3G5YB

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
210
Chain Sequence
DVQLQESGPALVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSANTRYNPSLKSRISITRDTSKNQFFLQLNSVTVEDTATYYCATAGRGFPYWGQGTLVTVSAAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 175 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 210
sequence length 216
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yB01
3GUTB 4OT1H 5FCUH 1Q9WA 3ZZ1A 3VGGA 5F88A 4M93C 4UV4H 2QHRL 5SWZE 4JFOB 5F3BA 5E2VH 4PRHA 3NIGF 1R3LB 5TE7H 1A6VL 3GNMH 1BM3L 4XCCH 1QFOA 5T33H 4OF7A 3MODL 3TBTB 5I71B 4WUUA 4V2CB 2OZ4H 4HZAA 5D6DC 1CXFA 2ORBL 1KJ2L 1BGXH 1RUKH 2C1PA 4I5BA 4R0LC 4XWOD 3TBWA 5T5FH 3NFPB 4AEHL 1YMMA 3GUTA 5DI8B 2KL6A 3SO3C 2GHWB 4JN1H 4NRZA 4CADA 1RJYB 1I8MB 4O5LH 4P2YA 3VWJC 1XF3A 1I3VA 2XOTA 2OMBA 1ED3B 2J3SA 4KI5F 2VZVA 3D9AH 2FEDD 5E6IC 4MJIE 4GS7B 2NY5H 3TBTA 3NMEA 2Y7QB 1IGIL 5ADPH 4NZRH 5HXMA 3VCLB 3HA0A 2GKIA 2AXJA 3TN0B 2BNUB 4JM2B 3MLUL 1B9ZA 3NFPA 4CW1B 5DI8A 3TWCL 1AJ7H 3K8MA 3IFPB 3RHWF 4B41A 3WD5L 2HWZL 1RJYA 5FGRA 2VNCA 3B43A 3ARFC 1WCQA 1ED3A 2RHEA 4HPOL 5DQDL 3B5TA 3W0WD 3UTZB 3D25A 2QSCH 4GRWB 2VLJA 5JLZB 1M7DB 2GJ6E 2Y7QA 4PRPD 2BMKB 5HDOA 2J6EL 3D39B 3L3OB 2AXHA 3W9EA 2VIRB 3SKNB 3VCLA 1A7RL 1A9BB 3TN0A 3QXTA 4TNVK 2BNUA 1QFWH 1N6UA 3OKOA 2HN7A 4JM2A 3ZSSA 4X6DA 3ZE0E 3ULVC 1DBAH 4FQIH 4QHUB 4CW1A 4NQXB 3IFPA 3U48A 2VITB 1QRNE 3IDXL 2FJHB 4YXKH 5CHNB 3TGXA 4LSUL 4RCAA 1RUAH 1CIDA 3ZKSD 1VERA 4MD5A 4OLXL 1VPOH 2OTUB 1E4WL 2VB5A 5DZLA 3K4AA 4PG2C 5IR1B 5JLZA 1M7DA 3S7GA 1JPGB 1OCWH 1BZ9B 5MEPA 3LN5B 4WWKD 4Z95H 3L3OA 1ZTXH 2VIRA 3SKNA 4LVOB 1A9BA 2VXVH 5B3NA 4QHUA 1MHPH 4XAKD 1A3LH 3ZSTA 4C55A 4YQXH 3NCBB 4NQXA 1ZLWH 3K0WA 2WIMA 4IS6B 3BD4A 2VITA 2JK5B 3DJ9A 5HVWA 1F11B 1V5JA 3NH7L 5HGHB 1BMGA 3EO1B 4EDXB 4HJJL 2OTUA 2ID5A 5IR1A 1BD2B 2VLRE 2EDFA 2BNRB 5F6IC 4JVUA 1BZ9A 3PV6B 1TVBA 3QJHA 3OMZA 1IGJB 1F4HA 1J1XH 4YHPB 4PJEF 1EHAA 1CDJA 4OJFH 3VFUB 3GSUB 4DGIL 1JCKA 1U8NA 2JCCE 2C3VB 2EZ0C 5FGSA 2H45A 4OKDA 4IS6A 4L4TE 3UTOA 3C09B 2JK5A 4BELD 4DN3H 1F11A 3IDIB 5HGHA 3EO1A 4KTEL 4EDXA 1WWWX 1G7LA 4OM0H 4OFPA 1BD2A 2AJYL 3SEPA 2HTKC 2BNRA 4RFOH 1IGJA 1S7XB 4RZCA 1GOHA 4YHPA 4JRXA 5ADOL 5FA4A 2DQGL 4NN6C 5J1AB 3VFUA 5DFWH 5CBAB 5HHOE 5CJXA 2A9NH 1T0MA 3GSUA 4G43A 3OJ2C 1J05B 4HUUB 5I19H 4FQQB 4WDIA 1RIHL 4TUKL 4MA7L 4APQD 1JFQH 3MV8B 4LVNC 2C7UB 5HVHC 1YQVL 1R5WB 5D1QB 4W4OA 5D4QA 4QTIH 4KKBD 3SBWA 4HHAB 4X9FA 3UX9B 4Y4KB 1B88A 1S7XA 1V8HA 2JF1A 2IANE 4OCSH 2APBA 3RWJA 1C08B 3A6CL 4CVUA 1MRFH 4POUB 5J1AA 4KKAD 4DZBB 5CBAA 3ARTA 3BP7B 4S1RH 5DUML 4HUUA 4P9HL 2XWTA 5L2KB 4FQQA 3ZKMC 3MV8A 5DQDH 1EJOL 1MCBA 4FQLL 4QGYA 1R5WA 5D1QA 2CK0L 1F5WA 3REVB 2XA3A 2YA2A 4POYA 3IAGC 3I50H 1NAMB 2MHAB 4QXUL 5D7IE 2J6EH 4HHAA 2Z4QA 4RX4A 5DJYA 1A7RH 1C16A 3RVVC 1XR9B 2KH2B 1QPXA 1X5YA 3HNVL 1KLGB 1OGAE 3HC0B 1C08A 5C1MB 4L3ED 4JDVB 4N8CL 4PJGB 2YHGA 3BP7A 4U3XA 1X4XA 3RVXD 1TPXB 5K33A 3O3BB 1K6QL 2HJLB 1FNSL 4H5SB 3HI6L 43CAB 4A6YH 5AUMB 3S36X 1JI1A 4MNHB 1SM3L 3TM6A 3R1GL 1AI1L 4ZUTA 2FJFB 4LK4A 4GRLD 5F44A 4OM1L 4GKZB 4MWFB 1XR9A 3FRUB 5DS8B 1JL8A 2VSCA 1KLGA 4YHKL 4F58H 5KAQG 4WHYH 4GXUN 1MY5A 2CIKB 2A38A 4JDVA 4ODHL 1G1YA 4PJGA 2FLRT 2V5MA 4UAOB 3N1PC 4ONHB 2ENYA 4LCCC 4QOKE 4LLVB 4O02L 2DRUA 3O3BA 1G9EA 4H5SA 3V5HB 4M7ZB 2AQ1A 4LLUB 3H9ZA 4NQCB 4MNHA 5K9QI 1P1ZB 1WZ1H 3UTSA 3VXSA 1DTUA 3HAEH 3MFFB 4K23H 3IB4A 3RNQB 4ZUVB 3F65A 5GSRB 2FJFA 1Y6MR 5I0ZA 1K4CB 4GKZA 4MWFA 4K9EH 2NY7L 2JJSA 4XZUA 5DS8A 4J3SA 3DWTA 3O2WL 3B9KD 3SKUD 4JGUA 1ZE3C 2FGWH 4DGIH 2VE6A 3G08A 4O9HL 4G8GA 1T4KA 2LU3A 3D69B 4Z7OF 4HJ0C 4XI5C 4ONHA 3KYKL 5CIPH 3KLAB 4FG6C 4YXLL 2Y25A 3V5HA 3MNZA 4LLUA 1DJSA 1DR9A 4JM2F 4KTEH 4NQCA 4XMKL 4X6DF 1YZZA 5HDBE 4OQ1A 4S1QH 3ULVE 3MFFA 5DK2B 3RNQA 3FB7B 4ZUVA 5GSRA 4AH2B 4RAHA 2GITB 1MJUL 2VDML 4Y5VB 5I0DA 1Z3GL 4F9PC 2J4WL 3H9SE 2I9LB 1XFPA 4NP4H 3VA2C 3LDBC 3D69A 2R56L 3CFDB 4OCWL 4XVUD 2C9AA 4NN7C 1RIHH 5EBGA 5KS9B 1ZHKB 4MA7H 3C5ZD 3P4MB 3SJVD 5FO9B 3VD4A 2CKBB 4PV8B 5EOQL 4LKCB 4OB5H 5F1SA 1JVKA 4OBRA 3QFJD 1R0AH 1ADQL 4F2MA 1YEKL 2NW3B 4RNRA 3PL6A 4Y4HD 5DK2A 1YEFL 2E6PA 1KCLA 4AH2A 1P9MA 2WSKA 5TGBB 1M71B 2GITA 4ELKB 4YPGB 2C4XA 4Y5VA 3A6CH 4K07A 3G5YB 5E00A 2JJUA 4K9EC 1HYSC 2I9LA 1WV7T 3OAZH 4X7FC 1TTUA 4YNYB 2W1NA 1RJZB 3CFDA 5KS9A 4ZOAA 1NCTA 4BJLA 3PWPD 2ZOLB 2YD5A 1CD0A 2MQ0A 4UTBH 2PR4H 4LKCA 1P7QD 3GI9L 4N0CD 3W39B 5I1GL 1QSEB 2VXQL 1CU4H 5AAMA 5SWQB 1HKFA 4QRPA 3L1OH 4MXWH 4MNQA 5TGBA 2CRMA 3DXAB 3J7HA 2Y36H 1LK3L 1AKJB 3G5YA 4PUBL 4N8CH 4R26H 2OS7A 3SOBL 1FFQA 5GRVK 5E9DE 5I75C 1JV5B 4KPHH 3HUJE 4F9LA 5E99H 3K80A 1K6QH 3DPBA 3QYCA 3BHBB 3TF7C 1WIOA 3WV0A 1BJMA 2Q3ZA 4AMKH 2XN9E 4YR6B 2ZOLA 3DX8A 5GZOC 1UWXK 1VFOA 1G9NL 1MOEA 5GGUB 3CFJB 1KCUL 4WV1B 4LAQL 3W39A 2KZ1B 1RZKC 2NPLX 4JPKH 2Y9RT 1F4WL 2WBWB 1AXTH 4MDIB 5SWQA 3LSOB 3NCFB 2APXA 4D0BB 3DXAA 2KQMA 2XZAH 1MJJB 4JQVC 4YHKH 1N4XL 2R29H 1RZIB 4PRAB 4DGVL 3P77B 4D94A 4NFDA 2F54B 1JV5A 3UZEA 3H3BC 3IDJB 3UPAA 5C7XH 1IL1B 3BHBA 5TQ2L 2YD8A 1LO5B 5FUZL 2ZKHH 3OG4B 2DL9A 3LCYA 3L7EB 3FQNB 2VC2H 1GCFA 1CLOH 5DO2D 1H5BB 3CFJA 5GGUA 4WV1A 2DWEB 4LGSB 4TVPE 5LJYH 3G9VA 4JRYB 2FB4L 4KWUA 3S88L 1OD9A 1QFHA 3HG1D 4P57B 4MDIA 2XQYG 3LSOA 3P2TA 3TYFB 4RGOH 2OR9L 3C6SA 4NCC1 4D0BA 3V8OA 1QHOA 2FATH 3V0AC 3FT4A 1K5NB 1RZIA 3CMOL 4PRAA 5IB3A 3P77A 1C5CH 5DURD 5CKAA 1KPUB 2F54A 2ADJB 3IDJA 4ZPVB 1IL1A 3KYKH 3IJYB 5ANMA 3IFOB 4RA3A 2OMNA 5I15H 1LO5A 3EBAA 4NPYB 1T3FB 3FRPA 2AK1H 5D71H 4DVRL 4ENED 3L7EA 1BWWA 4WI4A 4DVBB 1DVFD 3UXFA 3WFCL 4LRNH 5KW9L 4ELME 3F7QA 4JRYA 2VDOL 3DARA 3VI3E 2H2PD 4U7SA 4P57A 4XP9L 1MJUH 4KZEL 4V1DD 3TYFA 1FE8L 3NTCH 3RI5K 2XT1B 3FT3B 1OAYH 1RZFH 3MO1B 3HFML 4JN2B 5JORB 1K5NA 4KVCL 1VB9A 2OI9C 5DR5L 3P11H 1KPUA 2YMXH 4P3CH 3SE8L 2ADJA 3KLSA 5DT1L 4ZPVA 3IJYA 5C0IB 3ARWA 3CFEB 2JIXD 3IFOA 5E4EC 4P5KB 5GRYA 4B5EA 4NPYA 1T3FA 4FFVC 1CLYL 1D9KB 1I4FA 4X8JB 4DVBA 4NQTA 3EDDA 1ZOXA 2EXWD 1GL4B 1MCKA 4XB8A 1ZT7B 5LG1A 3HC4H 2J88L 4ZOEA 3R06B 4PJ5A 5I2IB 3FRPG 1INEH 3FT3A 3BN9D 3CSPA 3MO1A 4ZDHB 2B4CL 4JN2A 3P9MB 3I9GL 4U1IB 2ED9A 3JSSA 1KJMB 3SKJL 1EGJH 3VWKD 1SY6H 4JFDA 4FZ8L 4JO1L 3MRNA 5EIIB 3KLHD 3ARYA 2A1WH 5C0IA 3CFEA 3RWIB 3GI9H 4YHNB 3O2VL 4IOIB 3KPNB 2EIZA 1ZS8B 2J8HA 1EVTC 4X8JA 4IRSB 3BZFA 2CUHA 2ZSVB 5IROC 1L0QA 4U05A 2MSPA 2UV3A 2WW8A 2WWMD 4Y5XC 3SE3C 3TA3C 1ZANL 4OF6A 1ZT7A 4LDOB 2GFBA 4I8DA 4DUXA 4AIXA 3S6CA 1LP9E 3QDMD 4Y2DA 3KR3L 2D31B 4PUBH 1OW0C 4ZDHA 1BX2A 2YD6A 4FQJH 3AAZB 1QACA 4BK4A 2C3HA 3CXDL 1KCSH 4JGJA 4U1IA 1OP5K 4I3GA 1WCBB 4JREB 5J6GA 4DKEL 1PX3A 5ISZE 1KFAL 4XPTL 4LCIH 5EIIA 5L88H 4G3YH 3RWIA 4YHNA 4G80B 4GBXC 3V8CA 3CVHB 2WWKT 4G6FB 2AJSH 5INCB 1ZS8A 3JXAA 3G6DH 2NY3B 4J23A 4X4XA 2Y06L 2ZSVA 4S1SH 3BP6B 3E6FB 4GXVH 5MHSE 2BSSB 3NA4A 4DGVH 5IB5B 4K94L 5I8EA 2R1WB 1A5FH 3AAZA 4ZNEE 2WV3A 5L6YH 5AEAA 1Q94B 3L7FA 4KTDH 5GGRB 4GMSL 4OCRH 4N0YH 1GSMA 2EXYD 5FV2A 5F9OL 3P0VH 4XBPA 4PIRF 4I4WB 4G80A 4OIAA 3CVHA 4NDMA 1TQBB 4U2ZA 3QUML 4WEUD 3IGAB 1DEDA 3BQUB 4JGMA 3RTQC 5GS0L 1U3HC 2IPUG 2OR9H 2LQRA 3RPIB 3BP6A 1D5ZB 2Q87A 4BQ8A 4JHZA 3E6FA 1GIGH 3ZYZA 3LMJL 3RA7H 1WAAE 4LPVA 2W0LA 3LPFA 2CDEB 2ZNXA 3NA9H 1MCJA 1C12B 1Q94A 2VXTL 5IOPB 1F4XL 4EN3B 4X98A 5GGRA 2W59A 2YN5A 3QCTL 5GJSL 2DLIA 3BUTA 5IK3B 3DVNB 2BHZA 2HKHL 2BDNH 2BSRB 5I8OH 1J7VR 4TSAH 3IGAA 3U4BL 4OIIL 3QEGL 3BKCL 3RPIA 3S96A 3WFDL 3UJIL 4GSDL 5ACZB 4KVCH 2XWJA 2CDEA 4C56E 5DVOA 4QRRB 1C12A 1JGEA 4OLYL 4JQIH 5IOPA 4EN3A 2VLJD 3R4DA 3TO4C 3G5XA 5IK3A 1R3JB 1JIBA 1RK0B 2VZ1A 1AH1A 5BRZA 2AK4A 3F7PC 5CEZE 2BSRA 4JHBA 3K2MC 3V6OA 1Q38A 5D96C 4GG6F 1P4LB 1F6LL 1DEEA 1GAFL 4L9LB 1DQDL 4M3JA 1RHHA 3KXFE 5DA4A 1JNHB 4Y4FD 3U0TB 1G6RL 5ACZA 4ZD3L 3O3EB 2V5YA 4AL8L 2XZZA 3WBDA 3EJZC 2W9EL 4GMTH 2R2BB 4M1GL 1OWWA 4WEBH 4Q6YA 4CKVX 5KSVB 1EO8L 4JKPH 1G6RA 3IS1X 1WITA 1JBJA 2AI0H 1ORSA 3HMWL 1RK0A 3I02B 1JHLL 5D1XD 3VGAC 1S9XB 3LKRA 1BJ1J 4N8VB 1E4XL 1FPTL 2YPKB 1P4LA 2SEBB 5FHBL 4L9LA 5BV7H 5DFTA 1JNHA 3TJHD 4F7TA 5IJKA 1XF5B 3MJ8B 3U0TA 1RZJC 1GGBH 3TJEH 3ALPA 2FO4B 4N0UE 4MVBD 2R2BA 3BUYB 5D5ME 1JE6A 5DRZB 4QKXB 5KSVA 3G5ZA 3PP4H 5LWYH 3K2UL 2VZ3A 3MCLH 4JG1L 4JR9H 1OAUH 4L5FL 3I02A 3QNYA 3MA7B 4JPIB 2Y06H 4WU5B 4I9WD 5C0BB 2WAHA 1ZGLB 1IEHA 4LPTA 2GIYA 2YPKA 4I0PB 2SEBA 3QULB 3MPCA 4MB4A 3MJ8A 2NY2B 2X09A 1MF2L 4FFWD 4HWZA 4IDJL 4EVNB 2A6IA 2FO4A 4IRZL 4QLRA 3NPSC 3FFCD 4GMSH 4JPVL 5EZOH 4YHML 1K8DB 5D7JB 1HH9B 5DRZA 3L3JA 1T2JA 2KPNA 3V4VL 4NHCL 5K9QG 1AQDB 4JFFA 2NY4D 2B20A 3RKDC 5DJ8B 2EDTA 4HIHB 2W07A 5AD0A 1CBVL 3HB3C 4JPIA 4WU5A 4JRXD 4XWGH 5LGKA 1NDGB 2QBWA 3G6AB 5DD5H 3QULA 4OZFB 4OZIA 4EBQL 4PJBB 5DJ0B 1GC1C 2AGJL 4Z78A 3CFIC 2JKXA 3VE0B 4OCMC 3JVGA 5IW1A 1PEZA 3U30C 2BK8A 3QG6B 3CXHK 3N1MC 4RMWA 6CGTA 4B53A 1J18A 1FNEB 1K8DA 3PWVA 5D7JA 5EU3A 1FVEB 1I8LA 3T4YB 5C9JB 2HKHH 5DRNA 4FMFA 1AQDA 1U93B 4KKBC 1J8HB 5DJ8A 1NFDB 4DQOH 5ESAB 3DROB 1N64H 4OD3H 1IEAB 5IJVB 3E3QE 2X40A 5IM7A 5E8EB 4NNYB 3WFDH 1I1AD 1ROWA 3O6ML 4NQVB 4E41A 3IDGB 1IQDB 5IESL 3T04D 1IBGH 4OIBA 4PJBA 1D5MA 4I1NB 3VE0A 4JJ5B 1FYTB 5T3XL 3OF6D 4BFIA 2BOBB 3P0YH 3MJ7B 3QG6A 1A7NL 3ZHKA 2BNQD 1KELL 1FNEA 2FBJH 1S8DB 1EUTA 1FVEA 4CN6A 1N7MH 5ETUA 5C9JA 3UJJH 1CGYA 1A7QH 3SDDC 1JK8A 3LZFL 4DFIA 1J8HA 4BK5A 3ARXA 1NFDA 1P5UA 4OGYL 1IEAA 2P42B 1U92A 2Z35B 4G7VH 5IJVA 3BYTA 5C07D 5KVDL 4OFYA 5CCKL 3QXDB 4P4KB 5IMOB 4LLYB 3CPLA 4NQVA 3BW9B 3IDGA 1IQDA 3QQ3B 4RGND 3ESVF 1P5VA 4U7MA 3RU8H 4FN0A 2Q1EA 3C5JB 4JJ5A 5L8JB 3RVXC 5FECA 5ICYB 2EEDA 5IWLA 1RSFA 2EDKA 4Y16B 3UDWC 3QWOB 5DHYB 3NFSL 2BVPB 5MERB 2ZJSH 4UOW0 4K3DH 3BGFB 1TJIH 3EIFA 3F7RA 3FAXA 2DQCL 2R1YB 1E4XH 4GRLC 3P4LA 4QY8A 2Z35A 3MRGB 3MBEC 4OZGB 4D3CH 3QQ3A 3H3KA 1KCRH 1JGLL 1P6AB 3DVFA 1JPFB 3NAAH 1XT5A 4WENB 5MENB 4Y16A 4Y5YB 3QWOA 5DHYA 2PKDA 3UTSD 3VXSD 2CRZA 1MELA 2BVQB 3H6JA 4JEGB 1MCIA 4YHYC 5MERA 4NNXA 3KPRB 2A74B 2R2EB 2R1YA 1G9ML 4ZS7H 3O45B 5BZDB 3QIBB 3CX5J 5F9JB 3MRGA 3ARGD 4G8GD 1INDH 1CN4A 4OCYL 4MCYA 1FGVL 2AABL 3W0WE 3T0EB 2FX8L 5HD8D 4YHMH 4RFNB 5A3ID 3T8XB 4PRPE 2P8MB 5MENA 5TDOB 1NJ9B 4Y5YA 5EG6C 3N85L 4GQPH 2V7NB 4ODWB 3EJJX 5ENWB 2BVQA 3SDCB 4N5ED 3KPRA 3QI9A 5EZIL 2QADC 2R2EA 4YFLF 3O45A 1RZ8B 3QHFL 5BZDA 3QIBA 2VDKL 5TDNB 5F9JA 4NQED 3VXRE 3QQNA 4ODUA 3RGVD 5I8KH 2EE2A 4P5TA 2JELH 4LSSH 2DMBA 4M5YH 5T1MB 4HGMA 3OL2A 1AXIB 1CXIA 2P5EA 2NXZC 3T0EA 4XVUC 2HLFD 1H8SA 2PYED 3PQYB 1KNOB 3T8XA 2P8MA 4P3DB 3MOAH 5TDOA 1NJ9A 2VLMD 5T1LD 4TNWF 3PL6D 5ENWA 3BKYL 4QRSA 1UWGL 1KTRL 3ECBB 3SDCA 4R4BA 3WSQH 1I7ZB 4S1DD 2G75A 3TNNB 1NCBL 1JZ5A 1H8OA 3ULUL 1NMCB 1RZ8A 3DRQA 5TDNA 3TVMD 2AJ3B 4YBQD 2YUXA 5GSVB 3O6FB 3SDAD 5T1MA 1AY1H 4WFFD 3D0LB 4J3OC 1WT5A 4LPWA 4YDKH 5CLWA 1J1OH 1H0DB 3PQYA 3HLAB 1R3KB 5D7SL 1KNOA 3DRTB 4P3DA 4WUKH 5EN2A 1DANU 4RWHA 4WHTB 3MRIB 3FN0H 4QRPD 2XV6B 5DJAB 3ECBA 4KI5C 4MNQD 1I7ZA 2X70B 4BFGA 3TNNA 4UNTA 4HUNB 5GS1B 4XVJH 4H25B 4KK5D 5GSVA 3M1BB 1TZGH 1MPAL 3O6FA 1FJ1B 5HVFB 1TMCB 3L5HA 2NTSP 2DN7A 1JRHI 3IXAA 4C4KO 1H0DA 3HLAA 1U3YA 1R3KA 3L5IA 3IS0X 3DRTA 3OBAA 3G5VB 1I3UA 4OZIF 3MNWB 3MRBB 3EYUL 4YC2C 4WCYL 5FO7B 4LHUB 1Y6NR 3MYZA 3BH8A 2X70A 3NZ8A 3U79A 3CZJA 5HPMA 2AP2A 2C4FT 5CJ5A 4H25A 5DJ2B 1YPZA 3M1BA 3O9WD 1II4E 1P4IL 1W0VB 2XXCB 1FJ1A 3K81A 4LASL 1CGSL 3T3MF 3VXMB 3RVTD 2ZUVA 3HR5A 4WFED 2ICWB 1MVUB 3LKPB 3G5VA 1DUYB 5DO2C 2W65A 4U1GC 2VN4A 4JQXC 1G84A 5F7DB 5FO7A 4LHUA 1WWAX 4NGHL 5SWZA 3QUYB 5GGSB 3QUXA 3MREB 4PFEA 5DJ2A 5ID1B 4K3JH 4MJIB 5F1NB 5FDYA 4KK8D 1NFDF 3PDOA 4MNGE 3VFRB 1CGTA 3LS4H 2ICWA 3HZYB 4WO4D 4ENEC 5FYLE 1J0YA 3B9AA 1VFAB 4GAGH 1DUYA 3VFWB 4JLRA 1DVFC 5KVGH 5F7DA 4KRPD 2CJUL 1WZMA 1HNFA 1ORQA 1RZGA 4IMKC 2H2PC 1YYLH 3V95A 3QHFH 4H1LB 1T7ZA 1NGWB 4IOSD 4D2NA 4O4YL 5GGSA 5F70A 3MREA 5ID1A 1NCNA 4Z76A 5SX5H 2X4TB 4ZFGL 1DSFH 2GJ6B 3EOTL 3IJHB 4LHUG 3BVNB 4LSQL 1MJ8L 3GJFH 4HF5L 3P30H 5D1ZB 4K3EH 3BEVB 2W9DH 1GRWA 4KXZI 3HZYA 4JG0L 4U7KA 5DD6A 1VFAA 1ZLWK 3VFWA 2X42A 2Z91A 2YC1B 1CS6A 3STZA 6FABL 1NCBH 5K59F 1NAKL 1AR1C 4PJ5D 2EXWC 4JFZH 4ONGL 4H1LA 2O5YL 3RZCC 2DM3A 1QRNB 4PJXE 3NIDE 4LP5A 3QA3B 3GMLB 3BN9C 1A0QH 4JFEE 4U3CA 2DL2A 4JFDD 4LSVH 4M1CD 3GM0A 2P1YA 3RDTA 3VWKC 3Q5YA 5HI3D 2GJ6A 3IJHA 5ERWB 2F5BL 3BVNA 1UA6L 1QLFB 3FFDA 2Z8VC 3BEVA 5D1ZA 5JOPD 3KLHC 3I2CL 3GI8L 4DTGL 3BDYL 1GPOH 3L3IB 4POZD 1MCPL 3OKYA 4Y2DD 4CL7A 4HIJB 3BISA 4KJQD 1QRNA 1F3JB 3K3QA 1DQTA 1S78C 5C0EA 3QA3A 3GMLA 1MPAH 4MZ3A 4Q9QH 5GRJH 4ONFL 2VLRB 5CWSA 5ERWA 1T22B 4C4KT 4H1LG 3AS0A 2OLDA 5BMFL 1QLFA 1MCOL 1U8LB 3X14B 2QKIB 3JUYA 4X83A 3FO0L 2VH5H 3FO1B 1TFHA 3L3IA 5J9PB 3BPNB 3MROB 2JCCB 3QNXB 3MNVA 1T7YA 2VMFA 4D0CB 4LCWA 5C0FB 1F3JA 1P4IH 5I1HL 1JI2A 5C2BL 1NBVL 4LASH 2JB5L 3QXAB 2BCKA 3B3IA 3E0GA 3P73A 1CDGA 1T22A 2EXYC 1D5XB 4KKLC 5H37G 5EU6A 1N6QL 3VJ6B 1G1CA 5HDLA 3X14A 2QKIA 3KNBB 4MAYD 1R5VB 3U7YH 2Q8AH 1AXSB 3CC5B 3INUH 4NBZB 3FO1A 1A3RL 5HHOB 3VRLF 5J9PA 3MROA 2JCCA 3QNXA 4Q74A 3BH9B 4NM4H 3ULUF 3BT2L 3RBGA 2CUMA 2FX9L 4L4TA 5C0FA 5GS0D 3GSNB 4XTRD 3EGSB 4XPHL 1MNUH 4GRWH 5JHDD 3LIZL 2DM4A 1FN4B 3VJ6A 5I71C 5A2LH 1G7MA 2ZP0T 3KNBA 4GW1B 4Z7VE 1AXSA 2YD9A 3CC5A 1RUPH 4AG4H 5HHOA 2Q76A 2EKSB 3QJFA 1OAKH 5F6HJ 3HE6A 2W0PA 4O4YH 3QXVA 1QFPA 2DQHH 5I1IH 5ECJE 3GSNA 5AWNL 4GQ9L 4MLSA 3VGHA 4LSQH 1B2WL 1MJ8H 3KYMB 5ABDE 3KPMB 1G7IA 4GS7C 1FAIH 1KPVB 2AK4D 5BRZD 1FN4A 3GMPA 4XXCA 4JG0H 3VXOB 2IANA 4M93B 3ET9F 1OGAB 3DO7A 1YPZF 4RMSA 4HBQA 4GW1A 3QP3A 6FABH 2YRZA 4FXGA 3TNMB 2YD2A 3TN0C 2EKSA 1BQSA 4JM2C 4ONGH 2O5YH 1OAQL 1BJ1H 1QBLL 2A9ML 2DQJH 2V17H 5DJ6A 2VDRL 3IU3B 1NUNB 2VDPL 4YDVB 2L0DA 2IF7A 2F5BH 3KYMA 5D7IA 3AB0C 3KPMA 1QYGL 3ZKNC 2Q8BL 4NWTL 5GGVY 4CBPA 3VXOA 5HHPB 5E5UB 1OGAA 4CMMB 3DVGB 3H9YA 1PDKA 4K2UH 1CF8L 3PV7A 1ZGLP 3L3DB 1NH6A 2O93L 1T66C 4KMTL 1HZHL 4XH2B 4U1MB 3GB7B 1UXSA 3DBXB 2UZXB 1RK1B 4IMLB 1F97A 3TJHC 2V5TA 2JTDA 5ILTL 4N9OB 4M1DL 3ULSA 4FXLA 4PJAE 1IC1A 2XTJD 5JDSB 5BMFH 1OPGH 5D2NC 2J5LB 4KU1A 4KFZC 1P4BH 3FO0H 1P7KA 2RCSL 3ARFB 4CMMA 3DVGA 3NCJH 1NFIB 4M03A 3L3DA 4BH7B 4LVOC 5TFSL 1J0ZA 4Z7UE 4ZAKA 4QOKA 4U1MA 5LCVL 2XRAH 5AYUH 3GB7A 1HHHA 5DHXB 1RK1A 4IMLA 4KHTL 4P2RB 5I1HH 2XG5A 4NJAH 3HZVB 4FFWC 1IE5A 1JHTB 3O8XD 3BYYA 4NJ9L 2RR3A 5CD5C 5CUSH 4Q9CA 4JFFD 1YEJH 2CRYA 3OAZK 3H9SB 5E2WL 1NBQA 3QHZL 4M7JL 5DUBB 4BH7A 3LQAL 5IUSA 1X44A 2BY3A 3L95B 3T0DA 4M7LH 4JKLA 4ODVL 5CJXC 5EFIB 3LN9A 5KVEH 3OKEB 5FIEA 1JHTA 1MIEH 2D9CA 1JNLL 2DDQH 3ZE0F 3O0RL 4XPHH 5DXWA 1R24A 5F7LB 2APFA 3ZL4L 2ZCKL 1NAMH 4W4OC 2J2ZA 2PTUA 3ORJA 2Z92B 1F2XK 4FNLH 1KEGL 1EVUA 3SBWC 1RJLB 2R4SH 5M94B 3H9SA 1OF2B 4MS8C 5A2KH 4ERSL 4HIXH 4NBXB 5L8KB 3O6KL 1W8NA 3F12A 1KUMA 2X7LB 3L95A 4E41D 4BKLA 4OCLC 3MLWL 4GW5B 1LO2L 2F5AL 4G9FB 5CD3A 5EFIA 2YPLB 4UI2A 1QQDB 4YZFF 5AWNH 3OKEA 4L4JA 3T2OA 5IFJB 4X99B 1NCAH 3FQXB 5D1QC 4KDVA 1T1XB 1WBXB 3NGBB 5T3XD 2NXYD 2Z92A 1LEIA 4P9HC 2E7MA 5J6HB 4YHOL 3MLYL 4HEPG 1OF2A 2V2TB 2R2HB 3TIEB 3MJ9H 2N7BA 5E9DB 5E6YA 1JWSB 1NC4B 2C3WA 3HUJB 4EUPB 5HYJB 2A9MH 3EZJB 4J3XA 2XN9B 1N6VA 3C2SA 2NYYD 4JHWL 2Q6WA 1QQDA 2UY6A 4MJ5B 4U33A 2PW2B 4TUOB 3GKZA 4X99A 5IFJA 2QHLA 4NN6B 5I1KH 2N56A 5GXBB 2R23B 3FQXA 3S35L 3I6KB 4NKOB 2X4UA 4FQ1H 5FHAL 1FORL 4JPWH 2Q8BH 3SGKA 1T1XA 4NQDE 1A6UH 4G6JH 4KQ4L 4LPXA 1RV6X 1YN7B 3WDHA 5J6HA 3QO1B 4Q7DA 4JO3H 3MQIA 2V2TA 2R2HA 4GKSA 4HK0A 3TIEA 5E9DA 3CFCL 3ZHLA 1JWSA 3HUJA 4N1HB 3CK0L 4OD1H 3HR6A 1PFCA 4O58H 1CD8A 1X5KA 3MSPA 2DJSA 1YYMH 1NSNH 3VD5A 1TPXC 2X05A 1DBBL 1NLBH 1IKNA 2PTVA 2PW2A 1I75A 2UY7A 2HLAA 2DQTH 1UEYA 4JHAH 4M8QB 2R23A 2COQA 3D48R 3LD8B 3UYPA 3I6KA 1X5ZA 4NKOA 1T03L 3ARUA 5EU5A 3UPRB 2R8SL 3CIQA 2EDQA 1C5BL 3PWJB 1JN6B 2C5DC 4QRUA 5GGVH 2RCSH 1YN7A 3ZHDA 4C54A 3QO1A 3BD5A 2YD4A 5TFSH 2JJSC 3WN5A 3UZVB 5J1TC 1FHGA 4KK9D 1H3PH 1TXKA 1FFPB 4NYLB 3Q6GL 3L5XH 1J5OL 2CKBH 5GGTA 1JHKL 2NX5D 1MFAH 1LDPH 3TV3L 4ELMB 4M7ZC 5EUKB 5J0BA 2DD8L 5A3IC 1A7OH 1FC2D 1U3JA 3EYFB 4KKCC 2HYMA 3QIWD 3UPRA 2XZQL 3PWJA 3QI9D 3CSYA 4FMKA 4K8RL 3BE1L 5DC4B 3LQAH 4JO2H 1JPSH 1G7HB 4ODTH 5D7IF 1YY8B 5D72H 5L9DL 3LRGA 4P5TD 1Q0XL 1L9NA 2I9TB 2P5ED 4NYLA 1K9TA 3WFHB 2FNBA 1G7PA 3IAPA 1NGQL 5IB2B 1TETL 2XPGB 2YZ1A 1XR8A 2A83B 2HLFC 4ELMA 4OCNC 3TPKA 3ZDYF 3QEUB 4RBPH 3O3DA 1CDYA 2H8PB 3RIAK 5E8PB 2OSLB 1KEGH 3BI9X 1JGUH 1M05B 1RUMH 2MCPH 3PL6C 1UACH 4AEIH 4QHMB 2IBGA 2BRRL 2DIAA 4MLIA 2M26A 1P9MC 2IG2L 4ERSH 4PTTB 5IB1B 3TZVD 1MRCL 4Y5VC 1G7HA 4OI9A 1LO2H 5I76A 1LGVA 5AG8A 5GGRY 1ZLSH 2I9TA 4HCRL 3W9DB 2CDGB 2D0FA 5D2NE 3QCUH 1PG7L 3WFHA 3VGFA 2VABA 4HQQL 4AT6B 3ULUD 1L7IL 3V2AR 1CFVL 5IB2A 4PJCE 2XPGA 2DWDB 3OKKA 4PS4L 1FBIL 2OR7A 4M7LT 4FQCH 3QEUA 5HI5C 1FGNL 2PNDA 2H8PA 4I9WE 5E8PA 2OSLA 1M05A 3IKKA 1FG9C 3CUPB 1LP9B 4QHMA 4DUWA 4ZSOE 4LVHC 3WS6A 4PTTA 1LWRA 5IB1A 1CQKA 2NLJA 3O2DL 2FHFA 3VRJB 2IQAB 1VCAA 5ISZB 4KK5C 3FFCE 1CICA 3W9DA 5IHUL 2CDGA 4F9LC 5HYSB 4OF0A 1TNMA 4K55A 4AT6A 2X6MA 2HVKA 1YNTA 4KK6D 3CNKA 1L0XA 3WNMA 2DWDA 2IMMA 5CJQL 1P84K 4PB9H 3CLEL 5AZ2L 4XBEH 3RNKB 3LDBB 4QXWA 2CXGA 4NN7B 4CVZB 3K7UA 3CUPA 1LP9A 2WUCH 4Y88A 1Y6KR 4DWHA 4R2GB 1G9NC 2DI7A 2WNGA 3VXPA 1RZ7H 1KEML 3VRJA 8CGTA 2ICWJ 2XACC 2IQAA 4R8WH 3OJDB 5ISZA 3MXWL 1VKXB 4KROD 2ESVD 5HYSA 4N9GB 1DBBH 3UYRL 5EA0H 5B4MD 1KCVL 2EE3A 2OJZH 4LCUB 3RVTC 5I1EH 1DBKH 2BY2A 4H20H 2R4RH 5DJDB 5JXEA 4WV1C 3RNKA 1CL7L 1ZWIB 2Z31B 3T4AB 2OQJB 5SWSD 1XGRB 3ZKXB 3DMMD 4TOYL 1S7VB 1XGUB 1DLFH 4I3SL 4LRIA 5AG9A 5SWZD 1OVZA 4ZNEA 3QUXD 4L9DA 4N1EA 5HHVH 1J1PL 2FJGB 1UJ3B 3Q6GH 5EIVA 4LL9A 2BNQE 5C6WH 1CZ8L 2YBRB 1VKXA 1JHKH 4N9GA 3ZMRA 5GZNC 1URLA 2ZUWA 4LCUA 3LEYL 4KUZH 5DJDA 1S7UB 4XAWH 3UCRA 3TCXA 4XT1C 1HOCA 2XZQH 4FXKB 2ADIA 2Z31A 2IBBA 4H88H 2OQJA 5HHMD 3T4AA 1XGRA 4QHKJ 5C07E 5HYSG 1S7VA 2E27L 1XGUA 1T5WB 3JWNC 4GAYB 4Y8DC 1WAAA 1UWEL 2B0SH 4X4ME 4TNVF 2DYPA 4RGNE 1G6VK 1MFEL 1WK0A 3JWOH 5J12B 5L9DH 2ZSWB 1B4RA 2AXFB 5A2JH 1UJ3A 1L0YA 2IPKB 5BS0D 2I5YL 2YBRA 4FS0A 1NGQH 1E6OL 4KUCF 3QXWA 3P9LB 4E0RB 2RBLA 2OL3L 3HUJF 3HNTL 1N0XL 5H94B 1S7UA 15C8L 3KXFB 4FXKA 5GRUH 5IGXL 5F7EH 1OAZL 1E4JA 4J6RL 1T5WA 7FABL 1J0HA 1JWUB 1T21B 4C56A 3WE6B 1JYXA 4RMQA 3RWDB 1CE1L 4QO1A 1TJGL 2AXFA 1BFOA 4ETYA 2IPKA 2BP3A 3RDTD 1KT2B 4XNXH 1CFVH 2EEAA 3P9LA 3WIHL 4OQTL 3CVHH 4P2QB 1JPST 1IAIL 1IGFL 1XGQB 2B4CC 3ARDB 1ZT1B 3GSRB 1GHFL 4RISL 2AEWA 5H94A 4XXDA 4ZUSB 3KXFA 5C09D 5IW3A 2G60H 4POZC 4XP1H 4N0RA 1JWUA 1T21A 4RFEB 3LPWA 1GH7A 3O2DH 3S3PA 3WE6A 4N0UB 3T65A 3RWDA 4JFYB 4Y2DC 4AYFA 4FABL 1IGMH 3UPCA 5D5MB 3JWOC 4KJQC 4KMQA 4Q58C 5D7KE 1DQLL 3UTTE 2PXYD 2BVOB 3MCG1 4NWUL 2PF6A 4Z7NE 3QG7L 5CJQH 5DDHB 4Z7WA 1XGQA 1IAIM 1ZV5A 2E9WA 2OI9B 1ZT1A 3ARDA 4KV5E 3GSRA 5CP7B 3IKCB 4HMEA 1MH5A 3ZTJG 1UCTA 4NQEE 1T1WB 3RWHB 1GGTA 3WIFB 4ZOCA 1MLCA 3NABL 4LCWD 4RFEA 4ELMF 3DETC 4N0UA 1BBJB 1NGYB 1SJXA 4JFYA 4Z18A 1FO0L 3VI3F 2ZUQB 2PYEE 5D5MA 3MXWH 2KDGA 3REWA 4AENB 4U6YB 4WFHD 3MV11 1BEYL 2VLME 2BVOA 4FRWA 1NLDL 1TITA 1B3JA 5EU6D 3PGFH 5DDHA 1FO0A 3GMMB 3BOVA 3SKMB 1CI5A 1A6WH 2E7CA 2D2OA 2XNAB 5CP7A 5LBSL 1BP3B 2NY3C 3IKCA 4OLUL 4LU5H 4I3SH 3DHMA 1T1WA 4HT1L 5JQ6L 3WIFA 1MCDA 4L4TD 2MNUA 2IFFL 5JTWA 5LVEA 4LEOA 2FECL 5C6PB 5MP6L 4HS3B 1KN2H 3OZ9H 5GIRB 5GS0C 1IGCL 3TA3B 1YEEL 4U6YA 4Y5XB 3A6BL 4UT7L 3CU1A 1AQKH 4GKOA 4XCEB 2P44B 2Y4SA 5C0AD 1CLZH 4GXUM 2E9JA 5BCAA 3VXUB 3LEYH 5E1HB 2QR0B 3GMMA 3QDGE 4MNQE 3WHE1 3WHE0 3ARBB 5E03A 5DRXA 4OD2B 4YHIB 1TQBC 2XNAA 3MLVH 5HDQH 1L7TH 3VGDA 4DCQB 1NC2B 4M6AA 2HKFL 1J0KA 5FO8B 1MFEH 3HE6D 1KIUA 4NHUB 2DQFB 1KIPA 4XC1H 1UZ6E 3H8NA 4HS3A 5GIRA 1E6OH 4J3VA 4Y5XA 4R9HA 4XMLH 5HHXL 4DGYL 1QD0A 4HXBH 1GXEA 4EN3C 4XCEA 2OL3H 4M5ZL 5L7XH 3V52L 5T1DL 4J8RB 4N0FB 2IAND 3IAQA 1N0XH 4G6KL 5E8OB 1BFTA 4FQXD 1YNKH 1T7XA 3ARBA 4X9GA 1NL0L 4OD2A 4YHIA 4E9LA 3V6OC 4DCQA 5DLML 4J6RH 1CT8A 2JJTA 4GG6E 1BF2A 2DQFA 5HGGS 1A9EA 1CFNB 3TCLB 4DK6A 2P7TB 1KJ3L 2LTQC 2OP4L 4WFEE 4HAFA 3OPZL 3IT8D 1OP3H 4AJ0A 2EDHA 2RFXA 4YXHH 3ZYIA 2OR8A 3WIHH 4KAQL 4OQTH 1JWMB 1Q72L 2FX7H 4JANB 4J8RA 2CGRL 4RISH 2D9QB 2F53D 3RIFK 3VD7A 4X80H 3ZYJA 3BPCB 4LAJH 5C0CD 4ZXBA 2P24B 5C0GB 2R0WL 4XNZB 1K3ZA 4L9LC 2A6DA 3CCHB 5EBLB 4Y19D 5IJKC 4FABH 1CFNA 4MXVE 5HGAB 3TCLA 5LGHL 4HH8A 2EC9T 4HS6B 1LO3H 2P7TA 4YHZH 5I16A 1DBJL 5JMRA 1QLEH 3F8UB 2PCPB 4NWUH 3MRMB 1KTDB 1BVKB 1ODAA 5IV2A 1JYNA 1JMZA 4X5LA 1F90L 3NIFE 4HKXB 4M00A 3E6HA 2DB8A 4N8PA 5KANI 2ZCHL 4XC3L 2AXGB 3BPCA 3STLA 2QQKH 2P24A 5C0GA 1PZUB 4OZFH 4ZAKD 4QOKD 4DOHE 1EFQA 3T0WA 4KVNH 3FQUA 3W0WB 3CCHA 5EBLA 1LILA 3GBNH 5GRXG 2ATKB 3RUGE 4ZS6D 4PRPB 5F7WC 5HGAA 3EYVB 4HS6A 2P5WD 3UO1H 4CVWA 1EX0A 2V9RA 1YY9D 3MRMA 1C7SA 4AQOA 4EQ2A 3WCYA 1VFBB 3O8XC 4HKXA 2B5IC 3E8UL 3X3FL 5C0JB 1JPTL 1JF6A 1F58H 1UQSA 1KC5L 3KG5A 2AXGA 2H6PB 5DMGC 2DLGA 5JXAL 3JUZA 3U6RB 1F45A 1LD9A 1A1MB 4Z8FL 1WIPA 1RUQH 3L3HB 4P46D 3W0WA 1B4JL 1MRDH 3BZEA 3VGAB 5B3JE 2ATKA 2NY2C 4PRPA 2VDNL 3EYVA 3JVGC 4WWKB 1YEEH 4HC1L 5JOPE 4M62L 1IC7H 4UT7H 4FQ2H 5D7JC 5B8CA 1VFBA 5DHVB 5F72S 4OLVL 1I8LC 5BJTA 1W72L 4HW6A 1QSVA 2W92A 3DUSB 1YJDC 5C0JA 2DQUH 3GRWA 5ESVB 1PG7X 3HE7D 3VXRA 4EI5D 4Q6IB 1EH9A 3PWNB 3QPQD 5ALCH 1N5AB 2EE9A 1T04B 4U6TA 1A1MA 3L6FB 3S98A 5KJRH 4Z7WF 4D0DB 2YKLL 2P45B 1U0QA 2X2YA 3OKNB 3QIUA 5BVJB 5KSBE 4HUWB 2ARJQ 1Z6JT 2R0KH 4WWKA 3PABA 1WF5A 4RMTA 1Z2KA 4WW1B 4U2YA 2PN5A 1NGPH 1PJ9A 1JP5A 2W38A 3JBG7 2P4AB 3MACH 5DHVA 4F7PB 3BZ4B 3T77B 2QSVA 3D85D 3DUSA 3KDMA 1RU9L 5ESVA 3NPSB 2X4SB 2OTWB 1BVLB 4Q6IA 3PWNA 5GGSY 3THML 2B1HL 1T04A 2J7LA 5CGTA 2BOCB 1A3QA 3L6FA 4W68A 4LIQL 4OF8A 2EH8H 3KWWB 4YHLL 3GMQA 4JAMA 1KENL 1KJ3H 2OP4H 4AM0B 3OKNA 4HUWA 2C3GA 2NYYC 5I73B 1OARH 2OCFD 4W81A 4TTDD 4WW1A 4HLZH 1IZJA 5CZXD 2MKWA 3RX7A 4KHXL 4OSUH 1Q8MA 4DN4L 3T77A 4KUCD 4UT9L 2V2WB 2AS5M 2EYSA 4YX2H 1ZSDB 4BZ1H 4APQB 5IBUB 5BQ7A 5DMIL 1S7WB 2JJWA 5I9QB 3ZDZE 1CVRA 1TDQA 5IBLC 4U1KB 2V5RA 4D8PB 2BOCA 2HFFB 3VXNB 4XP4L 4L8DB 4AM0A 3WLBB 4G5ZL 1I3GH 5JHDE 4KTYA 1AD9A 2VJXA 5I1DB 1RVFH 5TF0A 1IC5H 2Y07L 5CMAB 4NRXB 3VFVB 5C08D 3UAJD 3O3UN 3AM8A 4M7KL 3BGFC 5KSUA 2V2WA 4RAUB 3TT3H 5SX5K 1JZ4A 1ZSDA 4APQA 3QCVL 2UZIH 5EBWA 4X7SH 5JNYB 1S7WA 3GJFK 3RI5F 4ZFZB 3RX5A 3RWCA 1C1EH 1FH5H 4U1KA 1LEGA 2L7UA 4HWUA 4D8PA 3JV5A 4MNGB 2HFFA 3BDXA 3VXNA 4PRNB 2BHYA 1U8HB 3MRFA 4F15B 2DKSA 3WLBA 1G9MC 5D8JL 4QGTA 1D5IL 4JRWA 5DD1H 4CU6A 2UVFA 5JIPA 4Y5YC 5CMAA 4NRXA 3V6FA 3X3FH 4L3EB 4YGVB 1IJ9A 4NO0D 4EDWH 1KC5H 1EMTH 2Z9TA 1DE4B 2AV1B 3FJTA 4B7LA 3QI9C 5E2UL 5E6ZA 5JNYA 5FYLL 4Z8FH 1PSKH 4ZPTB 3QIBC 5KVFL 4WTZA 3PWLA 1B4JH 2DQDL 1DQMH 4ZTOL 4LFHG 4X0KB 3D6GA 4P5TC 4K8RD 3QEQD 4MNGA 3VDAA 2VDNH 1MCFA 4PRNA 1U8HA 4IOFC 1A4JB 2A0LD 3EFDL 3HN3A 3IRZA 4GRLB 4M62H 3T0EC 5FOJA 4UT6L 4RFNC 4F33A 1F3DJ 4FTVE 1OSZB 2N7AA 4JDZB 4KJYA 4YGVA 1EHNA 3ILQD 2BVYA 2OXHA 3SDCC 4UTAH 4W6WB 1DE4A 4PJXB 2AV1A 4L3CB 3U0WL 3W81A 4UILH 5TF1L 2M8XA 3S4SB 4OGAC 2V2XA 4HWEL 4ZPTA 9CGTA 1OM3H 1CGWA 3KJ6H 3PGDB 4X0KA 3EO9L 4OLWH 1X5GA 2XTJE 1RFDL 1A4JA 2YA0A 3X13B 4Z5RB 4XPAL 1WT5C 3ULUC 1SMOA 2F19H 4PLOB 1F42A 3Q6FA 3H3PL 4WTZG 3NCEB 3B9KB 2CMRH 4HJGB 4DUVA 1DFBL 2BC4B 5F97E 5CSGA 3LKOB 1FZOB 2L7JA 5F8RC 3B8YA 3C8KB 3HTLX 4PJXA 2BFVL 3THMH 5I1CH 1H9VA 2UWEF 4J1UA 4L3CA 4GKNB 4Z0XA 4JFEA 1TZHB 3KS0J 1DQJB 1NMCC 3S4SA 4OGZA 5F21B 4MA8H 4LIQH 1CICD 1CG9B 5FM5M 3O6FC 3HPJA 3ARRA 4BQCA 3K8KA 3BRFA 1KXTB 2HH0H 5JA8B 1IFHH 4Z5RA 4PB0L 5A1AA 3X13A 1JYWA 5T3ZL 1U91B 4KK6C 1N5YL 4KHXH 3AVEA 1HSAB 3B9KA 4DN4H 4HJGA 2BC4A 4XNMB 3IDMB 4LLQA 3BAEL 4UNVA 3LKOA 1FZOA 3SJVB 3C5ZB 1TQCC 2QEJA 4TQEH 1I9RH 3C8KA 4KJWD 3L9RB 5E95B 2DQIH 1TZHA 1RD6A 1DQJA 1PYWB 1AHWB 3QFJB 4JZOB 3DOSA 2CDFB 4HWBL 4QXTB 1JYVA 2E5EA 5DMYA 3GKWL 1Y18B 4YLQT 1CG9A 1BAFL 2HT3D 4Q9RL 1T20B 2AEPL 4Y4HB 4PLKD 2R2CA 2MPAH 4OF3A 1AP2B 1EA9C 3U9PL 5EU7C 1U91A 4XPBH 5B4MC 3S4SG 1JMXA 2Y07H 5JXED 1X6LA 3VFSB 4LP4A 3OR7B 2DM7A 4H8WL 5E0QA 3G04B 1UM5H 4XNMA 3U1SL 3DX9B 1LO0L 3FKUS 3ZE1E 4BQ9A 3F7YB 3FB6B 3PWPB 3C5ZA 2RGSA 2R0LL 1P7QB 4HK3J 1W0YT 1AHWA 3ME0A 3QUXC 4JZOA 2BXZA 3V0WH 5JR1H 2CDFA 3KPOB 3BP4A 4QXTA 5FK9B 1PX4A 3M8OH 1W0WA 1Y18A 4BSJA 1T20A 4Y4HA 1FSKB 5D8JH 1FL6A 5FGCB 5E2TH 3K46A 4PREB 5FA3B 5T3XE 3B8SA 4Z7VB 2VUYA 3OKLB 3AU1B 4HXAL 3S9DB 2K9UA 5I8CB 2EYTB 2H2SD 3OR7A 1E27B 4OCXH 3GHEH 4ODXB 4YEFA 3G04A 1V7NL 3DX9A 3CFBB 5I66B 3F7YA 2DYPD 2VL4A 2Y5TB 2BJML 2AJUL 5H37H 4YDIH 1WLHA 3MLPA 5DVMA 5E2UH 1OSPH 1P7QA 2X9WA 4Q0XL 1GGCL 3KPOA 1AIFB 2X9XA 35C8L 5E5RB 5FK9A 3WEXA 4U6VL 4FFZL 3RL1A 1PBYA 4UB0L 1HXYA 1HKLH 3TBVB 4UV7L 3T2PA 4Z7VA 3OKLA 3OAUL 3AU1A 2EYTA 1E27A 2DICA 4ODXA 1YA5A 5I74C 3CFBA 5I18L 1JJUA 1J87A 4ZMAT 2Y5TA 4C56D 3LS5H 4NZUH 4XCFH 3EJYD 2ADFH 2XKNB 1NEZB 3GJEB 3HMXL 3NN8B 5TPWH 2GUOB 3HG1B 3RDTC 5CEZD 4R4FL 5DQ9B 3TBVA 3SCMA 1F4YL 1DP0A 1RHFA 5FCUL 1DFBH 2HT2C 4PGCB 5DURB 3FB5B 4UV4L 3LKSB 2H9GB 1YC8A 1ZEAH 5E2VL 1CFTA 5TE7L 4KRNA 4XCCL 5D93B 5T33L 3BGAA 5JW3H 2NX5E 1I7TB 5C0ND 2VLLB 1DVFB 1QR4A 3WNKA 3GJEA 3NN8A 3HZMA 2CSPA 4JQXA 2GUOA 1W8OA 2NY6D 4HBCH 4ALAL 1RUKL 4PB0H 5CZVH 1FYHB 3I6GB 4V1DB 5T5FL 5IHLB 4MQSB 2HRPH 1PG7W 5I30H 2OZ4A 5BXFB 4JN1L 4U0QB 1KIQB 2QSQA 3RWFB 4XGZB 2WP3O 4Z7UB 4O5LL 1NANI 2UZYB 3FB5A 4D9QD 3IVKB 3LKSA 3QUZA 1I1YB 2IH3B 4I77H 3GSQB 3CFKB 2NZ9C 4C59B 3D9AL 1U95A 4ISVB 5GJTL 2JIXB 5IVNA 2CR3A 2P5EE 2NY5L 4QRTB 5I1JH 3HZKB 5HTSA 4RA0C 2VZSA 3NFNB 4MX7B 1MJ7H 3GSNH 1S5HB 1WBZA 3OKDB 1I7TA 4K3HA 4WY7H 1DVFA 4PJAA 2WANA 4JCLA 3EYSH 5E8NA 3H42H 4F3FB 1KB5B 5LAXB 1J8KA 4DKDC 1ETZB 1Q9KB 5K9JH 1TCMA 2LE9A 4H8WH 1KIQA 3VFNA 1AC0A 1V3LA 2B39A 4Z7UA 4RMUA 3VWKB 1JRHL 3IVKA 1I1YA 1A14L 3BPNC 4BFBD 4ISVA 3VRLE 2JIXA 2R0LH 1ZAGA 2QSCL 4QRTA 5C9KA 2DQEH 4MX7A 1S5HA 3OKDA 2APWA 4XNQA 1KTLB 4KZDH 2Z93A 4MD4B 1XZ0A 1QFWL 1F02I 1Q0YL 1KB5A 4FQIL 2GSIB 3QDMB 1ETZA 1FDLH 4HGWA 2EH7H 1UG9A 1A47A 1LNUB 4EJ1C 1CK0H 4YXKL 2FIKB 4JFQB 2AJUH 3UBXB 1RUAL 1XMWA 5ALBH 1A2YB 2IADB 3C6LD 1VPOL 3QBTB 3HE6C 4D9LL 3IDUA 5TE4H 1GGCH 3LV3B 4AIZA 4K71B 1OCWL 3V9FA 4Z95L 2CO6B 1ZTXL 1KTLA 2VXVL 4MD4A 4OV5B 3TH3T 1DUZA 3LN4A 4ZQKB 1QFWM 5F96H 5IT2H 5IP4A 5ITBH 3C60A 4UBDC 1CXLA 1MHPL 1Q9WB 1A3LL 2GSIA 3CDFA 4LGPB 4U1JB 4XXCC 4YQXL 5F88B 1RPQA 3V4UH 4OZ4B 4YEEA 1LNUA 2B2XH 5F3BB 2Z0BA 2FIKA 3CH1B 3UBXA 3MXVL 1CR9H 2IADA 1S9YB 2ESVE 1T2QH 3HMXH 3LV3A 1EFXA 2FDBP 5K9KB 2A6JB 1HE7A 4RMRA 1J1XL 3DGCR 5CAYB 4ZFOL 4R4FH 1R3IH 4P59H 5F9WC 4K7PX 2VXSH 4OV5A 1IILE 4ZQKA 1N8ZB 5SWSE 4PBXA 3T3PF 4OJFL 1YEDB 1CXHA 4NRZB 4U1JA 4CADB 4S11A 5H35B 5IF0B 3ZLQC 1XF3B 1KJ2B 4ZXBD 3HS0B 4OZ4A 3O81A 1CIUA 1VADB 4ZFOA 2EEBA 3R8BB 4DN3L 1ONQB 3CH1A 2R9HC 3UC0L 2GYSA 3U36B 4P23D 1Q1JH 1S9YA 5KSAD 2O5ZH 4OM0L 2CQVA 2XQBH 5DJXA 2P43B 3VD9A 1HIMH 1A6TA 4RFOL 3S34H 4ALAH 5C0RH 5K9KA 2A6JA 3ULVH 2IBZX 4NQDA 3UBXG 1PZ5B 3M45A 2W60B 1IT9H 4QRQB 1DN0A 5HHME 1N8ZA 3MRDB 1YEDA 2A9NL 4NUJA 2DLTA 2EO1A 3BN3B 4R4ND 1SQ2N 2ZPKH 3VH8B 5I19L 5H35A 5IF0A 1K4DB 1KJ2A 3D39E 3HS0A 3QQ9C 1VADA 4M9PA 1F4AA 1JFQL 3U83A 1J12A 5GJTH 1ONQA 2ENSA 2NNAB 3D25B 1X7QB 4ZAKC 5JW4N 2VLJB 5BS0E 1JUFB 3U36A 2E3VA 4QTIL 3T2NL 4Z7VF 4X4YB 4LPYA 5DTFB 3NPZB 3W9EB 5JHLH 3GDBA 4OCSL 3OKOB 2HN7B 3FQWB 4X6DB 1PZ5A 3BEWA 1YY9C 2W60A 4QRQA 1MRFL 4Y4FB 1HK6A 3MRDA 1AE6H 1UCBL 5F7KC 2MTPA 3CSGA 2J5LC 3EYQC 5DEFB 1U8MA 4S1RL 1G0DA 2D7MA 3VH8A 2EIBA 1JF1A 1JRHH 4TYUA 1K4DA 5KTEH 4S10A 3LEXB 2VQ1B 1A14H 3WL9A 2F8VA 3AB0B 4MD5B 5SX4I 2NNAA 4JB9H 1X7QA 5CINL 1JUFA 1TJHH 1X6NA 3I50L 1LVEA 4X4YA 5MEPB 3MLSH 5D1XB 2XA8H 3MLZH 5DTFA 2YWYA 1CDIA 1PLGL 4UMGA 4MQXD 4ORZC 3O11A 1I1FB 3FQWA 1Q0YH 5HI4D 5C09E 1MUJB 2V6HA 4Y4FA 4NO3B 2XKSA 2J6EA 2VLKD 5DEFA 3VXRD 5JOEA 5F7MC 3LEXA 2VQ1A 4EUPH 3SPVA 4LOUC 4A6YL 4M43H 1HCFX 3MMEB 5IQ7H 5D2NB 1ZXQA 4D9LH 2HJKB 1HNGA 4PJCB 3QRGH 3QIUD 3QH3B 3VH8G 1TVBB 3QJHB 1RAMA 4V2BA 5D1XA 2WIIB 3JWDH 4YZFE 3RJDA 4UINH 4U1LB 4YK4C 1I1FA 2WBJD 3QSKB 5DGRA 3WIIL 4F58L 4ZSOB 1J11A 1MUJA 5EZJB 1U8NB 4NO3A 2AJXH 2WUBH 4J4PD 4L1DA 4Y7MA 2RQ8A 4LCWE 1OL0A 4PJAF 2CXKA 4MB5A 1EO7A 1IZKA 3FFCB 3MXVH 4PJFF 5F7HA 3MMEA 3X3GL 5D2NA 3VG9C 3IFNH 1G7LB 4WFHE 3S5LB 4NQSB 5ID0B 2HJKA 1LE9B 1WZ1L 4PJCA 2NY4B 4K23L 5GGTH 4E42B 5B39B 4CJ1A 4MDJB 3QH3A 4XNYH 5EU6E 4RZCB 4RGMB 1JZ3A 1TVHB 4TVPH 2WIIA 4Z7UF 4JRXB 5FA4B 4K9EL 3SQBA 1M4KA 4TTDC 4Q9BA 4U1LA 3V4PH 1NMAH 1V3JA 1SEQL 1T0MB 4ZSOA 2FGWL 5CZXC 1R6VA 3HAEA 4G43B 5EZJA 1IMHC 3SGKC 1H8NA 3NGBC 2MMXA 4NSKB 4WDIB 1EXUB 2WQ8A 5T1KD 2EKJA 3BKML 1QPPA 3FFCA 4KXZH 3UC0H 3LPGA 5BVPH 5ID0A 3S5LA 4NQSA 1OTUD 1LE9A 5M95B 4S1QL 3QPXH 4I3RH 5B39A 4E42A 3JTTA 4MDJA 5CIPA 2LU7A 5C0AE 3S8WA 3HI5H 5J3HC 2XKUA 4NC1E 5L2KE 1TVHA 3GEWB 1IKNC 4YUEH 3RWJB 2OK0L 3JWDC 4WHYG 1I1AB 5EUOE 4LFHD 4NP4L 3DV6A 2XWTB 2W0FB 4LGRB 4LQFL 4NSKA 3UAJC 3ZE2F 1EXUA 1WEJL 1NDMB 4IRJD 3CDYA 5GISH 1Q9OB 2BNQB 4OB5L 3WO4B 1U6AH 3WN5C 5FEBA 1R0AL 3T2NH 3HAEG 4YDJB 4KRMB 1JTTA 1E6JL 4WI3A 2Z4QB 5DJYB 4C83A 4LQ1A 1YEGH 1C16B 1FFOA 2VN7A 3CXHJ 3BRGC 4RRPA 2AEQH 2F74B 1VA9A 5C07B 1UCBH 1I1AA 3LD8C 3S5LG 4U0RB 4RGNB 1KBGH 5B39G 1EZVY 3M17B 2W0FA 1F3DH 3G6JE 4AEEA 3LEVH 1EAPA 3OF6A 3FONB 4UTBL 5DWUH 1NDMA 2F8XC 2PR4L 1Q9OA 2BNQA 3PJSA 1PKQE 3SE4A 2A77H 5CINH 5ESQA 5GRWA 5E08H 5EOCJ 1CU4L 4ZUTB 4YDJA 4CMHB 3MGAA 3L1OL 4MXWL 1PLGH 5FYLD 2A0LC 2DAVA 4M6OL 3GHBL 2F53E 1KCKA 2Y36L 4WRLA 4X9BA 2F74A 3RPKA 5C07A 4EEEA 5KZCD 5C0CE 4B50A 4HD9A 4R26L 4X4MA 3ZDYE 4KC3B 4KPHL 1NCWH 5E99L 3ILQC 2LVEA 3M17A 1BFVH 3IU4L 4Y19E 4AMKL 1DCLA 5DYOA 3FONA 3WMSA 4RRPG 3U7WH 5CJOH 2DKMA 5TDPB 3UTSB 3VXSB 3RZWA 3WXVH 5EULV 4JPKL 1DN2A 1KYOK 4YFLI 3KS0H 4YDLC 1AXTL 1OD7A 5J7CC 1ZLVK 5F6HI 4R90H 5KOMC 3OB8A 4XZUB 1VEMA 1SYVB 2XZAL 3WIIH 2R29L 3ARGB 2VE6B 3G08B 4G8GB 1T4KB 2XICA 2AV7B 2MCG1 4AZ8A 4XVSH 5C7XL 3MNZB 4JFED 4XNUL 3WS6C 1YUHB 2EYRA 2ZKHL 3DNKA 3X3GH 2P5WE 2VC2L 4BA8A 2DI9A 1CLOL 2ED7A 5TDPA 4G8FB 2ZOKA 4U6XB 1CICC 4DAGL 1QLRA 1HHGB 3X12B 2YSSB 1A1NB 1BQHB 1A1OA 4RGOL 1SYVA 1QO3B 2FATL 4NQEB 1SEQH 4Z0BH 3ARGA 3RGVB 5L0QC 5D2LE 3VFGH 3P3YA 1CDBA 1C5CL 4HMDA 1NBYA 3RVUC 3SGEI 2AV7A 5T3ZD 1JNJA 1CQYA 3MRRB 1F2QA 1IC4H 1QA9B 8FABB 4XX1E 2PYEB 3BKMH 1YUHA 5I15L 4KJWC 1MEXH 2AK1L 5D71L 3UTTA 4F2MB 4NUGH 5T1LB 4RNRB 3PL6B 4G8FA 1QG3A 5EH1A 4LRNL 1HQ4B 4U6XA 1NFKA 5DZOA 3PP3H 1KB9J 1HHGA 2YSSA 1U8OB 3STBA 2HT3C 2Y72A 1O7SA 2IQ9H 3X12A 1ACZA 1A1NA 1BQHA 3U9UB 4URTB 4X9HA 5DK3A 5EC1A 2OK0H 3NTCL 3PHOB 1OAYL 1RZFL 5E00B 3DTXB 5C3LD 3TVMB 1QO3A 1LEKB 4LCYB 4NQEA 5JXEC 3RGVA 3V6ZA 3MJGX 1QSEE 2D7NA 3SDAB 4MXQC 3ROLA 3P11L 4JY5H 4LQFH 2YMXL 4P3CL 1RQ5A 2YD7A 3MRRA 1WEJH 4LRIC 5FM4A 1QA9A 8FABA 2VQUA 5CGYD 1RZKH 2PYEA 1XF4B 4R2GC 1IKFH 1IAKA 4AK1A 4WHDA 3W2DH 5T1LA 3Q5TA 1E6JH 3S37L 3TIDB 5EWIH 3WUWB 1HQ4A 4QRPB 5A2IH 4LVHB 5E1AB 1U8OA 4MNQB 1OB1A 1GZPA 3D2UD 3U9UA 3HC4L 3FO9B 4RQQB 4O2FB 3IDNB 1ADQA 3PHOA 1INEL 3NZHH 3DTXA 1YECH 3TVMA 3BWAA 4LCYA 2UYLB 3BKJH 1LEKA 2R69H 2Z31C 3SDAA 3H2WA 1EGJL 4PJCF 1SY6L 3ZKXC 4L8SB 4WI5A 3FQRA 4HUVB 1SVCP 3TC9A 1BQHG 4UUJB 3DX8B 4UNUA 2A1WL 1MCHA 1XF4A 1MLBB 3IFLH 1BIHA 1P2CB 3WFEH 4MD0A 1SY6A 3RAJH 1UJ3C 3TIDA 3WUWA 5E1AA 2VO5A 25C8H 3VXQA 2K7PA 3QDGA 5J1SC 4M6OH 1MWAL 3A67L 3GHBH 3W11D 1KLUB 3A0OA 4RQQA 3FO9A 4O2FA 4PP2A 3IDNA 1MHEA 3UYOD 2UYLA 4FQJL 2EIDA 3O9WB 1KCSL 4GG6B 2VWEE 4L8SA 3IU4H 4HUVA 4P4RB 4F8QA 1I9EA 1T0NA 5FXCH 3NCYS 1Z0NA 4UUJA 4LCIL 3VWJD 4FOMA 5L88L 2NTFB 4G3YL 1MLBA 5AAWA 4PJ7E 1ZA3A 5J12C 2AJSL 5E6ID 1P2CA 3G6DL 1CXKA 3O3AB 2VDLH 4S1SL 1A6PA 3B9DA 4Q2ZB 4X7EC 3C6SB 3SCMD 3KJ4C 1KLUA 4GXVL 5C08E 2FO1A 1S3KH 4OGXH 3FT4B 1A22B 4Y89A 5IB3B 1A5FL 5L6YL 2X4OA 3O9WA 4PRID 3WUWG 4GG6A 4KTDL 2XZCH 2L4OA 1B90A 5ANMB 5EPMB 4OCRL 4P4RA 4XNUH 3F58H 3PHSA 1HINH 4N0YL 3S3JA 4ZUWA 1H3WM 1MFDH 3JV4B 3P0VL 2H3NB 2NTFA 3H9HA 1MREH 4WO4B 4X8XA 4DAGH 5HJ3A 3AXLA 3O3AA 1MQKH 3QFDB 1HSBA 4KRPB 4UDUA 4XMPH 4TULL 3CU7A 4Q2ZA 4OLZH 1JGVH 1GIGL 4UQ3B 3RA7L 4LEXH 4M6ML 3ARDC 4DOHB 2GCYB 3SQOH 3NA9L 2A2QT 3T0BA 2K1MA 3QUZD 5HPOA 1KLFA 3RUGB 3QZWB 5EPMA 1KXQE 4JM4H 5HGBB 1S7RB 1QBMH 3OSKA 3QEQE 1I4FB 3JV4A 2H3NA 5JOFB 4NKMB 2BDNL 5F1OB 3B2UC 4WO4A 5I8OL 2DKUA 1DDHA 1IGYB 4TSAL 1EIBA 3QFDA 3T0XA 3SDXE 4PJ5B 1RZJL 1PVHA 1CWVA 4UQ3A 4GUPB 3WNPA 1NUDA 2GCYA 4JFDB 1CDHA 1I85A 4JQIL 1ZVHA 3MRNB 3M07A 4I0CC 3L5WA 3RUGA 3QZWA 5HGBA 1S7RA 4BZ2H 4HPYH 4MHHG 5GS2H 1BPVA 2EIZB 4QHLB 5DC9B 4NKMA 5JOFA 4NBYB 3S37H 4K7PY 3BZFB 2ZUQC 1XIWA 3BSZL 1AGDB 1IGYA 1RURH 4IHOB 5J56B 2GFBB 3WUZA 2DMCA 4XHJD 3ZKQD 2EDDA 4Y2DB 1INQA 5HHQB 1BX2B 4GUPA 5MEOB 2FCBA 1FFRA 5CEXA 2DI8A 5HGDA 2X1OA 4GMTL 3WDJA 5J6GB 5IBTH 4OTXH 3WS3B 1WZKA 2ED8A 4WEBL 2D7PA 3DSFH 4JKPL 4WEMB 2C1OA 5JZ7C 1EK3A 2AI0L 4QHLA 3MR9B 4X4XB 1UB6B 3ARVA 1AGDA 1T0PB 3GFUA 1WTGT 2IAMA 4IHOA 1MWAH 3A67H 3C2AL 3QNZA 3QZWG 3C60D 4MCZB 1YNLH 5BV7L 5ICXB 1F6AB 1GC1L 4I13B 2QLVB 2X1PA 4O2EA 5HHQA 5I8EB 4YIQA 5DVKA 1QVOB 1GGBL 3C9NB 5MEOA 3ES6B 3ARBC 3E3QC 3TJEL 5F89B 3L7FB 3OTTA 4Z7NF 1QFUH 3WS3A 3SGJA 3V7AE 2JJTC 1FC1A 4CRPA 1FNGA 3CDGA 4KV5F 5IMLB 4XBPB 5KSBA 3PP4L 5LWYL 4NDMB 3MCLL 5GPRA 1EFXD 2ZUYA 5LKNA 3GBLA 3MR9A 4JR9L 1OAUL 4MAYB 3MOBL 5IKCB 4R96B 1UB6A 1MFCH 5AZEH 5KN5B 4LNVA 3TO2A 3OGOE 4G7YH 3QO0B 4P48A 4MCZA 5HVGB 4X6BB 5ICXA 1F6AA 1Y0LB 1IQWH 4L8BA 4OBSA 3T0AA 4PP1D 5KBNC 1YQ2A 3QUMB 1QVOA 3C9NA 1V3KA 3ES6A 4PY8J 5F89A 1A6AB 4X98B 4ZXBC 2A73A 2Q7YB 1ZK9A 2EDOA 5EZOL 1OTSD 1FNLA 2R15A 4GRMB 5IMLA 5JHDB 4JKMA 3HPLB 4P23C 2EICA 3DO3A 2XXMB 4O00A 4MAYA 4PRBB 4Q97A 5IKCA 4R96A 4QRRE 4NQDD 1FAKT 4S0SD 4XWGL 4TULH 4D9RD 5KN5A 5A40E 3S96B 1I7RB 4K3GA 4LSDA 5DD5L 4XWOC 1EV2E 3QO0A 4OKVB 3U4EA 1SMAA 1X5AA 3GRWH 4X6BA 1Y0LA 4M6MH 1I9JH 2XWJB 4PV9B 2VZUA 3QUMA 4HWNA 3N50A 1JGEB 3H7LA 3WJLC 3MLXH 1A6AA 2DBLH 1GGIH 2Q7YA 4XNZC 4PLJD 3WFBH 3SY0A 2FEDC 3G5XB 4GRMA 5JHDA 5JW4R 5BRZB 2AK4B 2BZDA 4ZOBA 1HXMB 3HPLA 1KPRB 4DQOL 4PRBA 1N64L 1DEEB 4OD3L 3BZDA 3EFFA 1RHHB 2P8LB 2ICWI 1RZJH 1UZ6F 1I7RA 4OKVA 5D70H 4X5WB 3RIAF 1MCWW 1UADC 2DIBA 1IBGL 4PV9A 1X5LA 2D3VA 2LTQB 4KDWA 3TH4T 2QQNH 3K1KC 4JY6B 3P0YL 3CH8A 1MQ8A 5DSCA 1G6RB 2HT4D 2FBJL 2O5XH 3VDBA 1ORSB 1N7ML 2J12B 3UJJL 4GAJH 1HXMA 1A7QL 3LKRB 4TRPH 4KI1A 2JB6A 3BSZH 3JTSA 1U8KB 1KPRA 4GOSA 4EIGB 4F7EA 2P8LA 3MRQA 4G7VL 4MZ2A 1HDMB 4F7TB 5B8CC 4NZTH 5L2JB 4TPRH 5HI4C 1J88A 4X5WA 3SDYL 1X5XA 4FZEH 1NPUA 4JKKA 2NY1D 3RU8L 1QBBA 2BX5A 4JY6A 3OG6B 4OI8A 1MIMH 5C0BE 4AQ1B 4XI5D 3G5ZB 2XTJB 1ZHNA 4QHKI 1AGFB 2ZJSL 3C5SA 4ODBD 4K3DL 3QNYB 1TJIL 4LSPL 4Z7WE 3QIUC 4FTVA 4K7PH 1U8KA 4FQHB 4WWKC 3C2AH 2UUDH 4MXVF 5EOTA 1GC1H 4XBGB 1HDMA 1DZBA 2WBJC 4D9QE 4G8IA 1DQQA 5CBEA 5L2JA 3RWGB 4HWZB 4D3CL 1KCRL 2A6IB 5KG9B 3NIFF 2HVJB 4Q6IC 3NAAL 3F6LA 3L3JB 3O8XB 1CE6B 2B5IB 5SV4A 4JFFB 1AGFA 3TBSB 3WNOA 3MOBH 2ICCA 5AD0B 2QL1A 4FQHA 4DKFL 5FUCC 2YS4A 4ZS7L 3C8DA 2XYCA 4YH6A 2MFNA 3RUGF 4OZIB 3WNLA 4XBGA 3OB0H 2HG5B 2YPVH 4Z78B 1INDL 3RWGA 5IW1B 4PY7B 3FHQA 1HYSD 2FR4B 1AGEA 5KG9A 3HI1B 3LRHA 2HVJA 1TTGA 1E0OB 3PWVB 5EU3B 3O8XA 2PUQT 1CE6A 3UTPD 2AKRB 5DRNB 4BUHA 2AJVH 1FCGA 1MAMH 1UXWB 3TBSA 2CLZB 2DTMH 1FYTE 2CKNA 4BSVB 2VISB 1XF2B 5I73C 2F58H 5IM7B 4KRLB 5DUPH 5B3JF 4YBLB 3F7VB 4E41B 2FL5A 1HCVA 3MGTB 1SHMA 1U8JB 5I8KL 1VGEH 2HG5A 3ROOB 5FF6B 2JELL 1D5MB 4LSSL 4M5YL 1TZIA 3RL2B 2VUOA 3DYMA 1UC6A 1AGCB 3AM8C 4HDIA 4BFIB 4PY7A 2FR4A 3HI1A 4APQC 2I60H 4IRJC 5I9QC 3MOAL 5ETUB 2AKRA 3D1MC 4XVTL 1TTFA 2VAJA 2NXYB 1JK8B 3A6OA 1NCCH 1UXWA 1KG0B 1UM4H 2CLZA 2XTLA 5C6TH 4M4PA 3WSQL 1EJ6A 4BSVA 2FHBA 2VISA 1U92B 1XF2A 5JMOC 3SGDI 1UYWH 4U31A 3QWRD 3GIZH 3CPLB 3F7VA 4CAGA 3V5DA 1NCDH 5KSBF 3MGTA 1U8JA 4J3TA 4KKAC 3ROOA 5FF6A 4MAUH 3RL2A 2B1AL 3I85A 5FECB 1AGCA 1AY1L 3I84A 4UIKH 4I18B 2HAZA 4YDKL 1J1OL 3U7AA 4PJ8A 2E8ZA 4WUKL 4OZGE 4G8EB 2PYFA 3FN0L 1MCQA 1KG0A 4IJ3B 4F15C 4WI6A 1DLHB 4QY8B 4NRYB 4XVJL 5DJCA 2OXGA 5FUOH 3SDYH 1F6FB 4BSWA 1TZGL 1WQVT 1KV3A 4ONOA 4I18A 5FM5O 5IFAH 3MZTA 4LSRH 3DX7B 1ZMYA 5EZLB 4G8EA 4UOW1 1XGYH 4LSPH 2K3TA 3SKOB 1WIUA 4NNXB 3ZDZF 1F13A 4YJZL 3ZT6A 5IG7A 1DLHA 3MA9H 3H0TA 1JGDA 4NRYA 3ARED 3AFLA 3K8LA 4MCYB 5H2BA 1CXEA 4OFVA 1V7MH 1LK2B 3ARPA 2ICES 2NX5B 3CVIH 2GTZA 5IIEB 2ZNWA 3D87B 4I2XE 5HHNA 2UWEE 3DX7A 4UDTB 3QIWB 2YK1H 5EZLA 4DK3A 12E8H 3PWUB 3SKOA 3MOQA 3QI9B 3MUGB 4FFVD 5EBMB 4DKFH 5J89A 2Z8SA 1YN6B 4ODUB 5H8DA 1T7WA 2H1PL 5INDB 2D7OA 4P5TB 3B9KC 3ESUF 1WBYA 2QQLH 4K3JL 4MSWA 4FP8H 2P5EB 2YRLA 4ODSH 4PJHE 4JJHA 2R0ZL 1LK2A 5D7KD 2NX5A 2XFXA 3FZUD 3K74B 3UTTD 5IIEA 3LS4L 3I3EA 5TE6H 4EOWH 3ISWA 4QRSB 1MVFA 4MA1C 4UDTA 3QIWA 4GAGL 4BYHA 4R4BB 5IEKA 5KVGL 3PWUA 2G75B 4UIMB 3MUGA 5EBMA 1FRGL 1YYLL 3DRQB 2VLKE 3TZVB 4CDHA 1YN6A 3MV7D 5INDA 1U8PB 3NACL 3EDJA 5EDXA 1UFUA 4HV8B 3TYGL 1D6VH 1GOGA 1DSFL 3KYNA 3SN6N 5JPMA 3C5ZC 3P30L 4K3EL 2W9DL 1R5IB 5EN2B 1AHWC 4XPFL 4XVTH 5JW5B 1BBDH 4P2OD 2G9HB 4GBXD 3HRZB 1K3IA 3MBXH 4Y4HC 1CFQB 4UIMA 3QEHB 4ZFFB 5GS2D 3BIKB 3I75B 4JFZL 4OUOA 2ZUSA 3TZVA 1I8KB 1FIGH 5LQBL 2EDXA 1A0QL 1U8PA 2ZUXA 1I9IH 2B1AH 4LSVL 4HV8A 4QCIA 3S36H 1NGZA 1HH6B 3IXAB 1MCNA 4LLMB 1EERB 3BXNB 1BZ7B 5GHWH 1R5IA 4XP6H 2C26A 5FUCE 1FLRH 1WVZA 2QTEA 5FYJL 2YR3A 4N0CC 2BY0A 5JW5A 5FDWB 1GPOL 4JDTH 4LIQE 2G9HA 1S9KC 1F3RB 3BGMB 3QDGD 1TQCB 2E6QA 3HRZA 2GQHA 3BH8B 3NZ8B 1CFQA 1FSKC 3QEHA 2FEEI 4ZFFA 5HPMB 3VXME 3BIKA 3I75A 4BQ6A 3W11C 2OBGA 4EIZC 3RTQD 1I8KA 1U3HD 2Y6SD 1YPZB 3RIFF 4AIOA 1XGPB 3WKNA 1OQOA 2BVTA 5BOPA 5KOVC 4Q9QL 5GRJL 4KROB 2ESVB 3B2VL 4ZO9A 3HR5B 1HH6A 3KPSD 4LLMA 3BXNA 2VAAB 1BZ7A 1J0JA 2D0GA 3MLTB 3LOWA 4JFOA 1XCQB 2W65B 3G9AB 4DKAA 2VH5L 5SWSB 1R3LA 5FDWA 1EHXA 3DMMB 4OZHE 3P0GB 1IEBB 3BGMA 4KMLB 2FSEB 3TT1H 3SCMC 1P84J 5SWZB 3QUXB 2CD0A 5CILH 4HIEB 1SJEB 1XGPA 5E56A 2PW1B 4B0MM 5IFHH 1FCCA 1B0RB 2ESVA 3PDOB 2IGFL 1KTKE 3MUY1 3SE9H 1TENA 3GK8H 1T89A 4HUKB 2VAAA 1I8MA 4PD4K 1OY3B 3ZE1F 3FMGH 3MLTA 1XCQA 4JLRB 3QISA 5LXGH 3U7YL 2Q8AL 3TO4D 1S5IL 5HHMB 5SWSA 3BJ91 3INUL 3DMMA 1ORQB 1RZGB 1IEBA 4Y1AD 1KB5H 2FSEA 4NM4L 2H1PH 2WZPD 3CD4A 4UOJA 5EORH 1RIUH 4HIEA 3VW3H 1SJEA 4DFHA 2PW1A 4Z76B 1YEIH 5BS0B 1B0RA 1JNNH 2R0ZH 3QUZC 1MNUL 3EJZD 1PKOA 5D93C 5TQ0H 1U58B 3S97C 5DD6B 5E8DL 2Z91B 5I74B 3STZB 4AG4L 1RUPL 3UTZA 3O6LH 1FRGH 2NY5C 1OAKL 2BMKA 4PTUB 3D39A 4JY4B 3OJVC 3NACH 1QKZH 2DQHL 3OWEA 3FAWA 5I1IL 3TYGH 4IIQB 3RDTB 4DW2H 5BS0A 4QXGH 5JW4Q 2E7LA 3FFDB 2PO6D 1EAJA 1FAIL 1U58A 1CLCA 1DBMH 4XPFH 4U4BA 1CCZA 3EOYG 2FJHA 5CHNA 1XIWD 2HFGH 5C09B 1H3XA 3LH2L 1EDQA 1T6WA 4TSCH 1O5DT 5HY9B 1JPGA 4LNRB 4XHJC 3LN5A 4PTUA 4JVPA 3CJJA 5C0EB 4JY4A 5LQBH 2DQJL 2V17L 5IMKB 1MAJA 2PXYB 4IIQA 2AW2A 5FKAB 5CWSB 3PG2A 2FD6L 4S2SB 4R7DB 2YZ8A 2DLEA 2QHRH 3TPUB 2G5BB 5FYJH 4RMVA 1A6VH 1BM3H 4MYWB 4K2UL 3MODH 5C09A 2IAMD 5J13B 3MNVB 3RKDD 4HK3N 2WWMC 2EDLA 5HY9A 4LCWB 2GSGB 3HB3D 4JZNB 3C60C 2ORBH 4LNRA 5T3ZE 3PV6A 1KJ2H 4DEPB 5IVOA 5IMKA 4AEHH 1UM6L 3BRDA 3R8QA 3B2VH 2BCKB 2PXYA 3B3IB 5FKAA 3P73B 2QSTA 2VTFA 1MI5D 2C3VA 5EU6B 1OPGL 4S2SA 4R7DA 3TPUA 4PJIE 2G5BA 1P4BL 4K71C 4XCYB 3NCJL 1TNNA 3IDIA 1IGIH 3O4LD 2N1KA 3T09A 5I1LB 4HFWB 2XRAL 2EDJA 3GIVB 3GSVB 2GSGA 4L4TB 4JZNA 5AYUL 3T3PE 1FVCB 4PP1C 1ZHLB 1B6DA 3EDFA 4NJAL 3MLUH 3GSOB 3QDJD 4PGJA 2IGFH 3TWCH 4J2XA 3WD5H 1J05A 2HWZH 1OTSC 5CUSL 5C0AB 3KPLB 4NC0B 1YEJL 1G7MB 4NOFA 2FBOJ 4HPOH 3QAZC 1S5IH 2C7UA 3AMLA 5EUOB 4XCYA 2Q76B 3QJFB 4X7DC 3VD3A 3SDDD 4J7RA 3HE6B 4M7LL 5I1LA 4HFWA 3GIVA 3GSVA 4Y4KA 3DECA 1FVCA 5KVEL 1ZHLA 3GSOA 3Q5OA 1MIEL 2DDQL 2K7QA 4DZBA 3DYPA 1G7IB 1CL7I 3AY4C 4PLJC 1NAML 3GMPB 5C0AA 3KPLA 1FIEA 3IDXH 2IANB 2C4FU 5L2KA 4LSUH 4FNLL 5E8DH 3DO7B 4FQXB 2R4SL 4NCDA 5ACLA 5E94B 2AEIT 4FXGB 4OLXH 5LGJB 5EUOA 1E4WH 4HIXL 3REVA 3LB6D 1NAMA 2MHAA 3B9VA 3G6JB 4NZDA 3ARQA 5DJ6B 1SVZA 3MBED 3RVWD 4ZG1A 1PKQB 1LHZA 1VFMA 3HC0A 5F9WB 4OFIA 5D7IB 2ICEB 1NCAL 3RY6A 3ALXA 3MRLB 3IRPX 2HT4C 4PJDE 2HJLA 3DLQR 2F53B 1BJ8A 3NH7H 4FQXA 43CAA 5AUMA 3NVQA 4HJJH 5E94A 5FGBA 3LH2H 5C0CB 5LGJA 3MJ9L 3DIFB 3K4ZA 1UXSB 3G6JA 4PRIE 5F9DC 4Y4FC 4Y19B 3D3VD 2APVA 3FRUA 1PKQA 3B6SB 2NY1C 3MJ9A 3ULSB 3MRJB 2VYRE 2CIKA 2FD6H 5I1KL 2HMID 2ICEA 1P7HL 5D7LD 2E7HA 4FQ1L 1VHPA 3MRLA 5BW7A 4LLVA 3TEUA 4JPWL 2YUVA 1A6UL 4G6JL 3NOIA 1OQXA 1P7KB 2F53A 4FTVD 4P2RE 3VFTB 4C58B 5D1XC 1BVZA 1QSFD 5C0CA 4JO3L 1P1ZA 3DIFA 1I8IB 4QOKB 4ZAKB 2AJYH 1VEPA 4OD1L 1QUNA 1G7JB 2QADD 1HHHB 4O58L 4Y19A 1K4CA 1LO4L 3JV0A 5ADOH 1YYML 1NSNL 1U9KA 2DQGH 1Z5LB 2P5WB 1UM6H 3PP3K 3B6SA 2ZCLL 1NLBL 3E2HB 1IAII 3MRJA 4MVBC 5FYKL 2VKWA 2DQTL 4JHAL 4GRWF 1GZQB 2NXZD 4NNPL 4PJFE 4TUKH 2O26U 1CTOA 1QZ1A 2XIDA 3KLAA 1Z0MA 5GGVL 4HG4K 1YQVH 4YPJA 3VFTA 5D2LB 4S0TD 1I8IA 3V5KB 3T1WA 4P46B 3FB7A 1G7JA 1H3PL 3L3KB 4G9DB 3L5XL 1Z5LA 2CKBL 2P5WA 3B4NA 2G5RA 1MFAL 1LDPL 3QDHA 1R24B 2QV2A 3NCYP 5DUMH 1GZQA 4P9HH 1A7OL 5DFVD 4NFCA 1PW3A 3GMRB 2BSED 1ZHKA 5FO9A 3P4MA 4G9FE 2YPLE 2CKBA 2NY4C 4PV8A 1EJOH 4FQLH 5DQJB