3G5YB

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
210
Chain Sequence
DVQLQESGPALVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSANTRYNPSLKSRISITRDTSKNQFFLQLNSVTVEDTATYYCATAGRGFPYWGQGTLVTVSAAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 175 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 210
sequence length 216
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yB01
2VLKB 4DCQA 5ACZA 1OF2B 4Z0BH 1KB5L 1YUHA 3B9EA 2LU3A 1MFDL 4I9WE 4AL8H 5TE4H 2R9HC 2W9EH 3TT1L 4C55A 2N7BA 3LS4L 4NQCE 1KIPB 2CRYA 1Q0YL 3BGMB 3BKMH 4JFFA 5DJAB 5KSVB 1CD8A 2DQFA 4UAOB 4NM4H 3P77A 5D7JD 1GGBL 4EOWL 1I3GH 1U3HD 4LK4A 1MFCH 4ETQA 3ZHDA 4FFYH 3VGAB 3B2UD 3K2UH 3NIGF 3ZKQD 4XAWL 2JE8A 1KPUA 2FGZA 4X6CF 2HJKA 2FR4A 1WK0A 1FBIL 2WWKO 4AT6A 3AMKA 2IPUK 5C2BH 3QUYC 2EDLA 2CLZA 1LO2H 4YHMH 1P5VA 5DVMA 5CHNB 4D0CB 5C6WH 4Y4FC 3A67L 3SKJL 5FAAA 5C92A 4TUKH 2ZSVA 5JXEC 4MXWL 3EHBD 4YDKL 4MS8C 1RIHH 4R0LA 9CGTA 4F7CA 1GXEA 3PWVA 1N0LA 2Y6SC 3UJJL 4LIQL 1L7IH 3KAAA 3GRWA 1OM3L 5GRUH 3VDAA 3A6BL 4P3DB 4K07A 4LSQH 4OZIF 1F4WL 3MRRB 4GRWB 4PB9L 5GRXG 5KVEH 3EFDL 1CXLA 1FGVL 5F7DB 4KK6C 2BJML 4HBCL 1AGDB 1RULL 4NP4L 4K9EL 5EFIB 3MV7A 2OJZH 4X9FA 4O2EA 1BM3H 2DWDB 2ATKA 4XMPH 5ICZB 3SGJC 1NEUA 1D7FA 4UDUB 4Y19A 4APQD 3SDXF 4QRRE 2ZCHL 3EFFB 2FYYA 2IQAB 2Z31C 1JPFB 2VLRD 2VDRH 5EB9A 5IHUH 3E8UH 3AM8C 5E08H 1T5WA 3ULUL 5KBNC 5D9SB 1IM3A 1C5CL 2H2PD 5J11B 1MUJB 3BP4A 3MRKB 4JM2B 3DUHA 3ISWA 4XHJD 3IDMB 4YHZH 3V79C 1HNFA 2DM7A 4HPOL 5HVWA 5FIEA 3WFZA 3D85D 1D9KD 5CZVH 4X6EB 4A6YA 5IVOA 1UWEH 3LIZL 4P2OB 2YN5A 4EIZC 5FYJU 3X12B 4R4BB 3NGBC 4UTBH 2WBWB 2ZWLT 3RNQA 1YEGL 3UBXG 2CDGB 4Q2ZB 3T0EE 3HE6C 3MX0A 5F21B 1F90H 4MJ6A 1ZXQA 1CTOA 1FYTB 5F6HI 3EKCA 4NWTL 1IAIL 3EYFA 5EOCH 2JTDA 5C0EB 2IPUG 3ARED 1KSRA 2AERT 3MREA 2FEEI 1P4LA 2X70A 1GYAA 3FO2B 2GTZA 3V0VA 2YA2A 1ZGLM 1FRGL 2XN9A 1ZHNA 2AXFA 1Q1JL 4JY6B 3TZVD 5I1DB 3P73B 4LNRA 3V5KB 4LLWA 3LB6D 4I18C 4M7LT 4UI2A 3CDFA 4ALAH 4PJEA 4TVPL 4XP1H 1UZ8A 3VFWA 1MLBA 3SBWC 1IGYB 4TNVF 5BV7H 4PJCA 1H8NA 5DJ8B 1M05B 1A7PL 5CD5C 3L3HA 4FTVB 1Q94A 1Y6MR 1JPGB 4HS3A 3MRGB 4Z7VF 4J6RL 3RX7A 1F11B 1YDPA 1TZGL 1CGUA 2VXSH 4GXUM 3ARTA 1DCLA 5GS3A 4U7SA 4F80A 2D7QA 4G9FA 5I8KH 1PY9A 2XYCA 5DD6A 5B4MD 4JFPA 4Z7WF 3AB0C 2H3NB 3RIFK 3VFUB 3ULVL 1CI5A 1P69B 4NHCH 1JPSH 1QO3A 2DIBA 1YNLH 4MNQA 4B41A 2VQTA 4U1NA 1U0QA 1IGFH 1ZS8A 1I1AD 2FL5B 3L5HA 5EO1B 1LHZA 3DIFA 1EERB 1TQCC 1MSPA 2NX5D 4ZUSB 4L5FH 4LCWB 1OHQA 4HFWB 1IAOB 1FFRA 4LLDA 2Y5EA 2R1WA 3PP4H 1NLDH 3WV0A 4JZNA 1VFUA 4PG9A 4YWGH 1J1XH 4OLUL 1WCQA 4M5ZL 4Z95L 5CEZD 4RGMB 5CJOL 4OBSA 2VDMH 4C56E 5AG9A 4GAGH 1X9QA 2OZ4A 3L1OH 2CK2A 5HDOA 1KEGH 3GSOA 5HGBA 3HZMA 5F44A 1X5JA 4L8SC 2XTJD 4GG6A 4KRPD 4L4TD 4OGAD 2A1WH 1U8OA 2QADB 4HDIA 4PB0L 5IMKA 1ITCA 3MJ9L 4M5YL 5FOJA 1VSCA 3HNSL 4K3DL 3G08A 1A7QL 2CUIA 4UILH 3UTOA 5C0CA 4EBQL 3BISA 1ZT7A 3DVFA 1JZ4A 4JPWH 4JRXB 1VENA 4WFHD 3VXMA 2AJVH 2C7UB 1U36A 4GQPH 3O6KH 3IJHB 2APXA 3BT2H 3H0TB 1PFCA 3QQNA 4CW1A 5BXFA 3VMNA 1G7JA 5LGJA 1ONQB 4JQXC 5C0DB 2VXVH 2A0LC 4RGNB 2AJ3A 3EJJX 2Y23A 1DBBH 1Z5LA 5FHAL 4MJIA 2PO6C 4PJHE 4YNYA 1A8JH 4IEFB 5EIIB 1UGNA 3LKQA 2I27N 4V2BA 5ISZB 1HDMB 4H0GA 4RRPG 2E7HA 1CT8A 3GHEH 2EIZB 2DTML 4PFEA 4POZC 4RISH 1HYRC 1CLZH 2JJUA 2YOCA 3U30C 3PGFL 4NKMB 2D0GA 5DS8B 2DYPD 4U6TA 1GGCH 3N85L 4BQ8A 4QXWA 5C0JA 3LQZB 5ENWB 4OT1H 5I16A 5HI3D 1IC7H 4PJAF 5D6CA 5FYLH 3UAJD 3LKNB 2XQBL 3VXTA 4OI8A 5H35B 5F93C 1X7QA 1FAKT 3MLXH 1MCSA 3O6FB 1A22B 4JG1L 5E6IB 4WV1B 4M93B 3VE0A 4XVTH 1A6VL 4PD4J 4KAQL 1K5NA 4M00A 2D03H 1I8MB 1R3IL 2NW3B 2Y25A 3TCLB 4AEEA 3QUMA 3IJYA 1DANT 1F3DH 3TVMD 5GGQH 1H0DA 4RMUA 2PKDA 2AQ2A 2Q76A 3HB3D 5D1ZB 3VWJA 1XGQB 1K8DA 2B2XH 3GSUA 5C08D 4L29A 5CJ8A 3RGHA 4NQXA 1CDCA 4XWOC 3UZEA 1JHKH 3OB0H 2VKWA 4PV9B 3S35L 3U82B 5L88H 2VABB 1DDHB 1OQOA 2IG2H 4DGIL 1NCWL 3MNZA 2Q6WB 3LQAH 4JFDB 4J3SA 1MWAL 2EDEA 5FB8B 3TGXA 1T7XA 1R3LB 4MDIA 2P5EA 1TFHA 3D2UA 1OAUH 3U4AA 3HUJF 3DARA 3CFKA 4HK3N 3TBVB 3U0PB 4R97C 3ARFB 3KWWB 4IRZH 4RNRA 2AJSL 5HY9A 2WIIB 3HZYA 1OSZA 4ZFOB 1HHHA 5JNYA 3OAZK 3FQWB 3BW9A 3VH8A 1S7UB 5GIRB 4D3CL 1DQJA 2WMPA 1OD9A 3JBG7 1QQDB 3THML 5KSBF 2GCYA 8FABA 3U48A 1IKNC 4DZ8B 4GOSA 3MLPA 1DP0A 3MLWH 5I6XC 5FYJE 1BD2A 3GSVA 2DICA 1EFXB 5ERWB 4QRTB 4PS4L 5DJ2B 2ZCLL 2VSCA 1T7YA 4R2GD 4U6VL 3KPSA 3STBA 1X5LA 2EDKA 4OCSL 3F5WB 5T5FL 4JFEA 4HUUA 3QG7L 4PRIA 4JANB 1MHEB 3OR6B 2AJUH 4LVOC 5JW5A 1NUGA 5JPNB 3GBNH 3NCJH 3HMWL 4PJBB 3SCMB 4M48L 5DA0B 1S7QA 2VC2L 1OCWH 3QIBB 1WUNT 4OFPA 2CDFB 3TIEB 1JBJA 3DUUB 3BQUA 3BN9C 3BZDA 5I1EH 3V0AC 1UCTA 2IAMA 1ZSDA 4FFZH 3P9LB 4G8GE 4LSUL 3VRIB 4H0HB 1U8LA 5F3HA 4NQUA 5I9QC 5GGUB 3M17B 4S1RH 5I74C 5GSVB 1T0NA 4IRJB 1AKJD 3MFFA 2XWTB 1CL7I 3QWRD 5BZDA 4PR5B 1JK8A 2VR4A 3O4OC 1EO7A 2HTLC 3BRGC 3TA3B 3IXTA 3JTTA 4WTZA 1DQMH 3WIFB 1JNJA 1MRDH 1Q8MA 2B5IC 2ESVE 5FECB 4MA8H 1UWXH 2EZ0D 1NCTA 3MRBB 3ARBA 2AQ1A 2V9TA 4P2QE 4DJMA 4MDJB 4Q74A 3L5IA 1YEHH 5BZWA 2YZ1A 1JYXA 1A7OH 3ZE1F 5I1IL 1MI5E 1K8IB 3LCYA 4POZD 4N5ED 3S37X 4LEXL 2FJGB 1QKZH 2DS4A 1NSNL 1UJTA 4PV8A 3IDIA 3HI1A 3IKCB 4XMKH 3P30L 3GSWA 4YGVA 1UKTA 1KBGL 4NKDA 5J06A 3TJHD 2R1XA 3B3IA 4Q9RH 1G6RH 1PLGH 2CUMA 2CR6A 2VLJA 1YY8B 3BYTA 3QXAB 1LDPL 3QG6A 5GRYA 3OR7B 2VZ1A 1QYGL 4NNYA 1FNFA 4GO6B 4NRYB 5EA0L 1E27A 1JNLL 3S88H 1BZ9A 4FQXD 4PBVC 1KCSH 1J05A 1Y0LB 3VDCA 1YQVL 2ZUWA 4BYHA 1M7IB 1RUPL 2B0SL 4L8DB 3I50L 3BD3A 1BX2B 1TTGA 5M94B 3FQNA 1QA9B 4UDTA 4LLVA 2NY6B 3E3QC 5B39A 4LAQL 4XBGB 3LY6A 4R90H 3RI5K 1EEYA 5CJBA 4Z7NE 1UB6A 3MRLA 3L9RB 1JE6A 1LO5A 4NOFA 5ACLA 2VTFA 5IM7A 3S7GA 2FX7H 3P4NB 2OSLA 4PP2A 2E6JA 1MCDA 2VH5H 2CGRH 3SJVA 4Z5RA 3EO1B 4AM0A 2Q7YA 3H7BB 2B4CC 5IK3B 35C8H 4PRPE 5C71A 3FFCD 2OJEB 1K4DA 3K4AA 2IH3A 4NQTA 5DRNA 3LH2H 4MA3B 1UQSB 3MNWA 4WO4D 2ED8A 2RB8A 3W82A 1DEEA 2HWZL 2F5AL 1NKOA 1I9JL 4JREB 4JY4A 2RR3A 3QAZB 1NC4A 4X80L 3EIFA 3W81A 3KPRB 4LPVA 1OP9A 1S7WB 1HZHL 3RWIA 1KB5H 5BVPL 3P4OB 1MFDH 1GPOH 2ADIA 3CFBA 5E1HB 4D9QE 5DVNA 5EU5B 1CLCA 3TT1H 2KQNA 3LS4H 4YDVB 3GMOA 4HS8L 1EEQA 3V0WL 2FNBA 1Q0YH 3FQXB 3O6FD 4MAYA 1TZHB 2A6DB 4ELMA 4KK8D 3CPLB 4H1LB 4M8QB 5D1XB 4OV5B 5BOZG 4P0DA 4LRNL 5DVKA 1GGBH 4X99B 5D2NA 1RZKL 4EOWH 5C0GB 4R4ND 3RZCC 3RGVC 4AYFA 1AXTL 2VZ3A 5K9OB 2GSIB 4PJGB 2QHRL 5T3XD 4XAWH 1KJMA 3Q5OA 1FBIH 5A43C 4BZ2L 4OKVB 3VXSA 4WHTA 3NIGE 2FHBA 4AQ1B 4F9LC 1OT1A 4ZXBC 4LARL 5EC1A 4ZNEE 4CMHB 3A67H 3SKJH 2ERJB 1K4CA 2AK4B 4NUJA 5IIEB 1QACA 4MXWH 3MROB 4ZFZB 2RQ8A 2I5YL 4CU6A 5BS0B 3F6IA 3KPLB 2D7OA 4M6NH 3UJJH 4LIQH 4PJXE 1MELA 1G7IA 5ETUB 1OM3H 1Q9WA 3A6BH 5BRZA 4ENEC 1JHLL 4HH9A 1Z6JT 2Y4SA 1FZKA 3IDXL 3ESUF 1F4WH 3T2OA 4AMKL 1OTUD 3OG6B 5HYQB 4PB9H 4OZIE 3EFDH 4IJ3C 4DVBB 1FGVH 1Z2KA 2EC8A 3BHBB 3KPOA 4HBCH 4YO0A 1T7VA 2V2TA 3MACL 1RULH 5I30L 1P4BL 4YLQT 2XKUA 4NP4H 1M71A 4K9EH 2VQ1B 4AIOA 5DHXB 4XNMB 3E2HC 4JHBA 4K7FB 5FM5M 4UQ2A 3MJ8B 4L3EB 3VCLB 4TTGA 5DD1L 3O2WL 1R3HA 2F54D 3JWNC 4XCNB 2EEDA 5H37H 1LK3L 5IV2B 3WN5B 3TESA 4MGXA 2ZCHH 5HPOA 2GJ6B 2AKRA 3TNMB 3OXSA 1EGJL 3ULUH 1PG7W 1VGEL 5I1KL 1C5CH 4OLXL 3SCMD 5CJXA 1KIUA 4U1LB 2X7LB 4X8JA 2HLAA 4KXZI 3ES6A 3QIBD 4G80A 4HPOH 3VXRA 3CDGA 4GKSA 1A6AA 4NBZB 3H9SB 4KMTL 3S35X 1KCUL 1A14L 4OLVL 3LIZH 5IW3A 3RWHB 3FQUA 4LASL 3IU3A 1SVZA 3KGRA 4LVHC 3VW3L 1FVEA 1I7TA 1YEGH 1I7RB 1PKQE 4OSUL 5J9PB 2BHZA 2YPLD 4LLYA 2E9WA 3T4AA 4IRSD 4N0UB 5ANME 3MC0A 4NWTH 1IAIH 1OP3H 1RUKL 4G6ML 4QXTB 2CKNA 1U8MB 4Y5XC 3QUXB 3QDJD 3NOIA 5D5ME 3PIQA 3HAEB 4U6XA 5AD0A 2V5RA 2ITDA 4L9LA 4YJZL 3MPCA 2Z4QB 2DQDL 3LZFL 3C09C 1JGDA 1FRGH 5CGYD 1Q1JH 2HVKB 4FFVC 5GZOD 2P5WA 3DHMA 4O58L 1NDGA 3GSNA 1X5XA 1UA6L 5IGXL 4TVPH 3G6AA 5CJQL 4J3WA 3PV7A 4M6OL 5DD0L 3BP6B 3QUZB 4WWKB 1A7PH 3VWKB 5J56B 1A4KB 2DB8A 1V05A 4GBXC 3FO1A 3ZT7A 3O11A 4JGJA 4J6RH 4WI4A 1TZGH 3D3VA 4WRLA 1QBAA 3X11B 5EBWA 2NQCA 3ALWA 1X5GA 4HUVA 3S36L 3IJSA 2GSGA 3E6FB 2EYTB 1A2YA 1VGKB 3ZKMD 5HGAB 5A2IH 2F74A 3ULVH 3I3EA 4V1DE 4X7DC 4Z7WE 5FXCH 4ZO7A 5TDOB 1HKFA 1KGCD 4MD4A 1M7DA 1EXUB 2WWKT 2Z91A 5DC4B 2FX9L 3UTSD 4PJ7B 4Y5VB 1RIUL 1P9MC 4QF1B 2MQ0A 4PLKC 4IOFC 2XG5A 1CIUA 3S9DB 4M7KL 1G6RB 4QYOA 4NZDA 4P46A 5JZ7C 4K94L 3JWDL 3I3BA 2ICEB 1QRNB 3LD8B 3LDBB 4OLUH 5DFVD 2VUYA 4JZOB 4M5ZH 3OGCA 4KI5F 5EU6E 5DHYB 2HT3C 4Z95H 3B9KB 4YHIB 3IRPX 4GKZB 5CJOH 2P48B 3FQRA 4HWZA 4XNYL 1BFSA 2Z92B 1JUFA 1OD7A 1A7RL 1BQHA 3FFDB 1TVBB 3KNBA 3PQYA 4JAMA 5E56A 2VN7A 5HI5D 3FHAA 4G7VL 2WBJB 3C5ZA 1G9NL 2EEAA 3WFEL 1XR8A 2P8PB 5J3HD 4ZYKB 4Y5YB 4PB0H 1D5IL 5AZEL 3MJ9H 3GIVB 2J8UA 3ZT6A 3KPRD 2N56A 4YPJA 5ABDE 3KR3L 3LN4B 3BXNB 1A7QH 5DMGC 4EBQH 4JO3L 4HIHA 3BUYB 1YN6A 2Y7QA 2XWJB 5BOPA 2GK0A 3L3OB 1FCGA 1YNTA 1LP9B 4YFDB 4Y2DB 2VLME 2EDHA 3ZE2F 1OGAD 1FCCA 3GMNB 3JV6A 3RVXD 1UXSA 2FIKA 3ARYA 2BY0A 3VGGA 1IC1A 3CFEA 1QFPA 5FHAH 5D7IB 2BSTA 5B8CC 4QTHA 1AGFA 3CSPA 4GLRI 5CBEA 3RIFF 4HHAB 3NFPB 1D5MB 2DTMH 2DI7A 4RQQA 4PGEA 1S7VA 2EDQA 4N8VG 1FFPB 1UM5L 3PGFH 3NCMA 3QIWB 4DZBA 3N85H 1A9BA 2YPKA 1C5BL 1PX4A 3OB0K 3RDTB 4QKXB 3UTZB 4CVXA 3OL2A 4PGBB 1EZVY 5BS0D 3A6OA 5ALBL 3MZTA 4U1JA 2XQBH 2JIXB 1DQLL 4F2MA 1KLUB 4PJAE 1H5BA 3L3DB 3MZGB 2AXGA 3UBXI 4HX1B 3ARDC 1B0GB 4JG1H 1TJGL 5EU3A 1A6VH 4E41D 4KAQH 1IM9B 1NGZB 2C9AA 3JUYA 1R3IH 5HXMA 1KB9J 4YDLB 4ZAKA 5CSZB 5DHVH 4HSQA 4AIZA 2JCCB 3VRLF 3QHZL 1YPZF 4NQCA 3MYZA 1II4E 5IUSA 1MREH 5F1NB 5BO1L 3GGWB 5JORB 2VL5A 3NPSC 3JTSB 3CSBA 1J8HB 3HC4L 3OAYH 5DO2D 4HC1A 4I0PC 1VDGA 4KV5F 4JRYD 4HIIA 4YHOH 3QDMD 2ZG1A 2GJ6D 2HLFD 3S35H 4GMTL 5SWSE 1BVZA 3L7FA 2ITCA 4GBXD 4DGIH 3C6LA 3GSRB 4H26A 1CDHA 1NCWH 2DQGL 4OAWA 5DR5L 1U8JA 3MJ9A 1MWAH 2V7HB 3Q5YA 1ZHLB 5IFJB 4H20L 1WVZA 3O3EB 3B4NA 1S9WB 1CDUA 3DVGA 4MQ7B 1FJ1B 3V5DA 3MJ6A 3OJVC 4HUXA 1KPRA 3RP1A 4N1HB 3HUJE 4X5WA 1JZ3A 4JO2L 1JYNA 2AJSH 2H6PB 4TNWK 2I9TA 2PTTB 2PR4L 2WQRA 4D3CH 1GRWA 3TBTA 4NHUA 2PW2A 4HWUA 3DRTA 3THMH 2HT2C 3MRPB 4WFEE 4WCYL 4KQ3L 1BBJA 3MO1B 4IM8A 5KSBE 5GGSA 1DVFC 2W1NA 2ZJSL 5MEPB 3M1BA 4HKJB 3MRQB 4MCZA 5GRZA 4DFHA 3O9WC 3QUXD 4KI5C 3ZYOA 2ZCLH 4U6VH 1HNGA 3VXUB 4OZ4A 5F9WB 4KK5D 4OCSH 2HH0L 5T5FH 3QG7H 4RFOL 2FWOB 3HMWH 1UWXK 1GH7A 4M48H 3FOLB 5L2KE 2VC2H 3ZKXC 3QEUA 4QRRA 5T3ZL 4ZS7L 4HG4K 1TCRA 3LAFA 2EYSB 4WFFD 1NGQL 1W8OA 2R69L 4MWFA 1TDQA 5EZJA 4Y88A 1XF1A 5C0BB 2VAAB 2HJFB 2KDGA 1QSFB 3QI9C 4WWKD 4DTGL 4F3FB 3DBXA 1JWSA 3I02B 3OKMB 4JM2F 4LSUH 3FO9B 1MCBA 5DMGD 1HHGA 4LSVL 1S9YA 4GW1A 1SHMA 3FB5A 4JFYB 5JR1L 3DO7B 1VPOL 4BQCA 5CEXA 2A83B 1T5XB 3HMXA 3BZ4A 4PY7B 2Q20A 5D1QC 4KDTC 3R0MA 3PL6B 3T0EA 3HE7C 4F7TB 4Z7UF 4WTXA 1HILB 1YEKL 1RZIB 1NMAL 1U92A 3T77A 2OS7A 3DRQB 5I1IH 1RHHB 1EPFA 3MGOA 5IR1B 5IQ9A 3C5JA 2XKNB 6CGTA 3DX6B 4I48A 5MEQB 3ZE1E 4LVNC 4PJ8A 4FQPA 4LEXH 4OD2A 3KDMA 1JGVL 3MRMA 4HGWA 1H3TA 3P30H 1T22B 4Q6IA 1R3KA 4IMLB 4BFBD 5DURD 4XWGL 1S9XA 5BJTA 1KBGH 4PJ9A 5FUCC 1ND0A 1HI6B 3GMRB 1LDPH 2IBBA 3TH2T 5IMMA 3D0VB 1QYGH 5I17B 3BWAA 3MV01 1URLA 3SE4C 3CXDL 3C87A 1FGNL 5EA0H 3GKWL 2BHYA 1JNLH 4U1HB 4O2FA 4FG6D 1AIFB 4NQVA 4NN6B 1YQVH 3MV8B 3GMPB 3UTTE 3BP7B 1RUPH 5I1AB 2B0SH 1K3ZA 3NMEA 3I50H 4OFDA 2UWEF 3S36X 4LLUA 1F8TL 3U36B 1D6VL 5IMOB 4YH6A 3EJZC 5ACMA 1HK6A 4Y4HB 5IEKA 1B4JL 4U2ZA 1KYOJ 4UOW0 3A6CL 5C07E 3LHPL 4Y2DD 1U8HA 2DBJA 3ROLB 5D71L 4X98B 3LSOB 5SWZD 2X5PA 5AEAA 5ADPL 1U8KB 5JIHA 2VOTA 3QPXL 1UADC 3HR6A 1QEWB 3D0LB 3L5XL 4X9HA 2PYED 2HWZH 2F5AH 2XKSA 2RGSA 3T1FB 1ZT4B 3WUWB 1I9JH 4WU5B 4X80H 4P2YA 2CDEB 5JLZB 1L6XA 3BSZL 4C56A 1JI1A 3ARWA 4HMEA 1HZHH 3RDTD 3SDDB 5GJTL 5BVPH 3HC0B 4ESKA 5FV1L 5CBAB 2VE6A 4FP8L 3RTQA 4HXAL 5HGHA 1TIUA 2LABA 4CNIA 2EECA 4HS8H 1BFOB 1JMXA 3V0WH 1CFTA 1XCTA 2EC9T 5GGTL 3S4SB 3O45A 1YYLL 1NC2A 4HCRL 3O8XB 1JN6A 1RZKH 3AS0A 4WUUA 4J1UB 3QDGB 2GJZB 4GRLB 1AXTH 1FFNB 1CICA 2RBLA 4X0KA 2QHRH 5CP3H 4B50A 4X4XB 2ARWA 1OGTB 2RJMA 3MXVL 4BZ2H 3FRUA 4YBLC 5KN5B 2J6EL 3IFOA 1Z9SA 2BMKB 5E2UL 1FZJB 1H15A 3X17A 5MEOA 3HPLA 4MLIA 4LARH 1WISA 5L8KB 1HHIA 4HULB 4I2XB 1YUHB 3LEYL 5DSCB 4YFEA 4OZFH 1XF4B 1FC1A 3W11C 1VEMA 2I5YH 4NN7B 4PJHA 1JF1B 5J11C 4L4VE 4EN3B 1B88A 5CEYA 4JM2C 1KOAA 3OKOA 5IHZA 3RI5F 3H9HB 3TIDB 3BRFA 4CADB 5CZXD 4R96A 5EWIL 1ADQA 4QOKD 1JHLH 3P77B 1GOGA 4NJAL 5DTFB 3IDXH 3U83A 4AMKH 1NANI 3QPQD 4P9HC 4P2OC 1RK0A 4NQDE 3WFCL 3PWPB 2MWCA 4FZ8L 4YXLL 2WNGA 4G9DB 3MACH 2YMXL 3PWJB 3ZYZA 4D2NA 5I30H 1A1NA 1P4BH 2CLZB 3IDJB 5IKCB 3HE7D 4TUJA 4XI5C 5DZNA 5EOTA 1QR1A 4GKNA 2BFVL 5JOPE 1AHWA 3QR2A 4UU9B 2FBOJ 5DD1H 3O2WH 2EE6A 1BJ1J 1S5HB 1T1WA 1LK3H 2Q3AA 1OP3K 4GAFB 1QSEB 2B20A 3HI5L 5J8OA 2GQHA 2EDBA 2OTPA 1J5OL 3OWEA 4OI9A 5J12B 1EGJH 1QFWM 5DFTA 1VGEH 5I1KH 1WIUA 3BO8A 2KPNA 3NTCL 3BFOA 4JCMA 3STZB 3VJ6B 2FEDD 2P44B 3MQIA 4OLXH 4WW1A 3T3MF 2HTKD 3TO4B 3NIDF 4XXCA 3CU7A 3BN3B 3L3JA 4P23D 5GSRB 3C8DA 4HJGA 4PG2C 2W60A 4KMTH 5DK0B 1KCUH 1EEUA 1A14H 1WZKA 4OLVH 1WBXA 4LASH 5T1KD 1QBLL 1W8NA 5D7KD 4LRIA 3T8XA 3VW3H 1GOHA 5D70L 1UKSA 3TN0B 3D25B 4OSUH 2MFNA 4L1HA 1QR4A 4ZUVA 1VERA 4Y19B 5GPRA 3EGSA 4CVZB 1OSPL 4LLAA 1JF5A 3AROA 3ZL4L 3O6LL 1KEML 1GSMA 4B7IA 5CMAA 5F3BA 3T0AA 1RUKH 4G6MH 1DBML 2XWBB 4DQOL 5EUOA 2NY0B 5CLWA 5L6YL 4HXBL 4JDZA 5KS9B 3BP4B 5LQBH 5H37G 1E4JA 3A0OA 3LZFH 2DQDH 2V9RA 3GBLA 4OZFA 2CQVA 2CKBH 4O58H 4A6YB 1A3LL 2BOBA 1UA6H 2AXHA 5IGXH 2YZ8A 5CJQH 5C6TL 4R0LC 2XNAB 4QRPE 3L3IA 4M6OH 2AV1A 5DD0H 5BQ7B 1GZQB 4RGMC 2M1KA 4WNQA 3DMMD 5J6GB 4G43A 2PXYD 1QZ1A 4M61A 3B9AA 4MA1B 4WI8A 4CRPA 5E4IA 1EUUA 2A73A 4GG6F 4GG8A 5EN2B 4XC1L 1KTLB 5FGRA 5KTEL 3S36H 3QUYA 5I1GL 2ZOLA 3RWCA 2CSPA 3BGAA 3L3KB 1A4JB 3KXFD 4ZODA 3VA2C 2QADC 1MRFL 2O26U 3OKNA 1WZMA 4Y4FA 1D5BA 4Z78B 5KVGL 1P4LB 5C09D 4X5XB 2GTZB 4X9IA 5JXEA 2XN9B 1I3VA 2FX9H 3L5WA 4G8GA 3U6RB 2IMMA 4YHYB 1T6WA 4YBHA 1RIUH 3MYJA 4X6DE 3VGHA 5LGKA 3ARVA 1JF6A 4PJDB 5FGCB 1I75A 3WE6B 1MLBB 1RIVL 2J7LA 3QWQB 3RKDD 4OD1L 4M7KH 3ALPA 3ZKSD 3LPGA 3RVWD 3QQ9C 4K94H 3QEQE 3JWDH 1Q94B 1QTYT 3BE1L 4KTYA 3ROOA 1GZPA 4RGNC 5I1LA 1CFSA 2ESVA 3SE9L 5IB5B 3WNLA 2NXZD 5HHME 4KI5E 1SMOA 4XNYH 3V5HA 4P2QA 3IS1X 1I8KB 3FB6A 4PRHD 1A7RH 1MI5A 1BZ7A 1QFHA 5L7XL 4KRMB 4G7VH 1CBVH 3MRHA 1KJ2A 3SGJA 1G9NH 1QP1A 3WFEH 4JFOA 2BHUA 2ICWB 2ZPKL 1D5IH 5AZEH 3SY0A 1NGWA 3LN5A 2HKFL 3LPWA 2AJYL 2Z31A 1P5UA 2BVTA 3DIFB 1WICA 3KR3H 4M6AA 1W0VA 1BQSA 1KNOA 3SGDI 3LEVL 4PPTA 4NRZB 1CFVL 2MMXA 4OFYD 4LDEB 4JO3H 5EPMA 2DQIL 4M93C 4WV1C 5E5RB 3R06A 2MQCA 4G8FA 3IFLL 2A74A 3KPPA 4RAUB 5HSFA 3CZFB 4U1GB 2CKBA 1FL6B 3DGGB 4UV7L 2I25N 5JW3L 3ZE2E 1FLTX 1JWUA 2CJUL 3QFJE 3QDGD 4P57A 5GJSL 5FCSH 3BZFA 1LDSA 3BEVB 5D1ZC 4EI5D 1A1OA 4YPGA 2J5LB 4OCMC 4PJIB 1KXTB 25C8L 5FDYA 2BP3A 1BVLA 3HE6A 3NPZB 5DD5L 1FE8L 3HR5A 2CIKB 4MJ4A 5E9DE 3D69A 5C8JA 3VFGL 1D5XB 1G9ML 4LFHG 1EDQA 1UM5H 1VA9A 3OAYK 3U4EA 4M8VA 4BSVA 5DEFA 3I84A 3S5LA 4G6JL 4NGHL 2GHWB 1C5BH 1IZJA 5F88B 4FXKA 4ODHL 2P7TA 3UJIL 2EIEA 2GITA 4PRPA 2DAVA 3SKMA 1L9MA 1A6UL 3VXMB 4LKXA 5ALBH 4AENB 3QHFL 2ADGB 4KQ4L 4JFFD 1DQLH 2XZCL 1G7MB 3UTQB 5FUCE 3E6HA 2R2HB 3ARFC 2LTQB 2XTJE 4CW1B 1I3RB 3IFPA 3SBWA 4JR9L 2BOCA 3VD3A 5GGRY 1HXMA 4MLSA 3WUWG 1J12A 2NNAB 4YNYB 2VLKE 3BKYL 3QHZH 1A7BA 1CT8B 3RIAK 4G8EA 5BO1H 4CMMA 2BVEA 4S1SL 3VRLE 1YPZE 1RZ8A 4C4KT 4OIAA 3HC4H 5I18L 2ATPB 4MQSB 5CIPH 3RWGB 2H9GA 2RFXA 4Z0XA 1FO0L 4V2CB 2HVJA 2LE9A 5D6CB 3S4SG 3UPRB 4KFZC 4PJGF 4GMTH 1ZV5A 3QSKB 4KV5E 1U6AL 5JO5A 2DQGH 5DR5H 1X7QB 5DGRA 4X6CA 4H20H 4P59L 1KN2L 4XPHL 4ZNEA 3EJYD 2AVGA 5DI8A 3LKRA 5F8QC 2JB6A 2Z8SA 1G1CA 4AJ0A 3EO0B 4WUKL 2X4SB 1C12A 1P2CB 2H45A 4E0RB 3QUMB 5EO0A 3RVUC 4JO2H 2Y06L 2AW2A 5E8DL 2Q76B 4PJXA 1MQ8A 3MV7D 3VWJB 2PR4H 5E2WH 3LPFA 2E5EA 1J1PL 3TT3H 1N64L 2IGFL 4GW4B 1DQDL 4IRJC 4BM7A 2C5DC 1JZ5A 3KPQB 3CH1B 2FD6L 4WCYH 4Y19D 4Y4KB 4KQ3H 3P4LA 3WYRA 3IF1B 4L8SA 4AEHL 4OZIA 2ZJSH 5D96B 4IDJL 4GRWE 2FRGP 4KTEL 2E6PA 2HP4A 5DRZA 3AC0A 4J4PC 4JJ5A 3WS3A 2HH0H 4F58L 4RFOH 5HYJE 2G5BB 5JQ6L 1DEDA 4NNXB 3MOQA 2P5EB 1BPVA 4XCYA 1B4RA 3DV6B 3H3PL 4M7LL 1N3NA 4K3HA 1E28B 5T3ZH 2EIBA 4ZS7H 4RNRB 3WJLA 2BDNL 3SDXA 1NGQH 2R69H 2FJHB 4FQJL 2Z35A 3F7PC 2VZUA 3WFBL 2JJWA 4JQXA 4DTGH 4UUJA 5DXWA 4UMGA 3F12B 2GCYB 1EHXA 2D7TL 3CFJA 1QBBA 4QHKJ 3OJDA 4ZQKA 2PO6A 4LSVH 4FZEL 4P4RA 3GSVB 5DRWA 5JR1H 1U58A 1YZZA 1NGYA 3PJSA 2X4UA 4J7RA 4LPWA 2PYFA 1N4XL 2E7BA 3MUGA 5HYSA 1XIWB 2DQJL 4PRIB 4NNPL 5JW5B 4I1NB 1VEOA 3QIUB 2XN9D 5CIPA 5C9JA 4R3SA 1PKQA 1XF2A 3PDOB 2NY6C 4I4WA 3W9DA 2AEIT 1YEKH 3MA7A 5ANMA 4WDIB 1NMAH 5C0IA 4Z7UE 1AY1H 1FYTE 1S7SA 2PUQT 3T65B 4WWID 5D5MA 3ELAT 5EULV 4LP5A 1JGVH 1ZSDB 2QSVA 4KJYA 1F5WA 4U1MA 4O02L 3BUTA 1UH3A 2C26A 1IGTA 4XWGH 4G9FD 3P0GB 5C6PB 1ZA3B 4Z9KB 5DDHA 4TUOA 1AJ7L 1KT2B 4YHNB 5HDBE 3QB7C 5D93C 4KKCC 2WUCL 5C0FA 1XGYL 1DQTA 4U3XA 3WXWL 3CXDH 1FGNH 4MNQD 3GKWH 5LJYH 3QAZC 1G1YA 4OI7A 1I7ZA 1N0XL 2AV7B 2V2WB 3O41A 3DSNA 1DR9A 4G5ZL 3FL7A 2XPGB 3TM6A 4DW2L 2O5ZL 4S0SD 4FTVE 4K7PX 3C60B 4Z7VA 3P0YL 4U1IA 1T66C 1C5DA 4KDVA 4ELMF 1OQXA 3DUSA 3VDBA 2G5RA 1N5YL 3Q6GL 5CEZL 2UWEE 4NFCA 1B4JH 4OCWL 3QNXA 4V1DA 4Z7WA 3A6CH 4PY8I 4MX7B 1PEWA 3LHPH 4HIEA 4YIQA 4YR6A 1HEZB 3GMMB 1YMMB 5D71H 2R1XB 3B3IB 4FXLA 3QG6B 5ADPH 3IDNB 1ZA6A 3QPXH 5I8OL 3EYVA 1HQRA 4FFWD 4NNYB 3L5XH 3QO0A 1BMGA 3C08L 4LCWE 3V6ZA 5HGDA 5FYKD 2ERJC 3K8LA 2OYPA 1I8IB 2FLBT 2NCMA 5EU6A 1Q9LB 4CGTA 3MCLL 3W0WB 2BVYA 2N1KA 4P5TB 3BSZH 2DJSA 3RVUD 5C0CD 2I9LB 4UDTB 4LLVB 5B39B 4P48A 5GJTH 1FNGB 1CYGA 2R0ZL 3WMSA 4MQTB 5E99L 1T03L 4FP8H 3VXMD 4HXAH 5GZND 1LO5B 5A16A 1XGRB 5MHSE 2IANE 3KPMA 3I6GB 3PABB 3VRJA 2OSLB 3BIBX 2K9UA 5GGTH 1QFWL 1YYLH 4G6FD 5I75B 4HCRH 1CU4L 4AM0B 1TTUA 4MJID 3ARBC 1EAPA 2JJSC 2X4RA 4ZPVA 1YEEL 3DX7B 3IKKA 3IRZA 3MNWB 1X6LA 3MXVH 1OAQL 5DFWH 5A1AA 3L6FA 1SYSA 1S78D 2EYRB 2J6EH 2JF1A 3LRSA 1WTLA 4IIQC 3AU1B 1LP9F 4JRXE 5IVZA 5E2UH 4D94A 4Z18A 5CS7A 3WN5C 4OV6F 4HEPG 2CMRL 3LEYH 1OVZA 5EBGA 4B5EA 3C8KA 5FKPB 2FEEL 4XPGL 2NYYC 1GGIL 1A64A 4NKQB 4RGNE 3VFVA 3STLB 1B0RA 5D7IF 4Q97A 1S7TA 1AGBB 3BGFB 4FS0A 5E6ZA 3DURB 5LAXA 1HH9B 4MAYB 3QNZA 1BJ1H 5ISZE 5EWIH 2PCPB 4BUGA 3REWA 4NJAH 2H1PL 4JDTL 3EYUL 4EUPH 4OF3A 3WFCH 4FZ8H 4YXLH 4OGYL 4ORGB 1P6AB 2ZUQC 1LEGA 5A2JH 4DUVA 2YMXH 4QWWC 3VXSB 4WHTB 1NAKL 3VWJD 4PJAA 1RAMA 1A6ZA 2CUHA 1GGUA 3FQTA 1VHPA 3JZ7A 3WDIA 4NOBA 4ZSOB 1PJ9A 3QO1B 4D0BB 1K4CB 5J7CC 3FN0L 4OQ1A 2X4TB 2YA1A 2D7PA 1ZE3C 4RFEA 5D7SL 2EDRA 4F37F 4QHLB 4NKOB 2Q7NA 1J5OH 1UXWA 3UX9B 5E6YA 5HD8C 1Q9WB 3DETD 2OTUA 3S98A 3VXQA 4KZDL 4PRBA 1FDLL 2P5ED 3G5XA 4NCC1 3D2UD 3NTCH 1W72B 1SJEA 5K9KA 5E8EA 2GFBA 3NCCB 5JHDB 3W5NA 4R7NA 5M7QA 4KVCL 4XC3L 3KPOB 1XH3A 3OV6A 4DFIA 2V2TB 3QUZC 3DXAB 1UM6L 3NIDE 5SWSA 4LCYA 4RIRB 4X7EC 5GGTA 4FQCL 3GJEA 3HRPA 5MI0B 4UQ2B 1NMCB 5C86A 5D70H 4JFDE 3B43A 4KH2A 3H9ZA 1R3HB 1OSPH 1BD2D 1UCBL 1YECL 3ZL4H 1KEMH 3O6LH 4NSKA 1TJIH 3Q2CA 5F96L 5J0BA 4I3SL 1QLRA 1TQBB 3HUJA 5KG9B 2AKRB 1MCEA 3QRGL 4MSWA 2VDOL 5FV2A 4NO3B 3KPSD 4DQOH 1DBMH 1CDYA 2F53B 4X6BA 5HI4D 5L6YH 2OL3A 4PRID 4Y5VC 1U91B 4EVNB 4HXBH 4QRQB 4PGCA 3H42L 4NJ9L 4TTDD 3HZKA 4XPTL 2V5SA 4I0KA 4X8JB 1F2QA 1I7UA 3P11L 3VXRB 4PBWD 1MCLA 4GKSB 5CP7A 1A6AB 1MCJA 5KSBA 4ZD3L 3MGAA 3WFDL 1MFBL 1F97A 3OPZL 5DJYB 1YY9C 2CPCA 1A3LH 3CXHJ 4POYA 3QEGL 3FQUB 3IU3B 1MCWW 2B39A 5C6TH 4KUCF 3LKSB 1OLLA 3BQUD 5DYOA 3CFIC 3B9KC 5IW1B 4QHNA 3G5VB 4U6HA 2IAMD 3EOBA 4OFVA 4PLJD 5FKAA 1I7TB 5FK9B 1B6UA 3RWDA 3S6CA 2YRLA 4OGXL 4EUPA 2IPKA 3RZCA 5B38A 3RGVA 2HJLB 1KIRB 4GH7B 1OB1B 4K7PH 3ZDZF 4WW2F 2YD4A 2P45B 4DOHB 4XC1H 4PJBE 5KTEH 4FABL 2WBJC 2CRMA 5I1GH 2DQHL 5TE7L 4ERSH 1IGJB 4F9LA 2G2RB 4ZXBA 1OAKL 4ODUB 4U6XB 4Y5YC 5TQ0L 5AD0B 1MRFH 2ITDB 2R2CA 3OJ2C 4L9LB 5F1IA 4FXGA 4NO5A 4LQ1A 1I1CA 5HJ3A 3HRZA 5KVGH 1UB5A 4LPUA 1XGUB 4ZS6D 4YUEL 5I76B 1JGDB 4PTUA 2IC2A 2VDPL 1JZ2A 3WNOA 2R29L 4YDJB 2HKHL 1OOAA 3ARBD 2BCKA 5A2LH 1NDGB 3Q3GB 3G6AB 3ARQA 5J13B 1RIVH 3FJTA 4OD1H 4LPCA 3NIFF 2BVPA 1AP2B 4KHXL 1FVCB 3BE1H 4OF0A 2GJJA 4F9PA 3O11B 3K4ZA 2QQQA 1ZKAA 3SE9H 5EBWB 2HN7B 3MLVL 1UZ6F 2VLJD 3IJSB 4XXDB 5GS0D 1RJCA 1IAMA 5EDXA 2YWZA 4W4OC 3D18A 4JKMA 4NDMB 2F74B 3T2PA 5L7XH 3QNYB 3JV4A 4J8RB 3QIWC 3ULVF 1LEKB 1IEAB 3O81A 5CD3A 2ZPKH 3ARGA 1KB9K 2HKFH 2AJYH 4XRCB 4M03A 4OZHB 2IMNA 4XNZC 1U9KA 3LEVH 4JLRA 4U1KA 1ORQA 1CFVH 3T2NL 1NBQA 3BIKA 2NY1C 4NQEB 3KYMA 5IMLB 2DQIH 3UC0L 3ZDYF 1T89C 3OGCB 3IFLH 3SJVD 1F4YL 3BPLB 4HIXL 43C9A 4UV7H 1D5ZB 4YDLC 2EDNA 1AGCB 5CWSA 5FA3B 4EXPX 5JW3H 2A6KB 3LEXB 2CJUH 4KROB 3PQYB 5T1MA 3DROA 4JAMB 1JGEB 1RFDL 1BQLL 25C8H 1CCZA 5DD5H 1MAJA 1FE8H 3ILPA 5C07A 3WO4B 5JIPA 1IGCL 5L0QB 1RUQL 1L7TH 1NC4D 4D0DB 4OD3L 4HUWB 2J8UB 3VFGH 1G9MH 3ABZA 5DJ0A 5E8OA 5IOPA 2IJ0C 4Y5XA 5F9DC 4YGAB 4G6JH 4Y16C 1N5AB 3EBAA 4ODHH 3UJIH 4JFZL 3QZWB 1A6UH 1R3JA 2Y7QB 4K9EC 1M1SA 5CSGA 2FDBP 3TNNB 3QHFH 3MA9L 3TFKC 4KQ4H 4LHUG 2XZCH 4MAYD 4JGMA 3HZVB 1CXIA 3WD5L 1GCFA 4BKLB 1WBZA 2D2OA 3OZ9L 1DUZB 2HT4D 3JV6B 4JR9H 5T3XL 2X9YA 4WU7A 1NCCL 5JIIA 4BFEA 1MRCL 5SX4H 3SQBA 5F1KC 2HMID 2ZUYA 3KPRE 3OGOE 4I3GA 2NXYD 1IMHC 3BKYH 4P4KB 3G5ZB 3FAWA 3VXSD 5F72S 1TPXB 3QA3B 4P2RB 1CGSL 1ACYL 5DMJB 5E7BA 4PGEB 1BQUA 4RQQB 3MBEC 3ZSSA 4S1SH 5DZLA 1CL7L 5I18H 4NQSB 3VGBA 1IBGL 2DIJA 4DKDC 4Q6YA 3QH3A 4YHPA 43CAB 4DKFH 4KJPD 2EO1A 3BZEB 2YXFA 5E1AA 3CX2A 2PF6A 1IEBA 3RL2B 1U6AH 3MUJA 1CD0A 4PJGE 5GGVL 4WW2C 5BRZD 4JN2B 1B9ZA 3KJ4B 4LDOB 2X1PA 1KN2H 4P59H 5FYLE 4XPHH 5LCVL 1IJ9A 2WIMA 3REVA 4KKBC 5JHDD 1QUNA 3UTPD 3U7AA 2G60L 4WUKH 4UQ3A 2NZ9C 1T4KB 5AZ2L 4MVBD 2J88L 1J7VR 2AK4E 2Y06H 4NQCB 5E8DH 4L4VA 3OX8A 3WO3B 3QP3A 1HN1A 1J1PH 1F3RB 1N64H 1KTDA 1SMAA 2IGFH 2VL5B 1DQDH 4JEGB 3TPUB 4PTTB 2FD6H 1U8QA 1T04A 3OF6A 5CUSL 3BKJL 3IVKA 4PUBL 8CGTA 4QRSB 4UBDD 4AEHH 5IG7B 3TJEL 3DVNA 4NQDA 1JRHL 4KI1A 3HI6L 2AI0L 4IDJH 4KTEH 5T1LA 5CKAA 3KG5A 4H26B 3VFTA 1G7LA 3ORJA 1LQSR 1N6QL 3I75B 4OAWB 1U8JB 3PL6C 1ZLUH 4UTAL 5JOFA 4ODXA 4Z77A 4F58H 3SDAB 5EORL 5JQ6H 2VB5A 3CMGA 3IDYB 3VFOB 1C16A 3VXRD 3V5DB 5HHOE 1UKQA 3RJDA 3BDBA 3QULA 1J10A 3H3PH 4QXGL 4L3EE 4M7LH 2BX5A 4X5WB 4QEGA 2ZP0T 4BH8B 2BNUA 1I1FB 1U93A 2BDNH 2H8PA 5TDPA 3ULVC 1KG0B 1OAZL 4FQJH 3RQ3A 3WFBH 3ZT5A 3TBTB 3NFNB 3TYFA 2VLLA 1JVKA 2DRUA 4MNHB 1DN0A 4M43L 2D7TH 1QLEL 2UZIL 4KKNA 4FZEH 1UH4A 5B8CA 2MHAA 1AR2A 3M1BB 1KYOK 3DGCR 4MCZB 5EOCJ 4N8PA 3PP3H 1MY5A 1YEFL 2BSSA 1INQA 4E42B 3DV4B 1X3DA 3IDUA 1N4XH 1PZ5A 4ZAKC 3H9SE 2DQJH 4IOIB 3TC9A 4EI6A 2D7NA 4NNPH 3UBXA 3GUTB 4AEFA 2P5WD 5D2LF 1TCMA 4JRWA 4Y4HC 2VDLL 4HKBA 5EZJB 2IFFL 1S9VB 4N0UE 3ARDA 1ED3B 1UJ3A 3BH9A 4S1DC 1GVIA 5J1AA 3O3BA 1KACB 1WC7B 1RK1B 3VFNB 5KS9F 3DBXB 3PNWB 4XPBL 3D3VD 4HKZB 1HHGB 1S9YB 4GW1B 4O02H 3SDCB 2WUBL 4UNUA 3FB5B 1Q9KB 2XV6B 5ICXB 1AJ7H 3DI3B 1FAIL 4J3OC 2WUCH 2IALA 5J1SC 1XGYH 5CZKA 4QRPA 3BZ4B 4ELKB 4M4PA 3VD5A 1GHFL 1UT9A 3MRNB 1N0XH 2X4NA 4I0PA 4WFFE 1NJ9A 4G5ZH 5TH2A 1T6VN 2R2BB 4DW2H 2AS5M 2O5ZH 3SDDC 2YEZA 4BFGA 4BQ6A 5DJDB 4Q9QL 1F45A 1U92B 1R5IA 4NT6A 1G9EA 2C3HA 3P0YH 4MYWB 3MRJB 3T0WA 3ULUD 2R23B 3MGOB 5MENE 3M45A 3UROR 4BH7A 4P46D 3QJHA 3Q6GH 5E00A 3IGAB 5DQ9B 5CEZH 3UDWA 1N5YH 4PJ8B 5IP4A 4OCWH 2OTWA 2ZOKA 4U4BA 3VXOA 5ESVA 3QXDA 3MRMB 5IW6A 3WUZA 3O8XC 3HA0A 5M95B 1JTOA 4NZUL 5E4EC 4Q6IB 1JNNL 1NEZB 4KUCD 3JUZA 4GXUN 4EQ3A 4GRLC 2DL9A 4ISVB 4X6DA 5ICYA 3CZJA 3OKEA 1HHKB 4PJDF 4Z8FL 1ND0B 4PJ7E 3NA9L 1HHJA 3NZ8A 1RJZB 5DA4A 1QHOA 3PQYD 5IMMB 4JKWA 4XCEA 4H5SB 2VDKL 3BWAB 2X09A 3C5ZD 1K2DB 1LNUA 3QEQA 3LMJL 3C08H 5SWQB 1ZVSA 1WFUA 1P6FA 2KBGA 1DVFA 5H94A 1QRNE 3MNVA 3O9WA 5IB4A 3MCLH 3CUPA 1OLZA 4ODVL 4KGLA 4DAGL 1BECA 1KJVA 1XCQA 4OCXL 4EN3C 4J12A 4LEOA 5D7LA 2H26B 3DTXA 5IEKB 2R0ZH 5EC2A 3ZKND 5INCB 5E99H 1T03H 1SJHB 5ESAB 4XP6L 2ZUTA 4JY5L 1CDJA 4ZPTA 2QQLH 3BVNB 1NBYB 1QFWH 2ORBL 3OJMB 4XZUB 1EHAA 3D39E 3QYCA 4CJ1A 1CU4H 1MHHB 3QI9A 1JPTL 1MIML 2NR6D 4XNQA 3VMOA 2EXYC 3O3AB 2M26A 1J86A 1T1YA 2APBA 4IS6B 3RUGB 1YEEH 4TYUA 3WFHA 3HG1A 4J3VA 5DJCA 1OAQH 1QSVA 1B6DA 5IB2A 4XB7A 5EBMB 3IDGA 4L8CA 5D7JB 5IEHA 4K3JL 1U3HB 2J2ZA 4QY8B 1LP9E 2G75B 2CMRH 2NY5L 3HS0A 2W65A 4K3GA 1LEIA 3QFJA 4M6MH 1ORSA 3I85A 5J12C 3KLSA 1UVQA 3GJFB 3KLAA 3RTQB 4XPGH 5D1QA 1GGIH 4RZCA 3P4MA 4KDTA 4PJIF 4RRPA 4CNIB 4ODWA 2OQJA 1WZ1L 1CFTB 4GRWH 2KUTA 4C54A 3DECA 5E9DA 3TO4C 4C59B 2G9HB 3O45B 5D7IE 1AD0B 1G7HB 3LV3B 1WT5C 4AZ8A 2H1PH 2W0PA 4JDTH 3EOAA 1RJYA 3EYUH 4JFHE 4WUUB 2QL1A 4GSDL 5HHVL 2J4WL 4ZAKD 2D0HA 3K1KC 4I9WD 5E5MA 4OGYH 1P4IL 3I2CL 5IJVA 4NQCD 2CIIA 3PGCA 2M2DA 1FO0B 3MMEA 1F3DJ 2XT1B 3FRUB 3O2DA 3TN0C 1NAKH 5TJWK 2YD3A 3CSYB 4O2CB 4LFHD 3QZWG 4MJ5A 1MCPL 2H32A 3WIHL 2DIAA 1VEPA 3FN0H 3SE4A 2NY0C 4S1DD 1QVOB 2VLKA 4ZFGL 1AO7E 1OF2A 3C6LD 5D7SH 5K33A 3N1FC 4KK9C 1TVDA 3ECBB 4MMZC 3ARUA 2VXUL 3H7LA 2B1HL 3M8OL 4KZDH 1NAML 2JCCE 2FECI 1YPZA 1FDLH 1NGXB 1RSFA 1ULVA 3AS3A 5DJZA 1KIPA 4APQB 4C58B 3BGMA 4N9GB 4PRAB 5DJAA 4LHJB 5KSVA 4KVCH 4XC3H 3SE8L 4PYGA 1J8HE 4WIQA 3ZTJH 1S8DB 3CVHB 1UM6H 4JPIB 3VU2A 1N8ZB 4LVEA 4FQCH 4KJWD 4TUJB 5EOTB 1DQQB 1AHWB 5L2JA 1MJJA 4JO1L 1UCBH 1YECH 4D0CA 4I5BA 5F96H 1ZHKB 3CD4A 4I3SH 3QRGH 2JELL 1MLCA 2VDOH 4HIJB 3R8BB 1HE7A 4TOYL 3UCRA 4KJQC 5FO9B 3H42H 4NJ9H 2YPVL 2WLYA 4XPTH 4YHKL 5IBLC 3P11H 5JW4R 3AREB 4HV8B 4P3DA 4QRRD 4P3CH 4HJGB 2BVUA 3WFDH 4ZD3H 1MFBH 3OPZH 2A6IA 1RU9L 5EZOL 3MRRA 3PUCA 1TENA 5DD3L 3BIAX 3QEGH 2FH6A 1FN4B 1FVDB 5F7DA 2OMBA 1EVTC 2X1WL 4JPKL 4XNXL 1ITBB 2A2QT 1K6QL 1AGDA 3E1F1 4Z7OE 3TZVB 5HYJA 3VXUE 2OLDA 1Z0NA 3D5OF 4OGXH 4OQTL 3MFGB 2SEBA 4ODTL 4LPYA 5EFIA 5C7XL 1BOGA 3P2TA 4HS6B 4GRMB 4ZUWB 5TGBA 4MQXD 2DWDA 3CCHB 4D9RD 2FIRT 4NFBA 4K8RD 4F7PB 1I1YA 4FABH 5ICZA 5ID1A 4U1SA 3ZDZE 2DQHH 4UDUA 2J8HA 4HWNA 5EUOB 5TE7H 4AIXA 1R0AL 2VZSA 4FQ1L 5K9QI 4U2YA 1OAKH 4N0FB 1OTSD 3AVEA 4X4ME 5TQ0H 2BVQB 4KKAD 2IQAA 1WCBB 5C0BE 4YUEH 1HCFX 1MOEA 1QSFE 2EDFA 3T0ED 2VDPH 3CFCL 5IFAL 2R29H 2HKHH 2C3VB 3ETBF 3FT4B 4ZG1A 5J6HB 3MRKA 1NUFA 4LU5L 5EZIL 4JM2A 2BOBB 2Y07L 3IDMA 3MRDB 1T21B 4UT9L 4HG4J 2OBGA 1JFQL 4PJ8D 1SY6L 4U1GC 1V3LA 4X6EA 3DSFL 4NYLB 4KHXH 1I1AB 3KLHD 4M61B 1I9EA 4P2OA 3RKPA 2Y36L 2R39A 4TVPE 3X12A 4R4BA 2BERA 1K9TA 4HMDA 4PJ9D 3RNKB 3MLVH 2J5LC 3T0XA 3QUYB 2CDGA 3RWCB 5ITBL 4Z7UA 1FYTA 2H2SD 4N0YL 1BLNB 4Y4FB 1EMTL 3GHBL 4DUWA 3TBWB 1F4AA 3VFSB 3ULVE 4PP1C 1RZKC 3FO2A 1A9EA 4R6UA 5E94B 4JY6A 5I1DA 3V5KA 4CKVX 3T2NH 3GKZA 4HJJL 4L4TB 1FV1B 2RCSL 4QGTA 4GUPA 1IGYA 1CFSB 2ESVB 5DJ8A 1M05A 4PG2A 3ZDYE 1F4YH 4HIXH 4FTVA 5FM5O 3ARRA 1JPGA 3V5HB 4P2QB 2CO7B 1BIIB 1V3MA 4LLMB 3U9UA 3DHJA 1F11A 3MV8E 2EE2A 2FO4B 3VXNB 1NCBL 2AEWA 1VACA 2UWEA 3DNKA 1RFDH 1BQLH 1KJ2B 1CZ8L 4BQBA 4H8WL 1B90A 1IGCH 1RUQH 3VFUA 3IFNL 2VWEC 5B3JE 4XVJL 2FZ3B 3OKDA 3AAZA 4OLWL 2ILLA 1SM3L 2YRPA 3DOSA 2Y9RT 4C56D 1X44A 3ESVF 4U6YB 1AR1D 1T0PB 1IGIL 3FT2B 4GW5B 3RTQD 5T1DL 4JFZH 5E0QA 3FONB 5LWYL 4TSAL 4LBEB 1EFQA 3D9AL 3MA9H 5C0NC 5DMKB 3KPPB 4LCWA 1IAOA 3QRFM 1KUMA 4HD9A 3BDXA 3HLAB 2F15A 2ZUXA 1NC2D 2DYPB 3WD5H 4YAQB 3OZ9H 1AGEB 4LOUC 1SBSL 4TPRL 5T3XH 1VFBA 1YC8A 4PJXF 4WUUD 5HVGB 1NFIA 1NCCH 2DBLL 3I3DA 1JWUB 4XVUC 1MRCH 4R9HA 2VR9A 4P57B 3PGDB 3NGBB 5E8PB 3B9VA 3HTLX 1CICD 5TDNB 4YPGB 2W9DL 2PW1B 1K3IA 1T7ZA 1LK2B 1N6UA 3HE6B 5L9DL 2ENSA 1HOCB 1JHTB 2KKQA 4EJ1C 5C9KA 1ACYH 2LVCA 2IANA 1CR9L 4Y4KC 3ZZ1A 1WAAF 4DEPB 1HYSD 3SE3C 3CMOL 3DX8B 1U8PB 3RVVD 1CL7H 4MD0A 2Y1VA 3NAAL 4FXKB 1IBGH 4I77L 4LF3B 2GITB 3OXRA 4PRPB 3TVMB 3SKMB 1NLBL 3K46A 4RAVA 4XVSL 2E9IA 5AYUL 1CD1B 3NVQA 2PTUA 4I18B 1ZLUK 1VESA 1ODAA 5C08B 5GGVH 2ZCKL 4JRXA 3D48R 2C7UA 5LCVH 5HVHB 4RX4A 3IJHA 1GJIA 1HXMB 2F9BT 3U4BL 4K71B 2G60H 1S7RB 3RWJA 1NUNB 5C0DA 5AZ2H 4I2XE 2J88H 1INDL 2XOTA 1G7PB 2FHFA 3FZUD 4EEEA 5EIIA 1XGTB 5ISZA 1HDMA 2BC4B 5JW4M 4M9OA 2EIZA 5CUSH 3BKJH 1S7XA 3PWLA 4PUBH 5DZOA 2RFXB 4Z0XB 3T0BA 2L7UA 1NQBA 3TJEH 4KKLD 1JRHH 1XIWC 4NKMA 1ZAGA 4JB9L 3HI6H 3PP3K 2AI0H 2EO9A 3QIUC 1MJUL 5FA4B 4LCCB 5EG6C 4MAUL 3LQZA 1N6QH 5JO5B 3PWPE 5ENWA 5INDB 3V4PL 5CLTA 4X6CB 1HQ4B 5GS2D 4UTAH 2APFA 2WV3A 3LKNA 5EORH 3WEXB 5DI8B 5H35A 2JB6B 2GY5A 5D5MF 1IEHA 5E6IA 3VGEA 4WEBL 4WV1A 4QXGH 4Z76B 5EO0B 3LRGA 1PQZA 4R2GB 2X4PB 1JZ7A 1I8MA 3N0PB 1OAZH 2NW3A 3TCLA 1QSEE 1A02N 2CR3A 1KCLA 4G6AC 1E6OL 3HCVB 5JHLL 3BI9X 2YD7A 4M43H 5DJ6A 5D1ZA 5B3NA 2VXQL 1QLEH 2UZIH 1W0YT 4L8SB 1XR9B 3MRFB 5HHPB 2X41A 3DX9A 5DRZB 5F89B 1CLOL 1YEFH 5F97E 1YEIL 4K94C 3JWDC 1ZT1B 2HFFA 4AY0A 1CDGA 4PV9A 2XXMB 5BCAA 2VABA 3F7VB 1VFAB 3C60C 4I8DA 3KJ6L 4XCYB 4JFDA 1AKJB 2R9HD 4GT7A 1ZANL 4OIIL 5FB8A 2VITA 3EOYG 4GFTB 5FO8B 5FYJD 2VDLH 1R3LA 2R0WL 4LSSL 3FN9A 4UOJA 3MSPA 1TJHL 5D2LE 3SDXB 2X2YA 2IFFH 3TBVA 3U0PA 5EZLB 3ARFA 1JGLL 2K7QA 3P40A 4KVNL 4OUOA 3RY6C 2ZKHL 1R5WB 1QNZL 1G9NC 2A77L 2C3XA 1AI1L 2WIIA 4ZFOA 4AH2B 4W81A 3FQWA 4XPBH 2RAMA 1S7UA 3OJDB 2PO6B 5KS9E 4NIKB 3NACH 5IF0B 5IB3B 1QQDA 4JHWL 2WUBH 3QUYD 4G8IB 4BQ9A 4BFIB 5JDJA 2X4UB 5IWLC 3GNML 3KPNA 5ADOL 5EUKA 1FAIH 4Y4FD 3MUGB 3U30B 1DUYB 1GC1L 1X5YA 1N59B 1GHFH 5ERWA 1EFXA 5JXED 4P5TC 4QRTA 4G8GD 4MS8D 1CE1L 1MCRA 1RURL 4WFGE 2X4QB 1MHEA 2Y6SD 4Q9QH 3MA7B 3SGEI 5C0IB 3CU1A 4ORZC 1E4WL 4PJBA 5EO9A 4KTDL 2BNQE 4NN5B 2VUOA 1H8OA 4F15C 4FQXB 5FDWB 1INEL 5I75C 4KK6D 4OZGB 2ESVD 3M07A 4KJYB 3NN8A 4NZUH 4U1MB 1AD9B 1JNNH 4JN1L 4WGWB 4P2QD 3FHQA 3UP1A 3P9LA 3WNPA 3VRIA 1PGRB 2C1PB 4Z8FH 1MI5D 3NA9H 1XF5B 5ELIA 4H0IA 3M17A 3CVIL 5GSVA 3PXHA 4UIMB 4IRJA 2VDKH 4PJDE 4JZJB 5FGCE 3WJLC 3VG9B 2XWTA 1I7ZB 4LSDA 4UV4L 3LMJH 1WWBX 3GM8A 2DD8L 3TA3A 3U1SL 2Z31D 1C7TA 3WIFA 1Z3GL 3BPOC 3GEWB 4Z7VB 4ODVH 3BMVA 4U1IB 4DAGH 2NW2B 4J4PA 4JVWA 1C5DB 4OCXH 5FECA 3FFCB 1NBZB 1I3UA 1F6AB 2BRRL 3BGFC 2ARJB 3MRBA 2KZ1B 4WO4B 1RZGA 1ZWIA 4H1LH 4JFQB 3AFLA 2YD9A 4Y89A 4XP6H 5DUPL 3RRQA 4AQOA 4G42B 4HIEB 2WAHA 4JY5H 4YR6B 4YIQB 3F7QA 1ETZB 1HKLL 3PV6A 4KXZH 5DUML 2DQCL 2FJGA 2F58H 2ORBH 4JPVL 3IKCA 3B2VH 1JPTH 1MIMH 3EYVB 1HQRB 1VADA 1CDIA 2WINA 4GMSL 3HE6D 5IT2L 1JYVA 5D6DC 3QXAA 3V6ZB 5KSAC 5I6XB 1MHCA 5EU6B 3B8YA 3IAGC 1PYWB 3KYOB 3V9FA 3R1GL 5IQ7L 1Y0LA 4OM1L 4U05A 5HPMA 2NY5H 2DDQL 3B83A 4PRPD 1M7IA 4Q58C 3INUL 4L8DA 1BX2A 1P7HL 2YKLL 1QA9A 1IAKA 5HBBA 2XZZA 3KPMB 1CDBA 1WZ1H 4PJIE 4N8VA 1LE5B 1XAUA 4MZ2A 3L9RA 1L0XA 1XF3B 3G6JB 3P4NA 1AC6A 1T83A 5TPWL 4GSDH 5CD5D 1EAPB 2J4WH 4D9QD 2APTA 5T5NG 1PD6A 3EO1A 1X4ZA 1P4IH 3I2CH 5HHNB 2UUDH 3LKOB 1HXYB 1BP3B 3H7BA 3HFML 4YEEA 5I74B 5I9QB 1FLRL 5IVZB 3LRSB 3K8KA 5K59F 3BDYL 1KLGA 2EIDA 2N4IA 4MA3A 5JXAL 1UQSA 4M1CC 2VL4A 1MCPH 4ZDHB 3WIHH 1TQBC 1DBKL 3CXHK 3O4OB 3KYNB 1WLHA 5DQJB 3GRWL 1DN2A 3VFVB 2DOCA 4ZFGH 4ONHA 1I85A 4EDXB 3PHQB 4QCIB 5LAXB 1KULA 5IB1B 2VXUH 5EU5A 2B1HH 2Z93B 1NAMH 4YDVA 3ILQC 2F54B 4BSWB 1TZHA 2A6DA 1U2CA 3N1QC 2A9ML 4PREB 3BEWB 4PBXA 1T3FB 1RJLB 1X4XA 4M8QA 3SE8H 5D1XA 2OCFD 3L3GB 4OV5A 4EZMA 2VWEE 4D8PB 1OL0A 1AC0A 1AQDB 3BESR 4PJAB 1A6ZB 3HNTL 1D6EA 2GSIA 4PJGA 4JKPL 3BAEL 4OKVA 1FL3A 1SEQL 5E24E 2LU7A 3GO1L 3HAEH 4JO1H 4PRDA 1CGVA 2JELH 1HWHB 2AK4A 1J0HA 4Y1AE 5JMOC 4A2LA 3MROA 4ZFZA 3VXQB 4TOYH 5A3IC 1Q38A 5SV4A 4PRBB 3JVGC 3KPLA 2YPLB 4A6YL 3H9YA 4OTXL 2DWEB 1SJEB 2YPVH 5K9KB 4IRSB 3G9VA 2GFBB 4YHKH 5J13C 4S11A 1GIGL 1KCKA 4Q9BA 1RU9H 5EZOH 4IHOA 3QDJB 5DD3H 5HYQA 3OHXB 4LCYB 4DVBA 4XAKD 3BHBA 3GJEB 2A0LD 3DYOA 4JPKH 5KANI 4ZTOL 4FMKA 4XNXH 1EEZB 1K6QH 2VXTL 1NDMB 3U0TB 4OQTH 2PO6D 4ODTH 3ZTJG 2JJSA 5C7XH 4NWUL 4P5MA 4XNMA 5HHOA 2P5EE 4NSKB 2DM3A 3MJ8A 4L3EA 3VCLA 4IIQA 2F8OA 4WI7A 4XCNA 1R0AH 2DTSA 4FQ1H 2OL3B 3WN5A 1CFNA 4PGCB 4OLYL 3MCKA 5GGSY 3HZKB 4DKAA 3CFCH 5IFAH 4MCYB 4EIGB 3HN3A 3RZWA 3P9MB 4H25B 5KSBB 1JZ6A 1C08B 4LU5H 4LP4A 2FJFB 5F7KC 2Y07H 1RUAL 2YUZA 4U1LA 4UT9H 2X7LA 4NRXB 4KRLB 1JFQH 2GUOB 1SY6H 2CK0L 4U6HB 3H9SA 5J89A 3EOBB 3DSFH 3UTSB 3RWHA 2X05A 2EKSB 4CAGA 2Y36H 2AGJL 5B38B 3RGVB 4PRIE 1KPVB 4KROC 3N06B 2FLRT 4YFLF 2J12B 2UY6A 5J9PA 4N0CC 5ITBH 4YE4L 4MXQC 3WO4C 4N0UA 4N0YH 1EMTH 4FXGB 3GHBH 4XWOD 3HRZB 4IOSD 4ZNCD 3S3JA 5HDLA 4QXTA 3FCTB 3R4DA 1IGML 2BCKB 1FG2B 2Z4QA 3MLYL 2HVKA 3C5SA 3EZJB 4QLRA 4HJJH 4R4FL 2BVPB 3PWUB 1TVHA 2AJZA 2RCSH 4V1DD 2OZ4L 2DQEL 2ICWJ 4YXHH 2YK1L 1YNKL 3BP6A 3QUZA 3VWKA 3L7EB 2IADB 3KHOA 4NC2B 1QPPA 5GS1C 2OI9C 3OKKA 3E2HB 5I2IB 5FYKL 5GGRB 2LVEA 3X11A 1NCBH 5MENA 2GI7A 2XY2A 5FFLA 4A2MA 3JV4B 3E6FA 1CZ8H 1QLFB 2DN7A 1JNHA 2EYTA 1OGAB 3C9NB 3QEHB 5EU6D 4AG4L 2XACC 4H8WH 3UPAA 3IFNH 3GMLB 4XVJH 4OLWH 1SM3H 5TDOA 2HRLA 3RL1B 3SOBL 1IGIH 2AABL 2VISB 4PJ7A 4Y5VA 1T1ZA 1YMME 1A5FL 5T1DH 4QF1A 3RY5A 5LWYH 4O00A 4TSAH 3D9AH 3GB7A 5D8JL 3VFRA 2QTEA 4FQLL 1G6RA 5KW9L 1OTTC 3BD5A 3G04A 3AS1A 2W07A 3RA7L 2ICEA 1QRNA 1J0KA 4TPRH 3KYKL 1SBSH 3S96B 1FZMA 1H3PL 4JZOA 4QT5B 2WWMC 4YDKH 2DBLH 3B9KA 3BN9D 1MH5A 4LPTA 4YHIA 1G7QB 3W0WE 3QJFB 4GKZA 1WFTA 4URTB 5IVXB 2W9DH 2DI8A 2Z92A 4LNVA 5KZCD 5L9DH 1ZGLP 2O61B 1N2RB 3FFDA 1TVBA 4WEUD 4HLZH 1CR9H 4L9DA 1CQYA 4E41B 1X5HA 2WBJA 3CMOH 2WP3O 4F9PC 5E8OB 1IGFL 1WAAE 2HTLD 2P8PA 3QT2A 2BJMH 3D39A 4ZYKA 4Y5YA 2MTPA 4JFXA 3NAAH 4I77H 2NY3C 4JGUA 5HGGS 5TE6L 1R3JB 1NLBH 3C09B 3LN4A 3FB7B 4XVSH 5AYUH 3SDAC 3IDYC 1KF9B 1QHPA 2FB4L 3WDHA 2ZCKH 3BUYA 2YN3A 3DVIA 2JK5B 1WBZB 2XWJA 4OLEA 3QUML 5JPMB 2OP4L 4JRYB 1LE9A 3QDMB 1LP9A 3SHSA 5DVOA 3ARGC 5FCUL 3U4BH 3RAJL 4WENB 4GBXB 1PDKA 4DGYL 5ALCL 4P9ML 2W0LA 4XCCL 3TV3L 1INDH 4Y0GA 5FGBC 4YX2L 2XFXB 1KB5A 5C0AB 1Q9OB 3P0VL 5D7IA 2AJXL 1B0WA 5HHQA 1T20A 4N90E 1IE5A 1KXQE 4HHAA 4W4OA 1D5MA 1NAMB 1UACL 5K9JL 2NZIA 3CC5B 2IBZY 1J1OL 1BGXL 2F19L 4JB9H 3QIWA 5I66A 4LCUB 1MJUH 4QHUB 4MAUH 1FNAA 1KTKE 3UTZA 3V4PH 3CFDA 4PGBA 1EX0A 3P9WB 2JIXA 1KLUA 1E6JL 3L3DA 4HX1A 3U79A 4YBQC 4WEBH 1EUTA 3O4LE 4UQ3B 4ZSOE 2XICA 3IS0X 1T89A 5SWSD 5I15L 1AO7A 1IM9A 3V7MA 4NZTL 4LHQB 5CSZA 1K85A 5I1HL 3O3DB 4ZTPL 4XP4L 2WANA 3SDCC 1E6OH 2R15A 3GSQB 4W4NA 3SKOA 4TSCL 5JHLH 4ZO6A 2UYLA 3WXVL 3IVKB 5F1NA 1DL7L 3GGWA 2VXQH 5FOBB 2NY2C 5JORA 3BP5A 1HSAB 4NQDB 3JTSA 2DMKA 1J8HA 3U46B 3V6FA 1RHFA 1G7LB 5JHDE 1CLOH 1YEIH 1LD9A 3DXAE 4RFNB 5JOFB 3SGKC 4P2CG 4Y16A 3GSXB 3GSRA 3KJ6H 2ENYA 4BK5A 1ZANH 2V7HA 4OIIH 3RJQB 3SPVA 2ID5A 3O3EA 3QULB 4ZUUA 1EHLL 1S9WA 4W68A 4LSSH 2ED7A 4JM4L 2EXWC 1OT2A 2D03L 1L0YA 4MQ7A 1TJHH 1FJ1A 2D31B 2H8PB 2UVFA 5TDPB 4YHLL 4X6FB 1JGLH 1VCAA 4KVNH 2HRPL 2ZKHH 1QNZH 2A77H 4X6DF 3PWNB 5FO7A 2QR0A 5T3ZE 1AI1H 3RZCD 1DN0B 3RGVD 2F53E 2PTTA 3V8OA 3W39B 1AXIB 4S2SA 3WLBB 4JHWH 1MCKA 2MHAB 2Y5TA 1SQ2N 3T0VA 3MRPA 4ZXBD 5ADOH 3MBEA 1INQB 3ET9F 2NTSP 1DZBA 5MEPA 4QXUL 1GC1H 4HKJA 1ZLVH 3MRQA 3UBXB 2C4FU 2ZSWB 3X3GL 5DURB 3VXUA 1CE1H 2O93L 3K1DA 3OKYA 4FOMA 1RURH 1IL1B 2CH8A 2NY4C 5TF1L 4NM8L 2FWOA 1E4WH 1UYWL 4MD5B 3TCXA 3FOLA 4KTDH 4WW2A 3BH9B 4ENED 4DOHE 4LKCB 4AEIL 5J1AB 3O3BB 1MIEL 2IBZX 4X4MA 5F7WC 1INEH 2EYSA 3BPNC 4E5XB 1FH5L 4M5YH 5GS0L 1NANH 5C0BA 2JJTC 2HJFA 1G9MC 2VAAA 1QSFA 5EH1A 3WHXA 3HNSH 4K3DH 2F8XC 1NPUA 4WHCA 3MGTB 1WFNA 5F7FA 4JN1H 4F3FA 4O51B 3R8QA 1WTGT 1DFBL 1RV6X 3OKMA 3FO9A 3QCUL 3NPSB 3CVIH 3MV9A 1BF8A 4QRPB 2V9QA 4NC1C 4JFYA 3T4YB 3DO7A 1U95B 4LAJH 2X4NB 1U3HC 4UV4H 1P1ZB 4PJ5A 1BJMA 3B2UC 3WDJA 4F7MA 1T5XA 2DD8H 3ARGD 3U1SH 1ROWA 5SWZB 1YJDL 1Z3GH 4LQFL 1R5IB 4PY7A 1C8PA 1NUDA 1F42A 4ZO8A 3PL6A 4F7TA 4JVUA 2BRRH 1RZIA 2PYEB 3DRQA 5DUPH 1RHHA 3EHBC 2XKNA 4O4YL 1HKLH 3DX6A 2N7AA 5DUMH 3WIIL 2DQCH 4JPVH 3ZYIA 3MR9B 1B3JA 2P8LB 1MCCA 1BIHA 2QV2A 2XTLA 2W59A 1T22A 3I6LD 1KELL 3BKCL 1I8LC 4OZHE 4HWBL 4S0TD 4GMSH 3ZDXE 5IT2H 2UUDK 3QEQB 5C07D 1HI6A 3GMRA 1UJ3C 2YBRB 3T3PE 3D0VA 2A6JB 4NQEE 5I17A 5H94B 2MPAL 3HPJB 4HK0A 2WSKA 3MNVB 3O9WB 1MVUB 5DRXA 4U1HA 3VMPA 1NCAL 3PDGA 3R1GH 5IQ7H 1FFQA 1SBBA 1XCQB 4OM1H 4TN9A 3FO0L 4EDWL 4LEOB 5D7LB 3MV8A 3GMPA 5EC2B 5C0RL 3BP7A 2DDQH 4ZOBA 5I1AA 4R7DA 2JKXA 3GK8L 3MLTB 4P5KB 3TLRA 4FNLL 2YKLH 4FFVD 3U36A 1S9KC 5IMOA 3PQYE 4W70A 4RAHA 5E2TL 4APQC 1F3JA 4Y4HA 5BMFL 3CX5J 5T5NF 3QUKB 4PJFB 3VI3F 4LLQB 4XNQB 5TPWH 1J88A 4H1LG 1HSBA 3QDAA 4JQIL 3ROLA 5E7FA 2H2PC 3GBML 4MNGB 5I19L 3FTGB 4X98A 1MAML 2YSSB 4XHJC 3HG1B 5CSBA 5KJRL 1U8KA 1JCKA 4WJ5B 3HFMH 5IB2B 3UDWC 3SKNA 1FLRH 5D4QA 4QOKB 5C0AD 1D9KC 4TULL 3BDYH 2X40A 4MXVF 5JXAH 2HA1A 5JOEA 2DMCA 5K59E 1ZLSL 1DBKH 3WKML 3X14B 1RZJL 3GMQB 1ZT4A 2GT9B 3NABL 4NPYB 3T1FA 4QHKI 3WUWA 1LEIB 1ORSB 3GRWH 4WU5A 1SVCP 5C1MB 2EH8L 5JLZA 3P4MB 2OQJB 1W72L 3HE7B 2YD6A 3SDDA 1I4FA 5CBAA 3U2SB 3K4DA 1NFDB 3AREC 2BVOB 1XZ0B 4UT6L 4PLKD 4IOFD 4GRWF 1EAJA 4P2RE 2FX7L 3WJJC 4X7FC 2IQ9L 1CGTA 5JZ7D 2V7NA 4LVNB 5C70A 4F33B 3S4SA 2A9MH 4JO4L 4XH2B 2O5YL 4L3CA 4PS4H 1AXSB 2HT3D 3O8XA 4L4VD 1R24B 5AUMA 4MA7L 3LB6C 2GJZA 4GRLA 3HNTH 1FFNA 3LH2L 4YEFA 2NY4D 4X4XA 2DJ4A 1OGTA 3BAEH 3OF6D 2QLVB 4P23B 1SEQH 1RPQA 4NQDD 2Q86A 1UM4L 2I07A 3GO1H 5CJ5A 5T1LD 5T1KB 2ZUSA 5ESQA 5T33L 4I2XA 3J8F7 5DSCA 1MFEL 1GPOL 1XF4A 1OAYL 5IJKA 1MJ7L 4XGZB 1JF1A 1YPZB 4WY7L 5DJZB 1IC5L 4A6YH 5B4MC 5JOPD 4EN3A 1CLYL 4OTXH 5I73B 5DHVA 3SGDH 4N5UA 3H9HA 3TIDA 1GIGH 4X9BA 4CADA 3QQ3A 5DTFA 3H2WA 1I1AC 5MP6L 3PWPA 5CILL 1KCVL 5EU4B 1FIGL 4G9DA 4JJHA 4ZTOH 3PWJA 2VXTH 3FT3B 2CLRA 5EBLB 4UIKL 3TBYB 5L2JB 2QKIA 3IDJA 3VXPB 2Z9TA 5IKCA 1HH6A 1MJJB 1WSST 2MOVA 4NWUH 2E9BA 3V6OC 1T1XB 3VD9A 4I5BB 1MWAA 4UU9A 1MLCB 1NSNH 3I6KB 4KGJA 1U8IB 1S5HA 3DMMB 4ZOCA 1XGPB 3CNKA 2X89D 4QHMB 2COQA 2V5TA 2PXYB 2IFGA 1QSEA 2NTFB 4HKXA 3NCYS 1OPGL 4M6NL 3GSNL 5HDBF 4OLYH 3HAEG 4JG0L 3U0WL 2XTJC 5JDSB 4KRPC 4GAYB 4OGAC 3VJ6A 2A6IB 4GS7C 3STZA 3KXFB 3ARDD 1RUAH 3MJ7B 5DEGB 1X5ZA 3TO4A 5GSRA 5C09B 3B6SB 2CK0H 4X4YB 5FF6A 1WT5A 5DK0A 5HYJB 1F02I 1FSKB 1U8NA 1DE4B 1S5IL 2SEBB 2AGJH 2CXKA 5LBSL 5H2BA 4F7EB 1BOGB 1KIQB 2UY7A 4ZUTB 3UZVB 5E8NB 5TGBB 2ICES 3PF2A 3S3SA 1I1YB 3D25A 4LAQH 4YBLB 5I8EB 3TN0A 5ID1B 4U1SB 4YE4H 5D2LA 4UAOC 4CVZA 4QRPD 4WGVB 3F58L 1ZTXL 4GAJL 1FG9C 4I0PD 1NL0L 4HWEL 4C83B 3VGAC 2XWBA 3ZLQC 2NXZB 4PRNB 2A38A 1IGMH 5KS9A 4ZFFA 4PRHB 5E2VL 3MLYH 1O5DT 2C1OB 2GTWB 2Q3ZA 1QFWI 4R4FH 4D9RE 2B7DT 3CAFA 2W0FA 2GAZB 2OZ4H 2DQEH 3GI8L 1YYML 3PHOB 1YC7A 1Z9LA 2XNAA 2YK1H 5E2JA 1YNKH 5HI3C 3UAJC 5BQ7A 1GZQA 2V2XA 3EOTL 2ADJA 5J6GA 4F37K 3EAKA 3UYPA 4Z7UB 4FQIL 5FYKH 2BNQA 2HT2D 5EN2A 1KTLA 1YEDB 3QEQD 4OF5A 4DEPC 4WI2A 1V7NL 5GISL 1JL8A 1DVFD 2QQKL 2GK2A 4AG4H 3L3KA 1A4JA 4OZGF 3S37L 1E4XI 3TBSB 3H3BC 4LRNH 1CXHA 3O9WD 4Z78A 5HHMD 5DEZA 2IH1B 4X5XA 4KI5D 5I0ZA 3TVMC 3AGVA 1I9RL 3RWEB 1A9EB 1ZHBB 3QFDB 3SOBH 4L4JA 3HB3C 3U6RA 4EI5B 2AABH 5D7LD 2E7MA 4KY1L 2R2EB 4OIBA 1A5FH 3BRDA 4PJDA 3WE6A 4GUPB 2HFTA 2KQMA 2OR8A 1V7ML 5D8JH 4OLZL 5HVHC 4FQLH 1KN4L 5KW9H 4DCQB 1RY7B 5ACZB 2BNRE 2Y72A 4K71C 3RA7H 2O5XL 4M7JL 3KYKH 1QG3A 1H3PH 3QI9D 3U9UB 3C8HA 5B22A 5IB5A 3U7YL 4JDVA 1VACB 2UWEB 4BA8A 4JFFB 3HG1D 2JB5L 1I8KA 1ZVHA 1FIEA 2UZYB 2DQFB 2EE3A 3P3YA 3Q1SL 3IU4L 3OKDB 3AAZB 4I3RL 4WHDA 4X7CC 2XA8L 3FRPG 3DPBA 4ETQB 4QGYA 1OWWA 2EDTA 3MV11 2ICWA 2WW8A 3QFJD 4LCCC 1KPUB 2HJKB 2FR4B 1Q72L 4AT6B 5D1QD 5TE6H 1CFQA 4Z7QF 3H6JA 3QXVA 4NRZA 4BZ1L 1TTFA 4MB4A 2FB4H 5E9DD 3RUGE 4M3KB 3MOAL 2ZSVB 3QUMH 1VFBB 4R2GC 4RAUA 4R0LB 2OP4H 1NFIB 4F7CB 4NC1E 3CZFA 1FL6A 3ZE0F 5FCUH 3DGGA 3PWVB 5KSUA 1WBYA 1ZLWH 1CGYA 3RAJH 2W0KA 4PIRF 4DGYH 5ALCH 4P9MH 1DANU 4XCCH 3TV3H 4HC1L 2IANB 4YC2B 5IHLB 4YX2H 3BEVA 1PW3A 1WGOA 4PJIA 4Q0XL 1IT9L 3P0VH 3WHE0 4NO0A 2AJXH 2VMFA 4MD0B 2CIKA 3G6JF 1UACH 5K9JH 1A6TA 1D5XA 3T04D 1J1OH 1YA5A 1BGXH 3OXRB 2VLKD 2F19H 4HLZG 4RAVB 4WUUE 2DQTL 3MV7B 3RWFA 4O2EB 5F88A 2VYRE 5F9JA 2ATKB 4ODSL 4BSJA 3V8CA 4AENA 3EJZD 2ADGA 4XX1E 5CP3A 4CN1A 4FQQA 1E6JH 5AWNL 5DGQA 5HHXL 1G7MA 3UTQA 4TSBL 2FYYB 2YUXA 2R2HA 4UB0L 1I3RA 4F8QA 3RWJB 4JQVC 4R26L 1EO8L 1FNLA 1T5WB 5F1OB 1A47A 5I15H 3U9PL 1IM3B 1SJVA 2EZ0C 4HUMB 4NZTH 1Y6KR 4FA8A 2NNAA 5LVEA 2IF7A 1PSKL 5LG1A 5I1HH 4ZTPH 4XP4H 3ZMRA 2L7JA 4TSCH 3WXVH 2QSCL 1S7XB 3PWLB 4N5EC 4EXKA 1DL7H 3F8UB 5IESL 2P24A 5F7EL 2ATPA 3RWGA 2K7PA 5EOQL 3MRCA 3RNQB 2VLRE 1ZLVK 3TJHC 3UPRA 1ZGLA 4PJBF 1O0VA 3BOVA 3BYYA 1VFOA 4MJ6B 4N68A 1OARL 5L8JB 3EYFB 1EBPA 4NN5C 3V7AG 5ITFA 3MOBL 1MAKA 1EHLH 4FQXC 1PQZB 3MREB 4JM4H 5IFHL 4YHLH 2X70B 3EO0A 4Y1AA 3V0VB 2HRPH 2X4SA 1ZHNB 2E7CA 1P2CA 2AXFB 4E0RA 5HYJD 4LNRB 4LLWB 4MB5A 4K8RL 1MREL 5DJ6B 3U7WL 2YS4A 3MCG1 4GQ9L 4PJEB 4GW4A 1TETL 1UZ8B 3KS0H 3VFWB 3HMXL 1EGJA 2OR7A 4HGMA 4JZJC 3KPQA 3CH1A 4PJCB 4ONOA 3VG9C 4Y4KA 3DX9B 3L3HB 1T2JA 2R8SL 3IF1A 2HFFB 4YHOL 5ILTL 3SE3A 4HS3B 4POUB 4QXUH 1YDPB 3AY4C 4LMQE 3X3GH 3LKPA 1IARB 3W11D 4G9FB 2VITB 1VKXA 5DD6B 4JFPB 5TF1H 4WO4C 2G5BA 4JM2D 4NM8H 1NCDL 4NNXA 2WP3T 3ZSTA 1UYWH 3QDHA 3D87B 1QO3B 1PX3A 1QFUL 4MNQB 3DV6A 4AEIH 3PG2A 4U1NB 1MIEH 1E28A 1ZS8B 1F4XL 4N1CA 4P2OD 5EUOE 3G9AB 3F6LA 1FH5H 3QCTL 2FJHA 5GS0H 1X5KA 3OB8A 1BFTA 4FQHA 4WI6A 3F12A 1DFBH 2H41A 4LLDB 2R1WB 4XI5D 3KPNB 1FYTD 1KENL 2XRAL 3O6FC 4JZNB 4PG9B 4KK8C 4HPYL 3Q5TA 5E6IC 5EUKB 3QCUH 3W9EA 4HT1L 3VFPA 1GAFL 5D72L 4R4NC 1XIWA 4RMVA 5AAWA 1UC6A 1FZOA 3HNVL 3QIUA 1YJDH 4LQFH 4PGJA 3GSOB 1U42A 3HZMB 4J3UA 5HGBB 5EO9B