3BPOC 3P73A 4K7PY 1S8DA 1T04B 3RNKA 3VRIA 5GRYA 1G6VK 2FHBA 3LEXB 3QNZB 2DM4A 1AXSA 3DYMA 3GRWL 4ERSH 4UAOC 3STLA 4DAGL 4ZDHA 1FZMB 5GRJL 4ELKB 3UCRA 2ADFL 3NIGF 1YQVH 2HRLA 3PNWA 4Z18A 4ONFH 7CGTA 2KBGA 1JPFB 4UOW0 3MRCA 2W0KA 3STZA 2P45B 4QTHB 4NWTL 1VGKA 1RU9H 2BSSB 3GGWB 5FYJL 5JQ6H 1JGLH 4BH8B 3CD4A 4TNVF 5IROC 3G9VA 1ZHKB 1HI6B 2NNAB 4N9OB 5EO1A 3RDTC 3RZCC 5BVJB 4IJ3B 4JY6B 3MLSL 1VB9A 3B5TA 2K7QA 2EDOA 2NY0C 4JEGB 4QNPF 4KQ3L 4XXCC 5F7LB 1S7WB 3D2UD 4ZUWA 5IEHB 5IW1B 2E8ZA 1LE5A 4EUPB 1KENL 1ZOXA 2NX5E 3IDGA 4TSAL 4YHPB 5E2TL 3F7VA 2R4SH 1P69B 1QQDA 4U1KB 2EDNA 2ICWA 4FN0A 3W0WE 4V1DB 5JW4Q 4FQXA 4H25A 1WC7B 4KJPD 2ENYA 5JNYA 1AGDB 3RJQB 3VFSB 1UB5A 2DQGL 2I9TA 1M7DB 3WDIA 1EX0A 4XPAL 4IHOB 4G6FB 1A1NA 1QSFE 3LMJH 3VXRE 1LE9B 43C9A 3IDIA 1GAFL 2Z31B 3RGVD 2XXCB 4R2GC 1ULVA 4QOKA 4PY8J 1RZJH 3QNYB 4PGJA 1H0DB 2UYLA 1A3RH 3QXAB 2HA1A 4RMUA 4A6YL 3K2UH 4L4VD 5GRWA 5H35B 4JPVL 3S96B 4M6NH 5D70H 4KK6C 3L3KB 2Y06H 3TJEH 1LK3H 2G75B 3V4VH 1TNMA 4ONOA 2APTA 5EULV 4X9IA 5FUOH 1FHGA 2PW1A 3ZKNC 4G8IB 4QYOB 4X83A 4JQVA 2C1PB 4K7PX 1TZGL 2G5RA 5FUCE 4EI5C 4NUGH 2BNQE 5AZ2H 3ARRA 4YQXL 1MCHA 4TUJA 5F93C 2Z8VC 1MI5E 1SYSA 3FT3A 3D9AL 1ONQB 4YDLC 3GSQA 5DHYA 5E5UB 3VMPA 1MREL 3T2OA 1QACA 1T3FB 3CMGA 3WDJA 2BSRB 4K23H 4PJGA 5GGUB 4U05A 5JO5B 3VFNA 1YJDL 3FTGA 4TNVK 1EFXB 3HG1A 3T0ED 3KYOA 3BZFA 4QF1A 1GGTA 1NDMA 3VRLF 4LCCC 5J12B 5FO9B 5I1HH 4HT1H 4WEBH 1YNKL 4RQQB 4PJXF 4E41A 3CC5B 3B9KC 1GC1L 1X5KA 4LCUB 3UZQA 1I1AB 4HEPG 5D71L 5ADOL 3GBLA 1F4YH 4P3DB 1MJ7H 4MWFA 3LS4L 1FLTX 4P3CH 2FJHB 5CSZB 1DBBH 1KEMH 3HUJF 3WD5L 4AZ8A 4I2XE 4LPXA 3PQYE 4AIOA 4RIRB 1A5FL 3JVGA 3DXAD 2QHRH 1WK0A 2CXGA 3MYJB 3IXAB 5J3HC 4L3CB 1C1EL 4UNTA 3ALPA 5F1IB 4DKEL 1NUNB 3MREB 3V5KB 4JZNA 4HD9A 1S5IH 1CG9B 4MQ7B 1CLOL 3OGCB 4Y1AA 2YPLD 5AUMB 1NL0H 2IAMA 4BQCA 4EDWL 2BNRD 4Y2DC 1QFWI 4M00A 2KH2B 3EYQC 1ZT4B 4J23A 1KTDB 1A64A 3MLWL 3WO4C 3P30L 1HCFX 1EA9C 4JRYE 4GMSL 1CCZA 1A21A 3K4ZA 2E3VA 4XVUC 4U0RC 4WRLA 5IEKB 2B1HH 4J3WA 3MBEA 1E4KA 1MAML 4R0LC 4MXVF 5ETUB 4MJIE 4GS7B 4RFOL 2VDNH 3V0WL 4JO2L 4P2QE 1XAUA 4JQIL 1BX2A 3BP5B 1RUPL 3MV8B 4M1DH 4JZOA 1DQDL 1M05B 3H9SA 2FH8A 1A2YB 2F15A 3NA4A 4NN7B 1RJZB 5C0DA 2E27H 3EDEA 4OZ4B 2BRRL 3QNXB 4ISVA 2APBA 3VW3L 5C07A 4ZFZA 2X10A 3FAWA 1LP9E 3E2HC 3QO1B 1TJGL 1K4CB 3D25B 1I85C 4MA8H 3MROB 2KZWA 3FQUA 4XCNA 2B39A 3VMOA 1LDPH 3PHOB 3CFJB 4XAWH 1OP3H 3HB3C 4YDIH 2EDFA 3QWRD 2BOCB 2MJWA 4LVHB 5ITFB 3PGCA 5GGSA 1OWWA 5F3HA 2BHYA 5E6IA 2HN7A 2VMFA 1BD2D 1T1YB 5DJZB 4MJ6B 4JFDA 3DROA 1YEGL 2F54B 3MJ9L 3FN0H 5IP4A 4AEIL 1CR9L 2W65B 4ZTOH 3P9WB 4N0RA 3VXTA 3RU8H 2BSTA 4MAYA 4FTVA 5I73C 5IMLA 4LCWA 4PJ9A 5D7LB 4GRWH 3P4LA 3TLRA 4TVPH 3B9DA 5CLTA 4HGWB 1BAFH 1N5YH 4S1SL 1DN0A 1B0RA 1V5JA 4LBEA 2Y5TB 5D93B 3TO2B 2P7TA 1P7QD 5DI8A 2ENSA 4MNHB 3N06B 4NFDA 4JM2A 4C57C 5GZOC 1E4XH 1TETL 5CMAB 1YMHB 1B6DA 1FO0H 4FQQA 3G5XB 3UTTB 5TQ2L 1S9WB 3I6KB 4HWBA 5T5FH 4LEOB 1T5WB 3H3PL 4YHZH 2RB8A 1AP2B 4OZGF 2NY3B 3G6DL 2AJ3B 3CFEA 5B8CC 4UNVA 1A14H 2A9MH 3AS1A 1VPOH 4ONGH 5EO9A 3LZFH 3BRDA 4GW1A 3LS5H 4IRJC 1D5XB 3RWFB 4P2RD 5FYKH 1MH5A 3AS2A 1U8JB 3O2VL 4OGYL 4LOUC 4J4PC 3NABL 1ORSA 2VLKD 3S37H 4F7EA 4HC1A 4GT7A 4LSVL 3X12B 3BHBA 2VQ1B 5JDJA 1LNUA 3U0TB 4RMVA 4H1LH 1RSFA 5DMGD 3RTQB 4GXUN 3LAFA 1EO8H 2ZPKL 1QRNB 4G6KL 5IFHL 4PJCF 3FOLB 3MRQB 3BRGC 3BFOA 5SV3A 1H15A 4M4PA 4U6HB 5BMFL 5CCKL 4MA3A 4Z7UB 1XH3B 5D96C 3DX7B 1DANU 4EDXA 4NJAL 1Z3GL 1UH4A 3VXOA 2VERN 4HS8L 5GGVY 1PSKL 4P57B 3C5JA 3LD8C 4PUBL 5T1KA 5KVGL 3MV7D 3DRTB 3E8UH 2DQTL 1G9NH 1EZVY 3BIBX 4MXQD 3VFOA 4EXPX 2KKQA 4D9LL 4PJFA 1HE7A 1RURH 2B2XH 4P5TA 3IJYA 3ARDB 1SBBA 4Y5VC 5F9WB 1QLFA 2AV1A 1UVQB 2D3VA 3OKLA 4NQCE 4M5YL 4L1DA 4UT9L 4AEHL 2E6PA 4PJDF 5BO1L 3BP4A 3EO9L 1OQOA 3R8BB 2CGRL 1HILB 1JBJA 4JRXD 4O2EB 1JK8A 5DMIH 3W2DH 1VFBA 4WO4B 2X1XR 1XF5B 3LEYL 3BZDA 4Y19E 1SJHB 5HD8D 3RP1A 1WF5A 2BX5A 3O8XD 1UXSA 5KSUA 4I18C 4TTDD 5CBEA 4ORZC 1JZ2A 4NKDB 4PGCA 4JLRB 4XNXH 3PUCA 4YUEL 4R4BA 4GQ9H 4MSWA 2Y7QB 5GGRY 1XGYH 2NY5H 1A7NH 4FG6C 4IBLT 1Z2KA 3LPWA 1KN2H 3JWDL 1OP5K 1YPZF 5D1QC 1CQKA 1YEFH 3BW9B 3N50A 5BW7C 3OAYK 5H37H 5FF6A 3L5WA 2NZ9C 2IADA 1DL7L 4LKCA 4MCYA 2FIRT 2DQHL 1LD9B 3H42H 3MRGB 5E00A 1HNFA 2CKBB 2IF7A 2ADJA 7FABL 1AKJD 3SGDI 1A8JH 1CL7H 3B2UD 3ARXA 3A67H 5BV7B 4RCAA 4JJ5B 3CVHB 3MLXH 3VGGA 1G0DA 1LO2H 3QEQA 1BFVL 4Z7NF 4KK9D 1A6AB 4OCSH 3LY6A 4L8DA 3WN5A 1INDH 3ZT6A 5FB8A 2P44B 5DC0A 1XGPB 1L7IL 5IB5B 3WFHB 1JHLH 3S35L 2OLDA 5FO7B 3TIEA 1WZ1L 1UCBH 2PCPB 3GJFH 4PRPA 1G9ML 5SWSA 2IG2H 5L6YL 3M8OH 4OCYL 2X1QA 4UV4L 5TE7L 1EZVX 3WIHH 4C4KO 1H3WM 5KN5B 3EJYD 2EO9A 4UAOB 3NFPA 4WUUD 5HHVH 5D7IF 3E6HB 3FN9A 3BP6A 2FNBA 4GMTL 5DJ8A 3D69B 4HUWB 2B5IC 4JFEA 4MA7H 1AQDA 5I8CA 2ZG3A 2VH5L 4XNYH 4O2CA 3VWJD 5DRWA 4S0SD 1PG7W 2EDYA 4HIJA 1KJVA 2OR9L 1OT1A 4J12A 2HWZL 4Z7VF 5JZ7C 5D7KD 3RDTB 1PEWA 1PZ5A 2I60L 4G6AC 3GMMA 5JHDD 2H6PA 4I77L 3BKCH 1OSZB 15C8H 1NBZB 4QOKE 5E8DH 2EYTB 4RNRB 2EZ0D 4XC1H 3WKMH 2A1WH 5EO0B 2FBOJ 1YEDA 5B3NA 4CJ1A 4X8JA 1DVFA 2XN9D 2R23B 4LSTL 5LBSH 2AERT 3MBXH 5BS0A 3CAFA 3LN5A 3LQAH 5D1XD 3S4SB 1BPVA 1ED3B 1IGIH 3GKWH 5AD0A 1T7YA 5C71A 4ORGB 4JQVC 2IH1B 2CO7B 3NAAH 1A7PL 2C1OB 2BVPB 2VZSA 3RIAF 1JHTB 3SO5A 3RX8A 4JG0L 1QSFB 3EYFA 3HRPA 3VXRB 2OJZH 4BFGA 3C60B 3BJLA 1A4KB 1UYWH 2EDWA 4UT6L 4NUJA 3SE9L 3BDXA 4J1UA 4J3TA 3ZO0A 5DHXB 5IOPA 5EOCJ 4YHMH 3CFKB 3DETD 4PJGE 4DGVL 4GW5B 5CP3H 5I30H 3WLWC 1CFTA 4FXGA 3BUYB 4OQ1A 3HG1E 3OKMB 2M1KA 2GHWB 3P0YL 5F7HA 2B4CC 2ZUWA 3BDYH 3DIFA 4D0CA 4TRPL 3T04D 2VN4A 5IIEB 4HFWB 3MA9L 1BJ1H 1Q0XH 3TNNB 5KAQG 1J8HA 1NCWL 4E41E 2OQJB 5KANI 2R69H 5GGQL 4HCRH 1DBJL 2BNQB 3GSWB 3RVWC 3KYMA 4WI9A 4K3JL 4JHWL 4LNRB 5CIPH 1KJ2L 5D1ZD 4YDLB 4NNXA 5C09D 3ULUH 4HKJB 3ULVL 5A16B 8FABA 3JVGC 3V6OA 4GRLD 1GPOH 4OGAD 2VDLH 4OIIL 2ICEA 2CDGA 2VZ1A 4PJBB 5JPNB 4HKZB 1E4WL 3MZGB 2AEWA 3K4AA 3IAGC 2Q7YA 4OKDA 3K81A 3JWOC 4U1LB 3WCYA 4LCCB 5GRZA 1X6LA 1Q38A 3OF6D 4Y1AE 5JLZA 3CSBA 2IAMC 3RKDC 3CZFB 2W91A 2H8PB 3OJDA 5I76A 5EZJB 4RAUA 3UJTL 2N1KA 1UA6H 3B9KB 1CBVL 2QSCH 1F02I 3VI4F 1M71A 1Z9LA 2QR0B 5A2FA 1I9JL 2AJYH 3WV0A 1WV7T 4NBXB 4TUOB 4LSPL 3O4LD 4I2XB 3F62A 3PQYB 1U8LA 1OP9A 3MBEC 1FFPB 5GGTL 4C56A 2FATL 5F1SA 3C9NA 1CU4H 4RA0C 3D87B 4U1JB 3BWUC 3IDNB 3EDFA 3RIAK 1OW0A 2A83B 4BQBA 5EU6D 1IE5A 2CLZA 3JWNC 3PWPD 4J3XA 2GTZA 1S9VA 1V05A 4NC1C 2GAZA 2B1AH 4NC1E 3DX9A 4MDIA 4JQXA 4YHIA 3H9SE 3FFDB 3S88H 4Q2ZA 2HMID 4UIKL 1IAOB 3L1OH 2BNUB 5C70A 4Y2DB 4MS8D 3GRWA 2XKNB 2NR6C 2HVKB 4DW2H 1G7LB 1QEWB 5C07E 1H3TA 3B3IA 4JRYB 1SJVA 3LH2L 3PDDA 4DGIL 1SJEA 3KWWB 2AXFA 5ADPL 1Q9KB 1PD6A 4Y89A 4NO0D 2UWEB 4U6YA 3HA0A 3CFBB 2G5BB 4TVPD 4CVZB 1NCNA 3KAAA 3TA3D 3CUPA 4OLZH 3HUJA 4P2OD 3WEXA 3HNVL 1DJSA 1A4JA 1ZHBA 1VHPA 4IIQA 1CICD 1CGVA 5DMJB 1FAIH 3IFLH 4ZTPL 5E6IC 5DJXB 2W0LA 5GZND 3QHZL 5DVLA 4TSBL 4EIZC 3PDGA 2NYYD 5DK2B 3SDAD 4HJ0D 1C12A 3IDYB 5BQ7A 4JFDE 2GY5A 4CUCA 5J13C 4IOIB 4JO4H 3MV01 2AK1L 3WXVH 3UTSB 4HIEB 5ESAA 4MAYC 2AW2A 4X99B 2AQ2A 1MRFL 5ALBL 4FTVE 4LCWE 4FMFA 1MHHA 4WY7L 3MUGA 1I7TA 2BY3A 1K6QH 2DLHA 3C8HA 1EBAA 1TCRB 1UC6A 4ZFOB 5FKAB 2AEPH 3BEVB 3H9YA 1DQLH 1BM3L 4ZQKB 5DRNB 5E5MB 4ZYKB 1QO3B 4NPYB 4K2UL 3LCYA 1W0YT 5IBTL 4W70A 3KS0H 2JIXB 3STBA 5FYKU 3BH9A 1FH5L 3RVXD 5LWYL 1N3NB 4NO2B 5FA3B 3DV4B 4P9ML 4PTUB 4NRZB 2PXYA 4RGND 4HZLB 4WFFE 1W2KT 2FX9L 5IVZA 4FXKB 1JPTL 1LO3L 1TZHB 4A6YA 1FNEA 4G8GA 3WXWL 1WIOA 3VFVA 3HE7A 3DECA 4Q6IA 1F58L 4MZ3A 1Q1JL 1JNHB 5GJTH 3MFFA 4BQ8A 1YNTB 3R8QA 1CDCA 4JFHE 3MOAL 4WI5A 3GSNH 2YPVL 3GMPA 3KPSB 2ID5A 4P4RB 4Z7QF 3VFMB 1KIQB 2BVQA 3QXVA 1IEBA 2EC9T 1AY1L 1UQSA 1YC8A 3LKRA 4U1NA 3LB6C 4NP4H 5J1SC 2VDKL 4JFPB 5I17B 4WWID 1Q9WB 1HXMB 2Y4SA 4QRQB 3MODH 3FQTA 3JTSB 2WQ8A 4OLXL 5DQ9A 2MHAB 3Q5OA 2A6JB 5IVOA 5B8CB 2NW3B 4GUPB 3AFLA 2EEAA 1KCRH 2NY2C 4RISH 2P24B 3PWJA 3VFWA 1LEGA 4MX7B 4QWWD 2F74A 5C6TL 3FOMA 3FQNA 4KHXL 1S7UA 4NRYB 4HIHB 4KROD 4G5ZL 2K3TA 2DJ4A 4JDZA 3G9AB 3QWOB 4YH6A 4JHZA 2BCKA 2XYCA 2ZJSH 3ZDXE 4LVEA 1JFQH 4P5TC 4PJFE 3GK8H 1U8PA 5IR1A 4ZOCA 4JFXA 4Z0BL 3AY4A 1V3MA 4UBDD 1DBKL 2VDRH 1FGNH 5TFSH 2OL3B 3RVUC 3ARED 3DVFA 1ZHNB 3UC0L 3TCLB 5DJDB 2D7PA 4ZUUB 4IOFC 4OZGA 2F5BH 1MY5A 2BHZA 2Z4QA 1IGJB 3P4NA 4OD3L 2E8YA 3QCVL 1R0AL 3LOWA 4D0DA 1UM4L 2MWCA 4HPOH 4WNQA 4E5XA 5HGBB 4DZBB 2DD8L 4HGKC 4YBHA 3UAJC 2DLGA 4J2XA 2C4FU 1YYLL 1FRGH 4HPYL 1QSEA 1I7ZA 3QIBA 5JW4R 5I9QC 4NQCB 3OKOB 4LSUL 5HPOA 3F7YB 3I85A 1AFVL 2CUIA 3BGMB 4PTTB 1HH9A 4YBLC 3NOIA 4WHTA 4DKFL 4PGEA 2PO6D 3MX0A 3MRDB 1SYVA 2ZNXA 2FJGB 5A3ID 4XTRD 2UUDH 4XNMA 4PJCA 5ESVB 5KW9H 4LQFH 1GOGA 4Y19B 2FEDD 3K8KA 4D3CH 3EYUL 2Y5EA 3MUY1 2NY7L 1JMZA 1NBYA 2ORBL 2DQUH 5AYUL 4WTWA 4I18B 2IANB 1XF3B 4KMTL 3AGVA 1GOFA 3ZL4L 2CLRB 3SKMA 1KXTB 2M26A 4S1QL 3QEQE 4XP6H 3FZUC 2CH8A 2VXVL 3WN5C 5E4EC 2WUBH 3CDGA 4Q58C 1U8OA 4NBZB 3OAUH 3K4DA 1HIMH 4M9PA 3O11A 4G43B 3CX2A 5EU3B 3P77A 3O0RH 4P9HL 4QY8B 3OR6B 3VXUB 1J18A 1KT2A 4O4YH 4PRPE 5SWSE 3L6FB 1S7VB 1OD9A 2IC2A 3U7WL 5J89A 3P73B 1S8DB 4PJDA 3OPZH 1KIRA 1SEQH 4KGLA 4U33A 2R0WL 4PFEA 2VLJD 1E4JA 3IGAA 1AXSB 3NZ8A 3STLB 1D6VL 5C0FA 4N8CL 1BFOA 3MJ9A 4ODVL 4RGMC 1UM6H 5E2UL 3PNWB 2HTKD 4Q9QH 1FL6A 3ARYA 3MRCB 2EIZA 3MXVL 4QTIH 2W60B 3STZB 3WIIH 3P3YA 2BXYA 5D6DC 3PL6D 4I0PD 5JA8B 4B7LA 1ITBB 4Y4HD 5E9DA 3HI5L 4CAGA 2HJKA 4NHCL 2V5RA 2AAVA 4XVJL 4XVTH 5KANG 2Q86A 4G9FD 3BISA 4XZUA 1MPAL 4Z0XA 2H2PC 3R1GH 4ZUWB 3TWCH 5E2VL 1LE5B 5TE6H 3TN0A 3GEWB 2ZOLA 4R6UA 1DVFC 2XWTA 2H32H 4JFYB 1F6FB 4K7PL 4NQTA 2ZSVA 3F7VB 5BS0E 4HIXH 1QQDB 1CDUA 3R0MA 1S5HB 3WUZA 4ODTL 4FQXB 2GCYA 4Q6YA 4H25B 3GIZH 2GSIA 4WHYG 3H9HB 4UNUA 2H2SD 5JNYB 4LEXH 5FKPA 1YEKL 2BRQA 1J7VR 1UB5B 3ET9F 2ATPA 4MA1C 4O58L 4LPCA 2C4XA 4HSQA 1PEZA 4XPBH 3IDIB 1DSFL 4ZS6C 3QIUD 1N7ML 1ZA6A 1DQTA 3ULUD 1CGTA 4XBGA 1EUTA 3QUXD 3QAZC 2UYLB 4KRLB 3MV9B 3KPQA 5ILTL 5L2JA 35C8H 2WINA 1FG9C 2CJUH 2DM7A 1H3UA 4I3RH 4RWYL 5D7IA 1JPGA 3CNKA 3FAXA 4FP8H 1RY7B 3OWEA 5T1MA 1J8HE 1IAMA 1ZT1A 3GDBA 2Z8WC 3NH7H 2DYPA 3T65B 3HAEB 2Y36H 4K8RH 4RGOL 4YC2B 1G7PA 4KUCD 4P5MA 4CW1A 1IT9L 3FT3B 4R96B 3GSQB 5DHYB 4YO0A 4X9GA 3BVNA 2AEQH 2DQFA 5F7KC 3Q1SL 4Z7VA 1KBGL 1QBML 1OAYL 1KCSL 3V6OC 4PJGB 1A7RH 3V6OE 1CF8H 3L3JB 4UB0L 1CQYA 1FSKB 3OGOE 5E8EA 3RBSA 3DUSA 3FTGB 4CJ0A 1WFNA 2VKWA 3KYOB 4H8WC 4QF1B 4XPGH 1NDMB 4JG1L 2Q6WA 1FQ9C 1EXUB 4HIIA 2DKMA 2XKSA 3KNBA 4E41B 2YSSA 4P49A 3SGEH 3B6SA 5DD3H 5JIIA 2B4CH 4HAFA 2DL9A 5C08B 1L6XA 1ERNA 4TYUA 1DQQA 1YQVL 1KPUB 1XGQB 3IXTA 4OFPA 1MLCA 2WBJB 4C56E 1RU9L 5C3LD 4Y4KD 4PG9A 4YJZL 3OKDA 5IMKA 3ARBD 5JQ6L 1JGLL 4YZFF 1OW0C 1ACZA 4CVXA 2FHCA 3H3BC 2BDNH 3KPNA 4ALAH 3BD5A 1KG0A 1WCQA 4F3FB 4QHNA 3D3VB 1CLCA 4JQXC 2IAMB 4XCYB 2X44D 3KYKH 3DV6B 5JXAH 2Y07H 3CPLA 5E6ZA 2EXYC 4X9FA 5JW3H 1AGBA 3VRLE 4WHCA 1P4IH 3OG6B 3KPRA 3EYOA 3IDJA 4EUPH 4N9GA 2HFGH 2GUOB 2R4SL 1TQCC 2IQ9H 4WW2B 1LEKA 2FR4B 4RBPK 4MNQA 4IMLB 4HS3A 3QG6B 1T1XA 1IL1A 1YEJH 3MBEB 1I75A 1N6VA 3HUJE 2DKUA 2DQIL 4IIQC 5HY9A 4M03A 5T3XD 5ID1A 3QDMA 5JOEA 3BQUD 5FYJE 4OCXH 32C2B 1BX2B 3LMJL 4JZOB 3W9EB 3HZKB 1OCWL 1E28A 1G7MA 1MNUH 3JV4A 1F90H 1SVZA 1RZJL 2FIKA 4KY1H 4ISVB 1A3RL 3U2SA 3EHBD 1NGZA 1RUKH 3K2UL 5C07B 2LE9A 1UKSA 3GMRA 4ZO7A 3MGAA 5C0AA 2CMRH 4M6NL 1NFDF 4ETQA 3TJEL 2Y06L 4EZMA 1LK3L 3FQUB 4OZHA 4XCNB 3V4VL 5FUOL 2KUTA 1CD1B 4K07A 4OLWH 3DGCR 4CVUA 2N7BA 1K4DA 4XWOC 5I6XB 3PGCB 5TQ0H 5GGSB 4B41A 4NUGL 3WS3A 1IM9D 5F3HB 2C3WA 4XPFH 5AZ2L 3VD5A 5E6IB 3RVTC 2HN7B 2RCSH 3VXSD 1GGCH 1OSPH 2ZOKA 3ZDZE 5BJTA 4MXVE 4L5FH 4LPWA 5GS0H 4FOMA 4HKXB 4JFDB 2PXYC 3DROB 2MQCA 4I3GA 2X2YA 3O2WH 4FZEH 4K23L 1UADC 5J13B 3VXTB 4FMKA 2JJTA 2BSTB 3K1KC 3IS0X 4G8GE 4MAYB 5CD3B 5IMLB 4LCWB 4PJ9B 5EG6C 3HE7C 4Q6IC 1SY6H 2A77H 3L3GB 4KGJA 5I1HL 4OQTH 4HT1L 4WEBL 5T3ZH 3I3DA 3LN4A 1DN0B 4RMSA 1V3JA 1B0RB 2O5ZH 4PJIA 2P7TB 3ARFA 4F7MA 3TZVB 4K71B 5ID0B 2P49B 4PP2A 3I50H 4LASH 1OARH 4JM2B 3MLZH 1KPVA 2DQJH 1UM5H 1F4YL 1MJ7L 4TNWK 5EIIA 4M7JH 4EN3B 4P3CL 1DBBL 2IMNA 4G80B 1KEML 2Y1VA 2NLJA 1I8IB 4PY7B 5ANMA 4PV9B 3O3EA 2VYRE 4JREC 4M1GH 5ITBH 5EUOF 2QHRL 3SKUD 4I4WA 1B90A 1R3LB 3CFEB 3FQWA 1YJDC 2V2WA 5IB2A 2H3NA 5EO9B 1YQ2A 1S5IL 1XF1A 2X70A 4PJEF 1MH5B 3SO3B 1NL0L 1ORSB 3I3EA 5HHXH 1YN6B 4F7EB 3HE6D 4QHMA 1GC1C 3ARZA 2YD3A 2WANA 3T0XA 3BHBB 1NCCH 4LFHD 4L4TD 1LQSR 1LNUB 2VAJA 1NC2D 1KJ2A 3BESR 3AY4C 2B1HL 1FAKT 4G7VH 3PGFH 3ALWA 3U9UA 2D7MA 3HZYA 3HKFA 2CLVB 5DRXB 1H15B 2VDNL 3S7GA 4MA3B 4NZJA 4EDXB 4OZGE 1P5UA 4M1DL 5D4QA 1IKFH 1NUGA 1U92B 3ARUA 2R1XA 2JB5H 3VXOB 5DJAA 1WISA 3C5JB 3QIWA 2E27L 3QUYA 5LJYH 5T1KB 5D72H 4GBXD 4NQED 1XEDA 5FM5O 3VFOB 5FA4A 3QPXH 5JXED 4NKQB 4PJFB 3IJYB 1FGVH 1QSEE 1UGNA 2R1WA 3VDAA 4LRIA 3QIBC 4MA8L 2NZIA 4P46A 4JR9H 3QSKB 1LDPL 2DS4A 1AR2A 4XAWL 5GGTA 4YDIL 2FGWH 3BP4B 3IDMA 4KKBC 2X6MA 3LDBC 2Q8AH 1JK8B 4PJCE 1IARB 4ODUA 4YIQA 4X6CA 1DR9A 3E0GA 4PB9L 2CD0A 2UZXB 4JPKH 1UXSB 3FN0L 5KSUB 3MJ8A 3VFGH 4TPRH 4ZTOL 1UB6A 4I8DA 2DB8A 5CJXA 5CGYD 4PGCB 3RU8L 4YAQB 4R4BB 5T5NG 2DL2A 4TVPL 1QKZH 1JGEA 4LHUA 1AC0A 1BAFL 4NDMB 1N5YL 5ESQA 5I15H 4FS0A 3JV5A 4R8WH 5FF6B 4UUJA 2AS5M 2IADB 4OJFL 2FLBT 4LKCB 1E4XL 3HZMA 4MCYB 1OM3H 4PJDE 1YECH 5E00B 5HI4D 2JJSA 5T5FL 4GLRH 3D2UA 3NPSC 4KDTA 4L4JA 3RUGF 4PP1D 2JF1A 4R26H 5T1DH 1A14L 2A9ML 2PYED 2R9HC 2VC2H 1VPOL 2DLFH 3QEQB 4ONGL 5B3JF 5KJRH 3LZFL 1N64H 4NC0B 4DUXA 3LS5L 5IM7A 1NKOA 3CVIH 4L8DB 1XGUA 3WN5B 5E4EB 5FB8B 4XCEA 5FYKL 5SWQA 1ACYH 5E9DE 4YGAB 1OGAA 4ZOEA 3S37L 3TIEB 2DBJA 5HYJD 3D39D 4PRPB 5IBLC 2XTJD 5SWSB 4DEPB 1HYSD 3HCVA 4WFED 3FFCB 1OQXA 1P4LA 4O02L 3SDDB 4PJAA 5MEOA 5D7JA 2IBGA 5E1AA 3CSPA 3DVGA 4QXTA 4YPJA 4EXKA 3NFPB 3TN0C 3WIFA 2ZUYA 4MD5A 4KXZI 3BP6B 1EO8L 4GKNB 1QFUH 3MPCA 4NQDD 1FNFA 2VZOA 3D6GA 4L4VA 5I8CB 1AQDB 3ARGA 3DLQR 4WHDA 1GL4B 5HTSA 2EE2A 1INEH 4O2CB 3MRLB 2J88H 3IS1X 5FHBH 3T4YA 5DMKA 4WI8A 4Z7NE 4HIJB 1KJVB 3SY0A 3LRHA 2B20A 3ABZA 4X6DF 3QDJD 3E8UL 3NA9H 3V6BR 1PZ5B 1G9NL 1ZANH 2H9GA 3GMMB 1RHFA 5DQDL 2X9XA 1RURL 2B2XL 1MAJA 1BZQK 1R5VA 1RZIA 1YEDB 4X8JB 1DVFB 5C0CD 2X41A 5BS0B 3EZ8A 3QH3A 3LN5B 1S9XA 4UQ2A 5F89A 3T0EA 3PP4H 3CLEH 4JZJA 4UIMA 3RWIB 5GS2H 1F11A 3KXFD 1QBAA 5D7IE 5DMIL 3W2DL 5DEGA 2XZZA 1ORQB 1FL5B 4XNQA 1FC2D 2DI7A 5F9AC 1JPST 5F96H 1WBXA 5F7MC 4KI5D 3ORJA 3DHMA 4XX1E 2HH0H 3HR6A 3EYFB 5GSRA 3BPLC 1X4YA 1TLKA 3DNKA 2NXYC 1R5IA 3MUHL 4XNXL 5F7UA 4GQ9L 1QOKA 1MVUA 1XGYL 4Z7VE 1HHKB 1A7NL 2NY5L 3CCHA 3CXHK 4JHBA 1KN2L 4MCZA 5LGKA 2BOBA 2XXMB 3QAZB 3V4PH 1QP1A 2VQUA 1YEFL 4R4FH 3ZTNH 3QPQC 5HHPA 3N0PB 2NY1C 3DIFB 3U36B 1UT9A 4D0CB 4AMKH 4OFYA 1YUHA 3I6LE 5HSFA 4HGMA 3H42L 3RWCA 2QQNH 2J5LC 4ODXA 5EZLA 1EBPA 2OM5A 4M93C 4TTGA 3RI5F 2CKBH 1CL7L 4HJJH 3HN3A 4S1DC 4DVBA 3A67L 2P4AB 2W9EH 4MNGA 1LILA 3VJ6A 3MLXL 4NNXB 1NGWA 1LO2L 4MB5A 5BV7H 2ZSWA 4OCSL 1INDL 1J1OH 3JWDC 4KTDH 5I1LA 1SHMA 3TT1H 2CDGB 4N0FB 1JHLL 4V1DD 3DOSA 5DSCA 1UCBL 2Q7YB 3UROR 2HKFH 2IG2L 5F9OH 1DLHB 1V7NL 5JLZB 3M8OL 1WJ3A 4LLMA 4P23B 4G6FD 3DO3A 4B7IA 4NJ9H 5I76B 1OP3K 3WE6A 4HH8A 4WDIA 2BFVH 3VXQA 3OAZH 3FO0H 2Z31D 1DCLA 1M71B 5HHVL 3EIFA 4LF3B 3PWLA 2QJDA 3KPRE 4MVBC 2HFEA 5DHVA 3MLYH 4DKDC 1IEAA 5D7SH 3RVVD 2GJ6A 3X13A 4MA7L 4MNQE 1U8LB 4XNYL 1MCCA 5DD6A 2HLFD 4R7DA 1BECA 1J1PH 5FOBA 2UY7A 5EOCH 1Q0YH 3OXRA 1Y18A 3QDME 5CSGA 2GTZB 1S9VB 5AG8A 1G6RH 1G9MC 1S7RA 4WFGE 3AXLA 3KJ4B 1BD2A 2J2ZA 5FFLA 4XVSH 3RWGA 5JUEH 2B7DT 2I27N 2UVEA 2C7UA 3BKCL 15C8L 5GS0D 1KUMA 5E8DL 5HI5C 4XC1L 5LGJA 3WKML 2A1WL 2E9JA 2P8MA 2JCCA 3B3IB 5LBSL 4YDKL 3MBXL 1SJEB 4S1RH 1A47A 1GCFA 2AXFB 1GH7A 3LQAL 1H3VA 5C0AE 4ZUSA 2D03H 3VI4E 1EFXD 4U6YB 1IGIL 2DLIA 2VL4A 4OZHE 2C3XA 3TEUA 3GKWL 3CUPB 4G9DA 3HUJB 2HFFA 3NCJH 4IIQB 3VMNA 4DAGH 5I2IA 3RI5K 3NAAL 2HT4D 1YY8A 2N56A 4HHAA 1P7QA 2OJZL 1YN7B 1J0KA 1L9NA 1I1AD 2VLRA 1UYWL 5IHLB 1D5IH 2VZ3A 1HZHH 3IKKA 1AR1D 3TVMC 1KB9K 1KACB 4KZDH 1C12B 4NT6A 3WHXA 4OF3A 5BQ7B 4YHML 4NO5A 1YMMA 5I30L 2JJTC 2N7AA 1DBAH 4FFZH 5ESAB 4U1HA 3BDYL 3VGHA 1MHHB 4YDJA 3MUGB 1I7TB 5GRVL 2YKLH 1WQVT 1Q0XL 3VFPA 2GW5A 4YGVB 4XP9H 2R69L 1J5OL 2J8UF 3ARFC 4MAUH 3MRKB 4HCRL 2VLKA 4LHUG 4PJIE 4PV8A 2OX5A 2ATKA 4XB8A 4OLEA 5KTEH 5FGSA 3BAEH 4N8VA 1J87A 3ULUL 3BH9B 1GGYA 3OJVC 4G3YH 3QUZB 5ANME 1GPOL 1MCRA 5IVZB 1KGCE 4PRHA 2VDLL 4G8GB 5AEAA 5CUSH 1P84K 4HV8A 5ICYB 3KG5A 1ZVSA 3VFVB 4D9QD 3RPIB 2OCFD 1GAFH 2GFBB 5DYOA 2FO4A 3E3QC 5D2NB 3E3QE 3MFFB 4X5XA 3TJHD 1NFDA 1UA6L 2NY6C 2QSCL 4NM4H 5LVEA 2BVQB 1IEBB 5IMOB 1BREA 1UQSB 4GAJH 3LKRB 4U1NB 5E99H 2AJYL 2OXHA 1NGYB 3QRGH 3ULVC 4QEGA 2ILLA 3ULVE 3FQTB 3LPFA 1CU4L 4WU5B 5F97E 2CXKA 2CDEA 5A1AA 4ODBD 1ES0A 1ZGLP 5HVFB 4XRCB 1GSMA 1NFIA 2B1AL 4XP1L 3PWJB 4KKAC 1F3JB 3FOMB 3FQNB 2F8XC 5DFWH 1S7UB 3RA7H 4BKLA 3S88L 2Z91A 3QIWC 1BBJA 3DVNA 3QUYC 5C92A 1EEYA 1JNLH 2A0LC 2P47B 1BWMA 3NCYS 3L1OL 2K1MA 1CE1H 5HGDA 3O8XA 4XNUH 1OAZH 4JDZB 4DW2L 2F54D 5KOVC 1O7VA 1FYTD 3P2TA 4K7FA 1U8PB 4LRIC 4P46C 1IAIM 5I75C 3NFSH 3ZE1F 5D7LD 4OLZL 1N0XH 5IJKA 4AK1A 5ADOH 4X4ZA 1PX4A 3MJ6A 1FAIL 3IFLL 3U46A 5EUOA 4OZGB 4F37F 5FO8A 2XZCH 1QHOA 3P4NB 3EGSA 4X6CE 4Z8FH 3KLHD 4E5XB 4PJEA 4RFEA 3UTTD 1HYRC 2A6DA 3CK0H 1NC4A 3WXVL 4DKEH 3O2DH 3OXSA 1R3IH 5EZIH 4CNIA 2NY3D 3SE3A 1QSEB 1L0YA 1K6QL 4Z9KB 3JSSA 3SQOH 2X4UB 3Q2CA 3SDXA 2G60H 1HH9B 2ARJQ 1WBYB 4DCQB 2HJLA 3LKOA 1DQLL 1TXKA 4WHTB 4PGEB 5F7DA 3ULUF 3LDBB 3DX8B 1VESA 4XNMB 4PJCB 5IKCB 2WNGA 3WJLA 1NAKH 1QD0A 2GEEA 2JJSC 4H5SB 1S7QA 3WNOA 4KDTC 1NBYB 3QQ4B 3DTXA 4WUUA 3DHJA 4Y16A 3RTQD 1BOYA 4Q9RH 3SKMB 1QRND 1UG9A 4HJGA 5I66A 4Y4FA 4WJ5A 1Z5LA 4APQA 3QXWA 3CDGB 4BZ2H 9CGTA 5ICXB 3JV0A 3O11B 3VWJA 3ZZ1A 1CE6A 4U3HA 3P77B 5ABDE 5GJTL 5MI0C 1OGAE 2OXGA 3FQRA 2G2RA 3IJHA 3D0LB 3GSNL 4R9HA 5TDNA 3TYFA 5E08H 4IS6A 1CXIA 5J0BA 1BLNA 2EICA 5DRZA 1FG2A 4PJDB 1KIRB 4NP4L 2COQA 4JGMA 5D7JC 4PJAE 3VG0H 1IKNA 4GAGH 3IGAB 3NZ8B 5C0FB 1NGXB 5K9KA 1IMHC 3MODL 1M7IB 2EXWD 3ARDD 5JR1H 2XN9A 2MFNA 3K74B 4L4VE 2EIZB 2BY1A 2AGJH 4MJ5A 4F37K 2A2QT 3M1BA 1AO7A 1KCRL 4RISL 3GIVB 5CZXD 5DLMH 5E9DB 2WBKA 1MFDH 3H7BA 5CBAA 1IAIH 2HJKB 4WO4D 2WWMC 4PS4H 1YPZB 4XPHH 4CMHB 5A2IH 4WGVB 2Y9RT 4FQHA 2Q86B 2DIBA 2ZJSL 1JFQL 4Z0XB 3GK8L 3I75A 2P5WD 3VXNA 5DK0A 2VDRL 5AG9A 1FGNL 1OLZA 1U6AH 5TFSL 1T83A 2ZOLB 4S0TD 3DSFH 2XWTB 2YRLA 3PDOB 2ZSVB 3FT2A 2ZG2A 1ZS8A 3T0EC 4JZJC 3NGBB 1A7OH 4RX4D 4FQ2H 1PJ9A 3T0EE 1X5AA 1YY9C 3RUGA 4R3SA 3NCFB 2HTLC 1RUQH 1ZLVH 5IW6B 3BRFA 1EHXA 2LFGA 2GSIB 3QQ9D 1JYXA 4HPOL 1U3JA 5FKPB 5I1DA 1EEZA 2ATPB 3DBXA 4F7PB 1CWVA 4H20H 4UT7H 1ZA6B 3T08A 1JWMA 2VXUH 1FRGL 4Q74A 5D1ZA 4YBQC 1B9ZA 1J11A 3BO8A 5DDHA 4XBGB 4WVRA 2WWKT 2X4QA 4LLVA 1LP9F 4OI7A 1KLUB 4GRLA 5KSBF 1ZHLA 1JUFA 3KPQB 1WZMA 5L2JB 2WINB 1CDHA 2OTUA 5DWUH 3TFKD 2BMKA 4YFLF 5D7IB 1JPGB 2IGFL 2V5YA 3DSNA 5TDOA 5KW9L 2GSGA 5D9SA 4LQFL 1KXVC 4OZFB 4D3CL 2DYPB 1G7PB 1PY9A 2DQUL 4OF5A 2A74A 3SHSA 5GISH 3BPLB 4P5MB 3HFMH 4YO0B 3BVNB 3ZDYF 2DQFB 4NJAH 4XP6L 5JQHC 4Z7VB 2XWBA 2RGSA 4M62L 4L29B 1LWRA 3O4LA 4DTGH 2WUBL 1N59B 1UJ3B 3VH8B 1BFSA 3OAUL 1HIML 2EH8L 5GQBA 3MJ7A 2WW8A 5E8EB 1EPFA 3P0GB 3O0RL 4M1CD 4ZUTA 4RAVB 3U4EA 3QCTH 5DFVC 1QG3A 1AGEA 1TITA 4O4YL 3PWPA 4HIIB 1CVSC 3KNBB 1Y0LA 3OPZL 1SEQL 1MIEH 1OTUD 1X9QA 1GRWA 1ZK9A 5BZWB 5INDA 1OGTB 5IBUG 3MRNB 4M93B 1CIUA 2VR9A 1T0NA 1VERA 2YSSB 4CU7A 3B6SB 4UQ3B 4F15C 1FNLA 1VFAA 3FN3A 4K3GA 1NAMB 3K8MA 2OYPA 1MEXH 1UM6L 1FN4B 2CGRH 2AJZB 1TQBC 1WT5A 3IXTB 5AYQA 4Q9QL 2ARJB 4PREA 3WBDA 2GJ6E 2DF3A 4QTIL 3EDKA 3QI9B 3WIIL 1OAUH 1MLCB 1CN4A 4GKSA 2LTQC 1MQKH 2OS7A 2W0PA 3SE4A 3VCLB 4PB0H 3OKDB 5IMKB 2IFFH 2YUZA 4P2OA 4ZOBA 1ZWIA 4P9HC 1CICA 4CVXB 3KPNB 1KG0B 4QHNB 5EDXA 2YN3A 1BD2E 3MNZA 3VXRD 2LVCA 4LRNH 1I7UB 3BZ4A 4AIZB 3C60D 3CPLB 1FO0A 3R1GL 4CKVX 1AGBB 3SDAA 3TWCL 3MLUH 5TE6L 5I1IH 1IC1A 3KPRB 2APFA 3EYOB 1I1YA 5E8OA 3SOBH 1C5BH 2JCCE 4N9GB 1HSAA 4LKXB 5KBNC 1DUZA 1C08A 1LEKB 4HIXL 1KCVH 3FMGH 3W5MA 1IGTA 1C16A 3LKPB 2H41A 4MNQB 1T1XB 4H26B 3ROOA 5FDYA 2VSCA 3IETA 5DS8A 1FZKB 3ESUF 5HY9B 2R56H 3GIZL 3W82A 4P59H 5ID1B 3QDMB 4LEXL 3GSRA 3DX6B 3GSXA 2BNQD 2VLRE 4XPBL 4GG6A 3BYTA 1E28B 5F7WC 1G7MB 1FVDA 1CGUA 2VXTH 3W81A 3QG7H 1NUDA 1YMME 4H1LA 2GK0A 5EBMA 35C8L 3GMRB 5C0AB 3GM8A 1UH3A 2CJUL 4GJTB 3RL1A 2VUOA 4I3RL 4ETQB 4FP8L 1NSNH 4LDOB 4CL7A 1FFRA 2HT3D 1N0LA 1KCUH 5DUPH 1K4DB 3NH7L 5DVNA 2VLKE 3WS3B 1RHHA 2OI9B 2Y36L 4K8RL 3HAEH 3B9KD 2ZOKB 1TJIH 5E8NA 2AEQL 1X7QA 2LAAA 4QCIA 1V7MH 1CIDA 3NCMA 3PHQA 1A7RL 5DMGC 3ZTJG 4KRPB 2CUMA 1CL7I 3QQNA 3PQYD 1EGJL 2I9LB 1CF8L 3ZE0F 3ZE2F 5F70A 4PRHE 4G7YH 5J56B 1FBIH 1KOAA 1QFWM 1F3RB 2HFTA 3L95A 4XMPL 3HS0A 4XPGL 3LHPL 4AH2A 5HYEA 4XBPA 4PD4K 3T4AA 3ZKXC 1JMXA 4QRUA 3ETBF 1J05A 3UPCA 3LN4B 4M8VA 2X05A 3UZEA 1NFDE 1XR9A 5DD3L 1CD9B 2NXZB 4PP2B 1HWGB 3I6GB 1KPVB 2B4CL 4K3EH 1I9RH 5EIIB 2Y23A 4CMMA 3RAJH 2NLJB 4JRYD 5ANMB 3O3EB 4XVUD 3UTPD 1FNSH 4M6MH 5IHBA 3ME0A 1T7ZA 1H5BA 4I4WB 2X4OA 3NZHH 4LU5H 2O5XH 2H3NB 3H7LA 4F9PA 3BIKA 2X70B 4ALAL 2B0SH 4X4YA 3RPKA 4OZIA 5IVNA 1BHGA 3KYKL 5FGCE 1FV1A 5IF0B 1VEPA 2Y07L 5JXAL 3C09B 5HD8C 2WLZA 3F5WA 5JW3L 2EC8A 1K9TA 4QHMB 5IHUH 3O8XC 1XT5A 2EE3A 2XPGA 3H2WA 4TTDC 1P4IL 3FRPA 4XH2A 4ZPVA 5IQ9B 1W72H 2J8UA 4TRPH 2HFGL 4POZD 2IQ9L 2UUDK 2YC1A 4OLVH 3UTSD 1UFUA 4EVNB 2N4IA 5JORA 3HTLX 4HMEA 1YEJL 3PGDB 1NCWH 4GG8B 3DURB 5IJKC 3SCMA 3HZYB 4N8PA 5LXGH 2EIEA 5F1NA 4AENA 5FXCH 1PZUB 1X5GA 3MR9B 2XQYK 1W8NA 3HB3D 4OCXL 1W0VA 5EUOE 5IMMA 1EAPA 3HPJB 3GJFA 1T6WA 2R1XB 3U6RB 5CJQH 5DJAB 3GBNH 1S9YA 5HHNA 3SDCA 1MNUL 4WFHE 2E6JA 1F90L 1K8IA 2JIXD 3RWHA 2EE6A 2QQQA 4KY1L 1QVOA 4PJEE 4U1MB 3WIHA 2YWYA 5F1KC 1RUKL 3JTTA 5FA4B 1MRCH 1M7XA 2AQ1A 5EWIH 3SE3C 2R1WB 2CMRL 2XI9A 2XOTA 2O61B 1CXFA 1VDGA 1YEHH 3EZJB 2X5PA 4P46B 3GMQA 4QRSA 3JUZA 1H9VA 1KJMB 4OLWL 3OMZA 3SDXE 5L2KE 3NVQA 4Y5YA 5TQ0L 1J9CT 1I9JH 5FUZH 3TBSB 4XPFL 5J11C 2FHFA 3T0BA 3KPSD 1GGCL 5EPMA 1OSPL 5L9DH 5FK9A 3IU4L 4ODUB 4YIQB 2Z92B 3WJLC 4L5FL 5GZOD 5GS0L 1N2RB 3I3BA 1WIPA 2VLJA 3V5HA 3RHWF 3O2WL 4FZEL 3EJYC 1RZJC 1NMCC 4Y16C 4WUUE 3KPLA 3HI1A 4J3OC 5DUBA 4IDJH 1DFBH 4Y4FC 1IM3A 4APQC 2E7LA 1CXHA 5IW3A 1SY6L 2A77L 1JGEB 3QO0A 3VWJC 1QSVA 1LO5A 4OQTL 4LHUB 5T3ZL 2YRZA 2ESVA 1RZKH 4Y4HA 4YHYC 5ESQB 3DGGB 1T80A 2O5ZL 3QEUA 4UUJB 4BSWB 4LOUD 3I50L 4LASL 1OARL 3MLZL 2DQJL 5HPMB 1UM5L 3HNSH 3HZMB 3MSPA 3SDYH 5D7KE 1S7TA 4G9FA 2NTFB 5DUMH 5E7FA 1IEHA 2XT1B 1IKNC 1HHGA 1GOHA 1P2CB 5D6CA 5E7BA 1MCWM 3O6KH 2EZ0C 1T5XA 1ZV5A 4M1GL 5ITBL 2APXA 2CPCA 1FFNA 2OZ4L 1HWHB 5CP3A 2XN9E 1IGFH 5EC1A 4LLDB 3HPLA 5D1XC 1XGUB 5CJ8A 1AO7E 1ZKAA 4HK0A 1N6UA 2MPAH 1OGAB 3PXJA 5MI0B 3P4MB 5HHXL 2D4DA 4HCRA 3CZJA 5C9JB 3LIZH 1MRFH 4KMQA 1P4LB 1IQWH 4K3HA 3QIUA 4M5ZH 5CIPA 3AAZA 5D7JB 1BZ9A 5A2LH 5E1AB 5DEFA 4ENED 1FJ1B 1MFCL 3DVGB 3OKNB 3WIFB 1T83C 4G7VL 4UU9A 1FE8H 3DETC 3PGFL 4MD5B 5F44A 4RZCA 4NC2B 4P3WA 5JIPA 3UXFA 4KDWA 4HF5H 3ARGB 3WHE0 4BFIB 3BH8A 4HG4J 3ZT5A 4W4OA 2XG5A 3RUGE 1IKFL 2FZ3A 2JB5L 4XT1C 1WTLA 1B4JH 1CXKA 3UJJH 5DMKB 1EHLH 5B3JE 5HYSB 3R0NA 3RHWK 3E1F1 1HOCA 3SN6N 3VXMA 4ODSH 4Y19D 4DK6A 3P9LA 5D72L 3MACH 2ZUUA 3QPXL 5D1ZC 3LSOA 2IAND 5CEXA 1HINH 3RX7A 2YD4A 2IPKB 1FGVL 3MRRA 2VDMH 2YPKB 5TH2A 3TBWA 5HHME 4U1GC 4JR9L 3OHXB 4EOWH 4YEEA 4GRLC 2AXHA 1RZIB 4QHKJ 4FG6D 1BIIA 3MOAH 4ZS7H 2FGWL 2YR3A 4GKOA 4H1LG 5FAAA 2FJFA 3QH3B 4QHLA 1S9XB 3HLAA 4XP5H 3T2PA 1U8MB 4JZJB 4UIMB 1F11B 2Q8AL 3VXUD 1MUJA 3R06A 5A43C 4HS6B 2DI8A 4OB5H 4XNQB 3EOAA 1WBXB 4JPKL 4MQSB 5GSRB 4KJWC 3VFGL 1I8KA 2YD7A 2J8HA 4TPRL 6FABH 1Z0NA 2X4RA 5CWSA 1R5IB 4BYHA 1T2JA 4JY4A 4HWUA 2YD8A 1TVDA 3CCHB 3FO2A 3O4LE 2UY6A 1QKZL 2BOBB 2HLAA 5HHPB 4Y4KA 5I15L 1I4FB 3ARBA 4R8WL 1LK2A 5KAQF 5JW5A 1TVBA 1GHFH 4AM0A 4YXKH 5F1OB 2F19L 3PWPE 1BQLH 1N4XH 4PGDA 3REVA 1A6UH 4P4KB 1OM3L 3RWCB 4R97C 4X6FA 2GYSA 1YECL 4ODXB 2XG4A 1Q9LA 1DBKH 4PGZA 4JCLA 5IJVB 3Q6FA 4GOSA 2HMIC 5FHAH 3QDGA 4DVBB 5DEZA 5F71A 4R0LA 4QGTA 5IESH 4R26L 2Z93A 2ITDB 5T1DL 2HT2D 2VC2L 2DLFL 5KJRL 2YD1A 2ZSWB 1N64L 3O3BB 3QR2A 3OV6A 5LQBH 5I71B 4M9OA 2BVYA 3G6AA 4TVPE 3SE4C 2MTPA 1JIBA 5F6HI 1ACYL 1HCVA 4P2OC 3IVKA 3QFJB 2R2BA 2EDXA 2V5TA 1CICC 2OR7A 3NN8A 4FQXD 3QZWA 5DSCB 4R90H 2WIIA 2X9YA 3VGFA 5KSBA 5GZNC 1RZGB 1Y6MR 1F13A 1D6EB 4LLMB 5EU4A 5H37G 3HR5A 2NYYC 4WDIB 4JN1H 5B21A 3FRUA 4HJ0C 3SDAC 3VXQB 4B53A 4I48A 4F15B 1F6LL 5ENWA 5J57B 4ZAKB 1S7XA 3PWLB 4JFOA 3CFCH 1QFUL 5DHVB 2ADGA 3C6LA 4DKFH 3MV9D 1IEAB 1TQBB 1G7JB 2VZUA 2GJ6B 3X13B 5EC2A 1NJ9A 4MLSA 1INEL 5MEQA 2BC4A 1P5VA 2J88L 4S2SB 1HH6A 2LTQB 5FHBL 5J6GA 1SMOA 5FYKE 1OTSD 1A6TA 2WLYA 3G04B 3OXRB 1SEBB 3GSNA 1IM9A 4IMKA 4L8BA 1S7RB 3NA9L 5C0GA 3E6FA 5HVHC 1MCIA 1ZANL 3RWGB 4GG6E 3WFDH 3MA7B 1H8SA 1OLLA 2EKSB 5DTFA 1ZTXH 3RVXC 2R0LH 3V0VA 5LGJB 4LHJB 3G08A 2D7TH 2FB4H 2P8MB 4GAFB 4OF6A 4C54A 1UWGH 3IU3A 4POYA 2OJEA 1RAMA 1G1CA 4IRSB 1FVEA 2NY4C 4KUZL 2R2EB 4JO1H 1QFOA 3PP4L 3CLEL 4W6XB 4ETYA 4LGPB 3CFDA 2FDBP 4M61A 1T22B 2GK2A 4OF0A 1QA9A 2HFFB 4NQSA 3FJTA 3MRFB 5I2IB 4LCYB 5F96L 3BEWA 2QSVA 3IAQA 4HHAB 1P7QB 2HH0L 4LPVA 1TZIA 4CDGC 1T2QH 2P8PB 2VLRB 1Z9SA 2APWA 4PLJC 1G9NC 4KRNA 3RVWD 5F8RC 4HX1A 5C08D 4IRJA 5DURB 1HHIA 4NT6B 3WHXB 1C8PA 4NO5B 1YMMB 2DIJA 3K3QA 5T1LA 2EDKA 5BRZA 5EOTB 5HGHA 4TULH 3V4PL 4ZOAA 4R4FL 2WBJD 3ZTNL 1AHWB 5JPMB 3BZEB 3AS0A 4I13B 3VI3F 2V2TA 1IFHH 4YDJB 4AMKL 5A2KH 5E56A 5MEPA 2V7HA 4FNLH 3TBTA 3VFPB 4QWWC 2QQNL 4OGXH 3D3VD 1MFEH 2VE6A 2ZCKH 4NSKA 2H26A 5F7FA 4PV8B 2IAMD 2CKBL 4HJJL 4KROC 3MO1A 5TF1L 1N8ZA 4N8VB 2YZ1A 4KRMB 2W9EL 2X4PA 2A73A 3TH2T 4L4TA 1OAXH 3M45A 5GJSH 5BV7L 4KK8D 1NC2A 3PE9A 2VL5A 5CJOH 2NMSA 3BPCA 3PIQA 4UBDC 2NY5C 1J1OL 1H5BC 4PRHB 1I3UA 2J8OA 3TT1L 4YR6B 3MLTA 1CGYA 4UMGA 5IV2A 2C3VA 1XF4A 3QA3A 4HV8B 4F9PC 3ES6A 1ZVSB 4W68A 1I7RB 1N7MH 4J3SA 1HQ4B 2HKFL 5JOFA 5IBUB 3QULB 5F9OL 2FO4B 3V5DA 1F4WH 4OZIE 3FB7A 4X5XB 4NJ9L 1NFDB 4V2CB 1D9KA 5H94A 2BFVL 1BOGA 5E6YA 4AY0A 3FO0L 1FIGH 5E94A 4O2FB 4F7TB 2EC9U 4D8PB 1MVFA 2XNAA 4OV5A 2J8UE 3MLYL 3G6JF 1T1ZA 1I8MB 5D7SL 1MCLA 3MUJA 1JRHH 3CLFH 2I07A 5SWZA 4JJHA 4JKWA 2HG5B 3IKCB 3SCMC 3F58H 2CDEB 1J1PL 1ES0B 5EOCL 1Q0YL 2MKLC 3LQMA 3B2VH 4QGYA 4U31A 1KYOJ 4WV1A 1QUNA 5CEYA 5HHQA 1G6RL 4PJ7F 1NFIB 4XTRC 5E6ID 4XVSL 5JUEL 1EJOL 3TC9A 5FGCB 4BKLB 3SDCC 2Z91B 2FEDC 3DVNB 1REIA 2LABA 1EEYB 3WHE1 1D5ZA 3T1WA 3RWDA 3G5ZA 5HGDB 3P4OB 4JFDD 4BQ9A 3PP3H 1ZGLA 4S1RL 2W9DH 4Q0XH 3VFUA 4K7FB 4AT6B 5GS1A 3SGKA 2D03L 5F7EH 4GFTB 4MAYD 3GKZA 1F6AA 2X4NA 4PJ9D 3RY5A 3LPGA 3U4BH 3B9AA 3KLAA 2IQAA 3O4OC 43CAA 3ZT7A 3WFEH 3NCJL 3B5GA 1WLHA 4Y5YC 1HDMA 3C5ZA 4JKPL 3C8DA 1E6JH 5EUOB 5F9JA 1TVHA 5FO8B 3TZVD 5LAXB 2JB6A 5E8PA 1D5IL 3X14A 2A6IA 1HZHL 4JM2D 2DDQH 5LCVH 5L0QC 3EGSB 3UTOA 2ED8A 5IG7B 4KZDL 4QRTB 2DWDB 4EN3D 3BPNB 2VLJE 4PJEB 4RFEB 5C6WH 1BF2A 1K2DB 4JFFA 1NC4B 3OXSB 2LV4A 1DBAL 4FFZL 4WFFD 4FQCH 2H32A 4KKCC 3NCEB 2HTKC 1X6NA 2YD9A 3DUUA 2F8VA 2E7LC 3D85A 5H2BA 3OZ9H 3LQAC 3VWKB 4P5KA 1IGYA 2DRUA 5FV1L 1AD0A 4D0BB 1T0MA 2YKLL 4I0PC 4Y4HC 5L2KB 2ESVE 3TPUA 2LU3A 4XP9L 4MAUL 3LKOB 5MENB 5F7DB 1WAAA 4JFHD 1EEUA 3ZE1E 5KTEL 3N1QC 4QHUA 3BAEL 4DFIA 5K9OA 4G9FE 3ROLA 1P53A 4G3YL 3B8YA 1U8KA 3LB6D 5IHZB 2DQIH 5J6HA 3SGEI 4I5BA 3DTXB 4QXGH 1NMCB 4Y16B 4ACPA 1PDKA 4FFWD 2JELH 1BQHB 2YD6A 4NQDA 5CUSL 5CILH 4HJGB 3V7MA 4Y4FB 1R3JA 4WJ5B 1Z5LB 3B5HA 3ZTJH 3QJFA 2V2XB 4APQB 1OCWH 1QZ1A 5TF0A 4FZ8H 4K94H 1CE6B 5KSVA 3FQRB 2G2RB 3IJHB 4PY8I 5KVFH 4IS6B 3TP4A 2VZTA 4NM4L 1BQSA 3BUTA 4OUOA 3QDJA 3QZWG 5T1KD 4GAJL 2OSLA 5E99L 3QIUC 4LSSH 3ZHLA 2EYRB 2YXMA 3ULUC 1A0QH 3QRGL 4L9LB 3ULUE 1QFPA 3L3IA 4CDHA 5K9KB 3ZSSA 2VDOH 4X6EA 1F8TH 3HMXH 3WUWA 2CSPA 4FFVD 5C0CA 4X7DC 4Q97A 3P9MA 3EDJA 1JJUA 4W4OC 1AO7B 1S7SB 3KXFA 4MJ4A 4OV6F 2VOTA 5HDOA 3RA7L 3H7BB 3ZYJA 2P5EB 1JNLL 1VKXA 3VXME 3BT2H 1CE1L 5ERWB 1RIHH 4XNUL 1OAZL 5K9JH 3QNZA 1IC5H 4N0UA 3I75B 3VXNB 1CXEA 5DK0B 2MNUA 3CDCA 3NFSL 4X5WA 4AEFA 1NCDH 5F7NC 1YZZA 3MCG1 1N0XL 1ZS8B 4NO3B 2J3SA 2IH3B 3KGRA 2V5MA 3RUGB 4R3SB 4JGUA 2APVA 2F8OA 4QRRB 2XZCL 1ZHKA 1HI6A 2NNAA 4K9EH 4JKKA 4NQVA 2CIKA 4Z8FL 3O3AA 4FABH 2XQBH 3OB0H 2IPUK 3CK0L 4X7FC 3O2DL 1AGCB 3ZMRA 1R3IL 5EZIL 4EUPA 5DDHB 3BO8B 2WP3T 5HHMB 3QEQD 5J06A 5DJYB 3SQOL 4HULB 3OAZK 4LLVB 4U1KA 5E0QA 1JUFB 4KK5D 4Y4KC 2G60L 2OTUB 4FQLH 5I8KH 3ARBC 3UTZB 4V1DA 2BMKB 1CDGA 3H3KA 1EHAA 1MHCA 3DMMA 1EEQA 1WC7A 2H45A 1AGDA 5SWSD 5TDOB 5D9SB 1OY3B 3BP7B 2Q76A 5EUKA 3GMLA 4IHOA 4N1HB 4YXHH 1NAKL 1LE9A 3FFCD 1JWSA 4CADB 1K8DB 4UOJA 3SDDD 3ZDZF 1JWUB 2Z31A 3QDGE 2A74B 3QNYA 4Q9RL 1ZVYA 1IAKB 1H0DA 3QXAA 4X6DB 3MRPA 4PRIB 4JY5H 4BZ2L 4IEFB 1RFDH 5H35A 3MJ7B 1KSRA 2R8SH 3CXHJ 2W59A 1QNZH 1CYGA 3L3KA 1JPSH 4ZUTB 3K2MC 1H3GA 3X3FH 5E08L 3BQUC 1AGEB 1LDSA 3PWPB 3OJMB 4QYOA 5KSBE 1ZMYA 3O6LH 2C1PA 1MCKA 1R3HB 3UYRH 1Y0LB 1VADB 1KPRA 2GITA 2XY1A 4P99A 1G9EA 3VG0L 3LKQA 4GAGL 4NOFA 1ONQA 3I84A 3T8XB 1VFAB 5DJ2B 2H2PD 4ZXBB 1ZEAH 4EJ1C 5JR1L 3EHBC 1T3FA 3C6LC 2UVFA 2BSRA 1DVFD 3Q6GH 4PREB 2AGJL 5BS0D 3DI3B 2XQYG 4GKSB 5DLML 4PB9H 1TDQA 1SY6A 2FX7H