3G5YB

Antibodies specifically targeting a locally misfolded region of tumor associated egfr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
210
Chain Sequence
DVQLQESGPALVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSANTRYNPSLKSRISITRDTSKNQFFLQLNSVTVEDTATYYCATAGRGFPYWGQGTLVTVSAAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 175 light chain
publication title Antibodies specifically targeting a locally misfolded region of tumor associated EGFR
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 210
sequence length 216
ec nomenclature
pdb deposition date 2009-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g5yB01
3VGBA 1OW0A 3L1OL 4YK4C 1GRWA 1LHZA 2E6JA 3MCLH 2A9ML 2WBJA 2VLJE 4FOMA 3S8WA 3ZLQC 2Q3AA 1A6VL 4WWKA 4MAUH 4G6AC 4XAKD 4MLSA 2OTUB 2YA0A 5GIRA 1QFWI 1NLDH 1P1ZA 3BKCH 2YD2A 4NKDB 2AJSH 2VLLB 5DK0B 5L8LB 1EHLL 3IF1B 3E0GA 2EC9U 3O2WH 1N5AA 4Y4HA 4GG6A 5CSZB 2Y36H 4RX4A 4PR5B 4DK6A 2VR9A 4LRNH 2SEBA 5BO1H 5JW3H 2AJYH 3LB6C 4YHNA 3QDJD 1VGEL 1K85A 4HJGB 1BZ9B 4NGHH 5HI4D 1KLUB 4NWTH 5I8KH 2BNQA 4Q6IB 2XIDA 3WJLC 5F9WB 2VL5A 1EVTC 2WUBH 1KPRB 3ULSB 4Z78B 1QYGL 2ZOKA 5SWZA 2XWBA 1P4LB 1A4KB 5D2LA 1S9XB 3VXSB 1OT1A 2VWEC 3LEVL 4LOUC 3TVMB 1WBZB 5IIEA 4PJBF 5JMRA 1RJYB 4BZYA 4WI9A 3KPOA 4GUPB 4MQ7A 4W70A 4CL7A 1J86A 4I13B 3KPSD 1CE6B 5F1KC 1A3QA 4DOHB 4ALAL 2AV1A 4I18A 2DTSA 3TJEL 3QO0A 4NO5B 4L5FH 5T1KB 3G6DL 1M7DA 5DTFB 2ZG2A 3DX9B 1QRND 1QLFA 4X9IA 3WNKA 4AEIH 4X83A 3BSZL 1KJVA 1Y6NR 4U0RB 4OIAA 3OWEA 3S4SG 4ZFFB 1LO0H 4MDIA 3IFOB 4TNWF 3HC4L 1G84A 1T20A 3SDYL 4WFGE 5EZIL 3L5IA 4FA8A 5GRZA 2D31A 5IF0A 4HZLA 4HXBL 3SJVA 4RWHA 4YO0B 1PY4A 2F53B 5CGTA 1QHOA 1WBXB 1T4KA 3D3VE 4QHLA 5BZWA 4IEFB 3AM8C 1E6JH 1CLOH 4UTBL 5D71H 3ZT6A 5L88H 5DMYA 2XA3A 5C0JB 5AYQA 5CKAA 4YGVB 3UEZA 3D6GA 1NL0H 3BYTA 3IDIB 1ED3B 3PIQB 4OFDA 2Y07L 1LEGA 4WJ5B 1WIUA 4KKAC 1MI5D 3VRIA 3ZZ1A 1LK2A 4FQXB 3QXAB 5B3JE 5C0CA 1HH6A 3I3DA 4GRMA 2HWZL 1GL4B 3STLA 4ODVL 2BVEA 4ODXA 4FQQA 1I3GH 1TCRA 1CS6A 2FZ3B 5ICXA 4IIQB 1R5IA 4HUNB 5ANME 4ONHB 4QYOA 2R0ZL 3I9GH 3D0VA 3IVKA 3SOBL 2OI9C 2NR6D 4GFTB 2X1PA 3IDJB 1KEML 5MEOB 4HSQA 4K9EC 3SDAA 1ACYL 4JM4L 4LSQH 3AB0C 4HV8A 1FN4A 3KLAB 3CX5J 2GSGA 4ACPA 4I3RL 5LGHL 2R23B 2UUDH 1T22A 5MHSD 1VFMA 5CD3A 5KSBB 4AEEA 1MCNA 1CGVA 2D7PA 5JXEC 1HCFX 2IJ0C 3QEUA 4WUKH 1N64H 1I1FB 2VDNH 4PIRF 4CVXB 3UBXG 1JN6B 2ZUWA 3ZYOA 2C1PA 2XYCA 1SJHB 1Z5LA 5FA4A 2EIDA 4OFVA 3TLRA 1JGEB 3R06A 1IEBB 1KB9J 5H8DA 4EDXB 3K1KC 5IUSA 3VWKB 1OAXL 5D72H 4HX1B 2QQKL 5AD0A 4BH7A 1NCAH 5J13C 4KKCC 3GJEA 1Q9OA 3KPSA 3QUYC 4JHBA 4UDUA 1CFTB 4CW1A 1D5ZA 1G7MA 2FL5A 4JFHD 3GMMA 2CXGA 1FNHA 3QIUB 1QRNA 3PV6B 3ET9F 4G8FA 1JCKA 4HUMB 5FO9B 4ONGL 2NY4D 2X4RB 3A6BH 25C8L 3UMTA 1MF2L 4LEXL 1EJOL 4U6XA 4XHJD 3ARZA 4L3EE 3GSOA 3OL2A 1KTKE 4YK4B 5INDA 3HG1B 3DLQR 5KS9A 1FAIL 1IGFL 3C8KA 1VERA 5T3ZL 1AGFB 1JNJA 1V5JA 4RAUA 2EDXA 1N3NB 4BKLB 1C12A 2GFBA 5ADPL 1YEGL 1LP9A 1A6TB 5KVEH 1ZA6B 3IXTA 2HRPL 3QQ3B 4HKJA 3RWCA 1WZKA 5C9JA 2D7NA 3GSWA 4RA0C 1LE5B 5DEGA 3LSOA 3VFOB 4FQ2H 3H9SB 3EFFB 4GW5B 4GW4B 1IBGL 1MI5A 3OR6A 4F57H 4AK1A 3C6SB 1Z0NA 3EYVA 1MJUL 1FVEB 4JFDD 5FUZH 1JGUH 5DFWH 5T1MA 4XNYH 4HPOH 1A7RH 5DI8B 1VGKA 2J3SA 1T7VA 3UTSB 3BD4A 5I1GL 3VE0A 3ARFD 4NBXB 5C0IA 4YHIB 3QNZA 1Q1JH 3EDKA 5C2BL 2YPVL 1UXWB 3MREB 3QEGL 4I48A 4KHTL 1CFNB 2L7JA 2NCMA 3KPMA 4OZ4B 2WBWB 1ZS8B 3CC5A 2IFFH 4ZPVB 4WEBH 1XGRA 1VFBA 2YD6A 4GRLA 5CUSH 4G8GE 3CH8A 4OLVL 1CBVH 4YHKL 2VKWA 3BP7B 4KK6D 4UDTB 4BA8A 1CIUA 5FKAA 1CFSB 1HIML 1GAFL 1PEWA 5JDSB 4AQ1B 3U30B 2FJHB 2AI0L 3ILQD 3B2UC 1JV5B 3UDWC 2VJXA 3QWQB 3NA9L 2ZKHL 5DDHB 2IH3A 4WW1B 3LH2L 1A6AB 1MQKL 5TDOA 1BD2B 5I66B 3TCLB 1AFVH 1IGTA 1U8HA 3LZFH 4HPYL 3T2NH 5IB1B 5SX4H 1A1MB 3QQ4B 1IARB 4MS8C 4PRPE 5J1AB 3MLUL 1YYLH 5CBEA 2V5MA 4Z5RB 4HAFA 3X12A 1QEWA 5K9QI 3GBLA 4PY7A 1KEGH 4JY4B 1OP9A 3NIDE 4XBPB 4DKEL 5T3ZD 1NGYA 4PP1C 2OI9B 4LBEA 1TJGH 3FT4A 3DX8A 5C0GB 1OAYL 4M3KB 5ITBL 3SE3A 1LEIA 2I60L 3AB0B 5MEND 1ZHBB 1KELH 4PTUB 3SDXF 1XCTB 4NQSA 4HWBH 3CU1A 2CLVA 4BZ1L 1GHFL 4GRWH 4UQ3B 3WDIA 3L3OB 1G9EA 3LKOB 1KJ3L 4NHUA 5EIQA 1P7HL 1BIIA 3X11B 1J7VR 3X17A 2LU3A 2VXUH 3QUZB 1H3TA 3U36A 2YXFA 3GFUA 4HCRA 5D7LA 3HS0A 1DQJA 3ILPA 3KNBA 1G9NH 2DM3A 4XC3L 4JFDA 3QRFM 5JNYB 3ULVL 1WZ1H 5B39A 2X4SA 1RQ5A 1DL7L 1RMFL 5C0DA 1Q0XH 2HJFB 5FCUL 4U1SB 3DJ9A 4R2GC 5J13B 3ARFA 1NANH 4PJAE 4X80H 1KJMA 1A3LH 4C58B 4CMMA 2R0WL 4MQXC 3ARUA 4MQSB 4M1DH 1Q0YH 4PG2A 3V6OC 3O4LB 4WEUD 5TH2B 3LQAC 3G08B 1KCSH 1E4KA 1EMTH 3EO9H 4AMKL 1EHXA 2AXGA 4R7NB 2X40A 2FR4A 4XTRC 3MNVB 5CJ8A 4D0CB 1KLGB 5EO0B 4HG4K 2FO4B 3QO1B 2HT3D 1F58H 4NC0B 2HJKB 2FWOB 4I3SL 4X6EA 1QVOB 5F96L 3ZE2E 1C16B 5D2NC 3PNWA 3LRSB 1MH5A 5IJVB 1MCQA 2JELL 2X4NA 3P4MB 5AAMA 2CLZA 5HYIA 4U3HA 1BFVH 1R3LA 3MV7B 3L3KA 5J8OA 3BMWA 3PJSA 1G7JB 2JB6A 4Z77B 4TOYH 5HDLA 3B9KB 5IFHL 5I6XC 3HZYB 2H26B 4WW2F 3V4UL 3UTTE 2BNRD 2YK1L 4QRPD 3MLXL 3AY4C 5DUBB 4QEGA 5GS0H 1M05B 5GRWA 4FMFA 3CX2A 4PJEA 5DJ8A 4PJ7A 3L5JA 3DO3A 3MMEB 5FIEA 2PYED 1U8PA 2VZ1A 3PWVB 5DC0A 3RZWA 1J5OH 2PKDA 4DW2L 3F58L 3VXUB 3ZE1E 5DC9B 1LE9A 1SY6L 2P43B 3G6DH 4APQC 3RWDB 5IW3A 2HT4C 2D7MA 2YN5A 4PYHA 4QXUL 1KYOJ 4N5ED 1BP3B 3RKDC 3QFDB 2VR4A 4G8IA 3MRMB 5ESQB 5F1OB 3IS1X 1NMBH 2CMRH 3FN0L 2YD9A 2AXHA 4PJHA 1LO5A 1AR1C 2GUOB 3KPPA 1RZJH 4ELME 4MJ5B 3ULVD 4MD4A 1F4XL 4HWNA 3MCKB 1SYVB 1DLHB 4JVWA 4E42B 3MUGB 3F7YB 4XCNB 3C6LA 4I4WB 3UYRL 3QUMH 4RFEB 3WFBH 4YDJB 4LLWA 4GAGL 1CFQA 4W4OA 1DR9A 2VE6B 4FXLA 1XR9A 5H94A 2NY7L 2HG5A 3BN3B 2RAMA 2GT9A 5EN2A 2NZ9C 5FYLH 5D1XA 4KY1H 3QJFA 2G5BA 1NCCH 3UPCA 4KMTH 1NH6A 1LO4H 1WIPA 1K4CA 4F7TB 1F2XK 5IEHA 5L0QB 2QADD 2DQUL 5DD3H 1VKXA 2F8VA 4TPRH 3PHQB 3RX7A 3RY6A 2MJWA 4M00A 1OP3H 2UWEF 6CGTA 1U8IA 5ALBL 4HCRH 3P0YL 1KEMH 3WIIH 3DX6A 1CLYH 1HQ4B 1GOGA 4EXKA 3QIWD 4M62H 2W1NA 3MNZA 2IQAA 1W0VA 4I2XA 4ZDHB 1Q9LB 4OF0A 3FFCB 5LAXA 4ZAKD 3TBSB 1R24A 4XVTL 2VL4A 3HB3D 3NN8B 1FVDB 3RIAK 1J1OH 1CDBA 4OI8A 5AG9A 5ILTL 4KRNA 4X7TA 1LD9B 5C09D 2C3HA 2BNRA 4L9LA 3UPRB 4QRPA 1MFCH 3DXAA 4R26L 1U6AH 3GKZA 4GW1B 3SKOB 1WJ3A 3K4ZA 4X9FA 1CI5A 1UJTA 3VH8B 1S7SA 1F11A 1BIHA 4M7ZB 2PYEA 1EZVY 2P49B 2Z91B 5IVNA 1RUKL 1SEQL 5KANI 4GKNA 1CXKA 2EDLA 1MFEL 3DVFA 3HI1A 5HYJE 3BP6B 5J6GA 3S5LB 4NQDE 4IMKA 5ALCL 5T3XE 4OCNC 1QBML 3WNPA 1RHFA 4KTDH 4X5XB 3R0MA 3RIFK 1PLGL 4FQLL 3QHZL 4XNXL 4LEXH 2XPGA 4GBXC 3C09C 1X5JA 1JGLL 5HHNA 1BBDH 1ZHNA 3U4EB 2Y5TB 1IM3A 4PLKC 5CIPA 3CFJA 5F7YC 4DWHA 5JORA 5D2NB 2VDQH 3P73A 3OTTA 2H9GA 1IGCH 4QXTB 3V7AG 3HNTH 2DQTL 1FHGA 1F8TH 3WL9B 4QOKE 5HYQB 3P0VH 4Y5XC 2ATPB 2YPLE 5I6XB 2HJLB 4I9WE 2JJSA 3RUGB 4ZQKB 3CVHH 4JG1L 4R6UA 4UIMB 1UWEH 5DRWB 3JV6A 3BFOA 1CICC 1ZHKB 5LBSH 4PJCF 4RFNC 5EUOE 3VRJB 1MOEA 3TZVD 4EQ2A 5A2JH 2H3NA 1HQRB 4OFYA 1T7YA 2YN3A 4PRIB 2Q8BL 1J87A 1AO7A 2JIXB 5GGSB 1U58B 4LLYB 4J12A 3QIWA 2L4OA 4S1RL 3RVXC 1HEZA 4AYFA 4KK5C 4UTAL 2MCG1 5C08A 4ZAKA 1YMHA 3MXVL 3V5KA 5DJ0B 3WHXA 1Q72L 1I4FA 5GHWL 5L8KB 2XTJE 5KZCB 4P4KD 1KV3A 3N9GH 5M7QA 2VDRH 3C5SB 4MAYA 2FRGP 5DO2C 4HIXL 4X6DA 1M6OB 5C09A 4HW6A 1OARL 2APTA 2EC8A 4R4BA 5A16A 2H2PC 2VXSL 1SY6A 2ZKHH 1S78C 5DRXA 5DVMA 2DTML 1MQKH 5EBLB 3RWIA 5BQ7B 1T1XA 5IV2A 2ESVE 5DHVA 3UBXA 1Y6KR 4LF3B 2V2WB 3KPRB 5KSVA 3UJJL 4OZIA 2OSLA 4ZG1A 1AGCA 1GGBH 3ULUF 15C8H 3BXNB 3FO0L 1CG9B 3DGCR 2XG5A 3EDEA 3VXQB 2DIAA 5T1DH 43CAB 5DJAA 3DTXB 5DVLA 3MRKB 4YDVB 2W9EL 4D3CH 4U1IB 4DKEH 3JUZA 1HXMB 3MFGB 1RK0B 2EXWD 5E0QA 4WO4C 3QPXH 4CU7A 3E2HB 1TLKA 3CFDB 1J12A 1IC4L 4BK5A 4YZFE 1RI8A 1M7IB 1YN7A 2WQRA 4YDLC 2FJFB 3HN3A 1NDGB 2CXKA 2FBJL 5TQ2H 3ZTNH 4GMSL 1FYTA 5I1CL 4OFIA 4ZS7H 1JZ8A 3G04B 3O45A 4M43H 3BPCA 4X98B 3I02B 4QRQA 3QDGE 2CO7B 4FMKA 1NGWB 5EBMB 2W91A 3G5ZB 3ALXA 5LWYL 3O3AB 3MA9H 5F89A 4Y5VA 5IHLB 3L3JA 2ICCA 1QP1A 2VN4A 43C9A 5T5NF 1FFOB 1MHHA 1DN0A 3EYSH 1S7WA 2HKHH 4W6WB 1DQMH 3F7PC 4X4YB 1E0OB 3P40A 3D85A 4Z0XA 5CIPH 1ERNA 3TZVA 5FCUH 3Q3GA 4CMHC 1UQSA 1X5HA 3H7LA 3LDBC 4LARL 5IFJB 1WBYB 4H1LG 2MQ0A 4L3CB 3HR6A 2MHAA 4FTVE 1FH5L 3LKNB 2B7DT 4XP5L 2CR3A 4JM2D 3P9LB 5CLWA 3HAEA 3VU2A 5DQJA 5BVJA 3GZKA 3MRDB 4AMKH 1RVFH 2OTWB 1DBJL 5ACZA 4UOJA 1CVRA 3IJYB 4XPFL 4M03A 4NFCA 1S7TA 4Z7QF 4I3SH 5DZLA 1Z9OA 1JNNH 3S36X 3BOVA 3RX8A 1EO8H 4QRRD 2ADIA 3GM8A 1IC5L 1FNAA 1L9MA 1AGDA 4UQ2A 1Q38A 4AL8H 5EPMB 1EV2E 4X4XA 2VERN 4Q9RL 5A40E 4WGWB 5EH1A 3MRPA 5D7KE 1O5DT 3LS5L 5F88B 4Z7WB 3W0WD 3V6ZB 5FYJU 1Q9WA 4LVHB 4Y5XB 5DQDH 2BJMH 4LLUB 4OGAD 1F90L 5LGKA 4O2FB 1X4ZA 1MUJB 4MNGA 5FAAA 2MCPL 1CICB 3MOQA 2EDNA 4YIQA 4JCMA 4B7LA 3WXWH 3F7VB 2QSQA 1T0MB 2DN7A 4IJ3C 4JZNA 4DW2H 4LSPL 1VHPA 5CKGA 4PJFF 3ZKMC 1QUNA 5EZOL 1BJ1H 2JCCF 5E2VH 3CXDL 1KGCE 5FOBB 1GIGL 3SO3C 3IDUA 1JRHH 4JRYE 4GQPH 1K3ZA 1T0NA 4UV7H 1MLCA 5DHVH 3EYUH 3VXPA 2GTWA 3L7FA 5D1ZD 1JF1A 1U93A 1BQHA 2EECA 2DI9A 3P2TA 5GZNC 2VISA 1VFAA 1A7NH 1X5KA 3ESUF 2BCKB 3HZKB 3REWA 2BXYA 3UCRA 4X0KA 3C2SA 1PKOA 5CEZH 1IKNA 3ZE0F 2A9NL 3O2DA 4KMQA 1H5BA 1MY7A 1MHPL 4BFIA 4OFPA 1U95A 1C8PA 1UB5B 1BAFH 1BQLL 5HHVL 1CTNA 1B2WL 3CNKA 3N85H 1I8KB 3S98A 3GNML 3CK0L 3G5XA 4M6ML 4Q9QL 2G2RA 3IFPA 3OX8A 2G75B 3SCMC 3NBNA 3NIGE 2GQHA 4WNQB 3MBXL 5SX5K 4JM2A 2J7LA 1FYHB 4P3DA 1HYRC 5CP7A 4F58L 2CDGA 1GPOL 1XF1A 4M6OL 3ZDXE 1MEXH 3NCJH 5E8OB 2EKJA 3KXFD 4PTTA 2C3VB 4G6KL 4WO4B 1FGVL 3RDTC 2AKRA 2QKIB 1R3IH 2DYPA 1SMOA 2H32B 4YDLB 2R0KL 4PRAB 1NFDB 4P5TD 2Z9TA 1OHQA 2FX7L 3MRBA 1R3HA 5F3HA 4P2QD 4NQVB 4XVTH 1MCHA 1P7QB 5TFSL 3Q6FA 1OD9A 3G6AB 3OMZA 1OGTB 4LPVA 4FQ1H 1JTPA 4KI5C 1D6VH 5I73C 2J8HA 3W0WA 5ILTH 2W38A 4LCCA 1MIEL 2CDEA 2GCYA 2J6EH 2FH8A 1QSVA 2QHLA 2LABA 1FNEB 3QFJD 3QEQB 4ZNEA 5E6IC 2ED9A 4UIKL 4CNIA 2VLMD 1XGYH 4LIQE 4JFED 3OKMB 2X70A 3MGTB 1QBBA 1IM9D 3ALWA 1UH2A 3FAWA 4X6FA 4U33A 4B53A 5SWQA 4CMHB 1AJ7L 3LDBB 4LLMA 4X6CF 1ORQB 1MFEH 2NY6D 5ERWA 3IB4A 1A5FL 2VH5L 4NCC2 2BSED 2VUYA 3IKCB 1NCBH 2AJZB 4J23A 3AVEA 4IRZL 1XF5B 1IC7H 2N7AA 4LPXA 1NGXA 4TTDC 3GIVA 4FN0A 1L4IA 1H0DA 5D1ZA 1BMGA 2NMSA 2MWCA 1K5NA 2Y4SA 1JGLH 5HDQL 2WIIB 3BPNC 3S34L 3WFHA 1T03L 3FT3B 4IRJA 1I85A 5FGBA 3TO2A 1AKJD 5L2KB 1BLNB 3WNNA 1KNOA 1GOFA 3WS3B 3DUHA 2YRPA 2Y23A 3MV8E 3LQZA 3HMXA 4H20L 1P84J 2O5YH 1MCLA 1TVBB 5HGDA 1TZHA 3TH4T 3C9NA 1WAAE 4J3VA 3QJHA 4JPIA 1UZ6F 4AIZB 1F00I 4JN2B 2XWJB 1S5HB 3EOTH 4KRPC 5DRNA 3V8OA 1JYXA 1UJ3C 4JG1H 4LAJH 4ODTH 4YHLL 1N0XL 1RFDH 1BPVA 3OHXB 5EU3A 1VA9A 1W72A 5B38B 1F3DH 1FZJA 4RDQF 4BUGA 5HYSG 3MV9E 4G6ML 3MRLA 3O2DH 1N6VA 3VFSA 1FVCA 4IJ3B 3ARSA 3KXFA 4MVBC 1OPGL 3FMGH 1BREA 5EU6B 5C86A 4JFQB 3S35X 1RZGA 1MHEA 1N26A 4S1RH 5HHXL 2X4OB 1R5WA 4XI5D 1QO3B 2IPTH 5E2UH 3VFTB 5CWSA 3SO3B 4P5TA 4UTAH 1LO3L 1MAML 5JQHC 3PGDA 2BOCA 1Q72H 5DK3A 3QDJE 4UT7L 2IBZY 1YUHB 1D6EA 1F3JA 4LNVA 5GHWH 3T3ME 4M4PA 4EN3D 2GJZA 3ZTJH 1S5IL 4HIXH 4LEOA 1TPXC 3ARWA 4P46D 2RHEA 3E6HA 5FXCH 3RWHA 3O11B 2FH6A 4DVBB 3QUKA 1X5AA 4GKZA 4RISH 1OF2B 3DYPA 4K7FA 1WFTA 2PXYD 4HF5L 4JFEA 3JV4B 1SEBB 2ADFL 2DWDA 1IGJA 2DB8A 1RULH 5D7IF 5DS8B 1SVCP 1MCBA 3SCMB 2Z31C 2AEQL 2HVJB 2YC1B 5ESAA 4RMRA 1TNMA 1I3RB 3UC0L 1IAMA 3BD5A 4ZXBA 5HHOB 3IU3B 4HXAL 1MVFA 4E0RA 3AREA 5FHAL 5JIPA 1KOAA 5L6YL 1Y6MR 5D7SH 1IC4H 3T0EA 1LP9E 4NUGL 5F7EL 4G7VL 5IB3B 5I1CH 2IH1A 4BSVB 3QI9A 3PWPB 1F4WL 3FQRB 3MGAA 1CGXA 3O3EA 4D0DB 3WSQH 3RL1A 1OY3B 4J3SA 1I8LC 3QCTL 2YA2A 5GGRA 4NUJB 2YXMA 4OCYH 3RVVD 2J8UA 5I73B 1KJ2B 1DANT 1PBYA 3HMWL 5EZJB 3D39D 1T3FA 4M6NL 1UCTA 3HZVA 3QDMD 4X6BB 5E6IB 5FGCE 1XH3B 1D9KD 2XA8L 3PGFL 1YPZA 3FQWB 2Y7QA 3UZVB 5C7XH 3RPIB 4Y19B 2XT1B 4YXHH 1EAPA 1QSFE 3EJZC 4XH2A 5E99H 1AGEB 3KDMB 5E1HB 4K2UH 4P2OB 5CJOH 1T1WA 4R7DA 1I9RL 3WIFA 1S9VA 1KG0B 1N7ML 3HMXH 1FH5H 3MRRB 5MHSE 2B2XH 3KYOB 3X3GH 1MWAH 1KIPB 1G1YA 2FHBA 1KN2L 2OX5A 3UO1H 1I7ZB 2Z8WC 5BS0A 4NT6A 4F33A 1HSAA 1XIWC 4QY8A 1DBJH 3HE7C 3RWJB 5INCA 1EZVX 2FYYA 1RHHB 1W72H 4EN3A 3MV11 1YEDB 1CT8B 2ZSVA 3ARBC 3OKKA 4M48L 4E5XA 1T89C 1NDMB 3F12B 5F7MC 2R2HA 4N0CC 4OM1L 4XCYB 3RBSA 1FGNL 4P46A 8FABB 1PQZA 4XWOD 2GK2A 4LP5A 1FO0B 5E8PB 3K2MC 3VGHA 1AXSA 3GMNA 1IEAB 4JVUA 3U9PH 4JN1L 4K55A 5GS1A 1D5MB 2PXYA 5I17A 4NZTH 4IMLA 4JFHE 2D0HA 4WDIB 1XGTB 1E4XL 4OGYH 1VADA 1OW0C 3BDYH 3BN9C 3P9WB 3C2AL 2WBJC 4KRPB 3T77A 2XN9B 1Y18A 4WWKC 2MCPH 2R4SL 3MJ8B 2DKSA 3L6FA 2H41A 3VXSD 3EBAA 3TVMD 4MB5A 4KDTA 3LKPB 3K8LA 4MMZC 3P11H 3KR3H 2DDQL 4Y4HC 1CU4L 3HFML 1WFUA 1VACB 4R96A 5L2JB 3BUTA 3OKDB 5JXAH 4K7PX 4PRHB 1DDHA 3QYCA 5T1KD 1DANU 4JFZL 4NN7C 4D9RD 1FBIH 5AZ2H 1VB9A 5HGAA 4JE4B 3HR5A 1U3YA 1ZTXL 1N5YL 1V05A 2Z92A 1XFPA 3VFRA 1IGML 3VFMB 1G6RL 1YNLL 3VGFA 3BWAA 2F53D 1LDSA 2PTTB 4NQEB 2BY3A 4JFDE 3NCCB 2R15A 5KSBF 4HD9A 4PGEB 3FB7B 4BQCA 2PW2A 1TPXB 4WY7H 3D39A 4IDJH 5EOCJ 3WBDA 4DN4L 3T1FA 5C2UB 4NDMA 4JRXB 4ZUWA 2X9WA 5GS3A 1YJDL 3SKUD 3L5XH 1CYGA 4XXCA 4NZRL 1BOGB 4M6MH 4Z7VE 4JO4H 4UILH 1DSFL 3TYFA 1HOCB 1MCIA 3C5ZB 4LHUG 5F1IA 3UTZB 5D70H 2NW2B 3MBXH 1YEEL 3DI3B 1L7IL 1YA5A 3NZ8A 4PJGA 5DD1L 1GPOH 4E41B 5F9JA 1MREH 2VDKL 3H3KA 2Y9RT 4IS6B 3JVGA 4DGIL 4PJBA 3GI8L 1RY7B 1TIUA 3MRJB 4BJLA 4QTHB 2IC2A 3PF2A 12E8H 3TH2T 2WAHA 4NHCL 2YWZA 2R0KH 1R3KB 2FSEB 35C8L 3VW3H 1A7PL 1F3DJ 3PGCB 4ONFH 1RZ8B 5EO9B 1EFQA 1NGPH 4NKDA 3IF1A 1M71B 4XMLH 2HFFB 5EWIL 5SV4A 2HT2C 2WWKT 4PR5A 5DSCA 1MIEH 4Z8FL 4LSUH 3SDAC 4PGZA 1YEJH 3IT8D 1CZ8L 3MRIA 3H7BA 1KPRA 3FRUB 3ULSA 3FT2A 2I07B 2F74B 3VWKD 1P4LA 4HDIB 5CBAB 1A4KA 3ZL4L 3VXSA 1CXIA 1WBZA 5GZOC 5MENE 3VI4F 2VLRA 1XEDA 7FABH 1AJ7H 4AEHL 5E2TH 1FZMA 1ZSDB 4NO5A 3L7EB 1NBZA 2WBKA 5DTFA 1C08B 2DKUA 3DX9A 3QIUD 5J6HB 2D7TL 3O6FA 2HTLC 3EW3B 2OR8A 3CDYA 3VGEA 3IFOA 1XIWB 3AUVA 4JDTL 5IFAH 1AD0B 3HE7B 4XPBH 1P7KA 1WEJL 1UM6H 4PG9B 4MWFB 4G6JL 3S34H 2V6HA 2F53A 3HG1D 2R8SL 1IL1B 1V8HA 1WBXA 1JZ2A 1EX0A 2QSCL 1L6ZA 5IBTL 4KGJA 4G6AD 3HA0A 3BRDA 2H6PA 1OP5K 1FNFA 5FM5M 3RVTC 5TPWH 1FL5B 4MNQB 4JGMA 1Z0MA 4B41A 4YGVA 5DD6A 1MCFA 3UTQA 3WLWC 4MA8H 2EDBA 3H9SD 2AJVL 2E27H 1G9NC 1H9VA 1E4XI 4LKXB 2VLKB 3TT3L 3TFKD 4MA7L 3UJIH 4WWKB 3WJJA 1TETH 4UV4H 2E7CA 4Z7UF 2F5AH 4IIQA 4ONHA 5SX5H 4HIIB 4R8WL 5C07B 3UTSD 3WXVH 3W82A 5GGVY 1S9WB 1LO2H 4D9LL 4I2XE 3MLYH 5J0BA 4P0DA 2I24N 3BKMH 4XPHH 4QGTA 3U46B 4N0UB 2SEBB 1ADQL 1AHWB 4JDVB 4G80A 5IOPB 4CU8A 2Z8RA 4NN7B 3KLAA 1C5CL 3RPKA 2AGJL 2D0FA 2VL5B 4K23L 4Q58C 3U7YL 1NCUA 2ZOKB 5SWZB 3QRGH 4Y2OA 2XWBB 1MCWW 3V4VL 4WEMB 1II4E 5D2LB 4R4FH 1ZGLM 2W92A 5IIEB 4XCFH 3T0WA 1I1FA 2D0GA 4CVXA 3UXFA 2KQMA 5BJTA 1JN6A 5TJWK 1GOHA 2BX5A 3QO0B 5T5NG 3MNWB 1JGEA 4QHKI 4CAGA 3V8CA 1ZEAL 4H1LH 4PRNA 5DD5L 2NW3A 1KJVB 4EZMA 3VWKA 4D2NA 5GSVB 4CN6A 3P4OA 5H2BA 4MDIB 1BD2D 5EOQL 4GRLC 1TMCB 5GS0C 4NJAH 1T20B 4TSCH 2Q87A 4NC1C 4TVPH 5CEXA 4JDZB 4OT1H 4KDWA 3GSNL 4HZLB 3RI5F 3SJVB 3WUWG 4UAOC 1T04B 4UNVA 3V52L 3FOLB 1BVKB 5D5ME 3UC0H 1G6RA 4QHLB 5BZWB 3CFKA 2BRRH 3QIUA 5DJ6B 3PV6A 5IWLA 1QQDA 2DLEA 3DROA 3ULVE 3HUJB 5FHAH 5FO9A 4LPUA 1I8IB 2DBLL 5EU5B 1NGQH 1PZ5A 1W8OA 2DJSA 4J6RH 5TQ0H 2IGFH 4ZSOA 3VRIB 5L9DH 1LK2B 4NOBA 3HG1A 3DYMA 5C0CB 3STZB 1HH6B 4EOWL 2WP3T 1AGFA 5B3NA 4GRMB 4ODXB 4BKLA 1TCRB 4PUBL 2FEEL 5ICXB 1R5IB 1A6TA 4QYOB 2E6PA 2YZ1A 3H42L 2PN5A 5AYUL 1UM4L 4PJDE 1P53A 4FHBD 4HBCL 3IVKB 2NY4C 3VI3F 3V5DA 3KJ6H 3VFOA 1WTGT 3H9SA 3QXUA 4FXKA 3QUZD 3SDAB 3EFFA 4GW4A 1CIDA 4NQUA 4HV8B 4ERSL 1A14L 2DQJL 1HHKA 1P2CA 2MKWA 4QHUA 5CJQH 5DI8A 5CD3B 2EZ0D 4TRPL 3L3IA 4OCLC 1KC5L 5JQ6H 4XAWH 2VXQL 1CXFA 3BQUB 4HBQA 1QPXA 3MJGX 4KKCD 2YSSA 4WI4A 4YHIA 3HI6L 1AI1L 1OGAB 5I15H 2C1PB 5FA4B 1C5BH 1UXWA 3O4LD 1KB5H 4LSTH 1JHLH 3G6JE 1UCBL 3B8SA 1B4JL 1IAKA 2F54E 4OZ4A 1ZS8A 4ZPVA 3LPGA 3OGCB 5C09E 3GGWB 4HIJA 4Z0BL 3BP7A 4UDTA 5AD0B 4BH7B 1IGIH 5JOPD 2QR0A 3GJEB 1PG7X 3ARFC 4GRWB 3KPSB 1KCRH 3OAYK 2FLRT 3SDXA 5IVXF 4UDUB 2O5ZH 4CN1A 4CW1B 1D5ZB 1V7MH 5FOJA 4PG2C 4TULL 3IDNB 4G8FB 4JN1H 1E4KC 3KPQB 4XPTL 1JWSB 3CMOL 5DDHA 4WW1A 4DUXA 5FUOH 3B9KD 5KVDH 5LVEA 5IW1B 2MOVA 5IB1A 1PDKA 2B0SL 4KK6C 4JHWH 4OCXH 4NYLA 3B4NA 5J1AA 5INDB 4YBLC 5DFVD 3L9RA 2CO6B 2LVCA 5KS9B 3C8KB 4MHHI 3RKPA 5HHME 4OCMC 4L4JA 3ILQC 3UYOD 5CZXD 4M9OA 2BVPB 3UTPD 1C12B 4XNQA 4JQVA 4JY4A 1QLRA 4XBPA 3VXUD 5F7LB 2DQHL 2B1HL 3INUL 1AP2A 3GSWB 2R1XA 5DEGB 4PP2B 1JHTB 5MEPA 4YQXH 1U92A 1ZHBA 5ABDE 5I19L 1XCTA 3RL2A 5I75C 5GGSY 3CFCH 1V3KA 1BWWA 2BHUA 3NZHL 1QFOA 4PLNC 3L3OA 3LKOA 1CFVL 4PJIA 4OCWH 5EU4A 1XR8B 1G6RH 2VAJA 5JHDA 1DBBH 1FRGH 5BRZE 3LQAL 2FB4L 3B9DA 3QCUL 1OCWL 4GAJL 4HKZB 2CIKB 3D3VB 3QNZB 3QUZA 3OJDB 3IAGC 4DN4H 1J0KA 3FTGB 2AK4D 4I48B 1QTYT 3DUUA 1DCLA 1ADQA 1QBLL 3WIHL 4M02A 2DRUA 2IBZX 2ZCKL 1VFBB 5E70A 4HULB 1MCOH 4GRLB 3QXWA 2HJFA 4G8EA 4PJXE 1OLLA 3WLBB 3VDBA 4WW2A 1MLBB 5FKAB 4F9LA 1P4BL 2A0LC 4MS8D 3T65B 1IAOA 4WFHD 3DVNB 4L8SA 4WTZG 3C6LC 3O4LA 1L7IH 5ANMB 4ONOA 3MLSH 4W4OC 4R7NA 1KLFA 1UEMA 4Y1AA 4D0CA 3RU8L 3ZDZF 3F7RA 1CF8L 4GQ9H 5TDOB 4EUPG 1IGTB 1U8HB 2ENSA 5D1XC 3IDXH 5JDJA 3MR9B 2HJKA 4K71C 1IILE 3CSYA 1DBAL 1QVOA 3QZWG 1R6VA 3FFCD 4PD4K 5CBEB 5IJVA 3U0PB 2BSRA 3GSNA 3S36H 1QEWB 2V2XA 1R0AL 2FEEI 4KJYA 3TP4A 3RY6C 1FFRA 2R2CA 1NGYB 4Z77A 3B9KA 4LBEB 3L3HB 3AGVA 1FLRL 3FT4B 3QUMB 3DO7B 3GSVB 4MLIA 1LEIB 1X6LA 1CE1L 5DUBA 5ESVA 1M05A 1FDLL 1JNHB 1T80A 5GGQL 4KAQL 4NQSB 2CLVB 1RURL 3GUTA 1XGQB 5I1JH 3ZL4H 4RDQG 1PSKH 1EJ6A 3MYJA 3RUGF 5KJRH 1FV1A 5KSAB 3UJTH 2AJUH 3PWVA 3C8HA 4JZJC 5EU7C 4YHZL 2CDFB 4QHNB 3VXUA 4NHUB 1RU9H 3X14A 1BIIB 4ZUUB 3A6CL 4JEGB 3VXTA 4L9LC 1A22B 2NY5H 1WZMA 4J8RA 3S96A 4P5MB 3U36B 3QFDA 5D7LB 3MRMA 3HS0B 2IAMB 1DQJB 3ILPB 3KNBB 4XP4L 4XTRD 5EC1A 2UWEA 3V0AC 4PS4H 1E6OL 2GUOA 5B39B 1OOAA 2NXZB 4NZDA 2HVKA 4EQ3A 4HIEB 4NM8L 4G6JH 3MCKA 1DLHA 4BSJA 5E8DH 4E42A 2RB8A 2V7NA 3GKWH 4XCNA 4ZTPH 4XRCA 1KJMB 3WFZA 4IMKC 4LPCA 1NSNH 2AK4A 5ISZD 3MROA 1OAQH 1QNZH 2VE6A 3GIZH 5J3HC 3F6LA 2FR4B 1YZZA 4KTEL 3B9VA 3TNMB 4N9OB 2R29H 4JQIH 4S11A 2VDPH 4XBGB 3WDJA 3F65A 3BO8B 1CL7I 4YBLB 4L4VE 5F1SA 1I3UA 4U3XA 1A7OH 1MH5B 2X4NB 3K2UH 2W65B 4QRUA 1CD9B 3PHQA 32C2B 3IJHA 1X7QA 4M1GL 2DM2A 3AMKA 3PJSB 3QWOA 1RJCA 4PRID 4QRRE 5FO7A 1GGIH 2JB6B 1DVFA 3D2UB 3SKNA 4C4KT 2PW1A 5I1KL 1X44A 3GK8L 2JJSC 3VRLE 4LHUA 5MP6L 2AXFA 1A6ZB 2RIKA 4ZDHA 3W0WE 1Q9LA 1I9IH 3EJYD 5TE4L 4JO2H 5I75B 4PJEB 2PTUA 4PJ7B 2HFEA 4MZ3A 1AR1D 2QADC 3EHBD 2ZPKL 3NN8A 2XWTB 1FVDA 4NBYB 1JZ3A 1U8PB 5KZCD 2XICA 4BK4A 1VENA 4H88H 4YFLF 5GJTH 1LE9B 3ETBF 4K94H 3QIWC 3RHWK 2ICEB 8CGTA 3KPLA 2IANA 3VGGA 1QHPA 4NKOA 1ZEAH 5DD5H 1UA6L 2IF7A 4PREA 4G8IB 1AE6H 1AC6A 1JI2A 4ZAKC 4L29A 4DCQB 4QXWA 5EOQH 1RUAL 4LASH 4PJHB 2GYSA 2Z8SA 1OWRM 2Z91A 3CVHB 1U2HA 1FL6B 3KPPB 4G43A 5CP3A 3GSNH 4MD4B 5DJXB 4MAYC 5I9QB 5DXWA 2XTLA 4O02L 3S5LA 1I75A 3MLVH 4K3GA 3C6LB 4F80A 4PJCA 3CSPA 4PY8I 5HI3D 4UB0L 3NPZB 4LLWB 1YMME 4B50A 2NLJA 1ZXQA 2DBLH 1XR9B 2ORBH 3QUXD 1TVDA 5H94B 1BF8A 3VGDA 2GT9B 5BXFA 4OLXH 5D1XB 4N8VG 1ZWIA 4FABL 3QULA 3QJFB 3WIHA 3U4EA 2Y5TA 4K71B 2H1PH 5J11B 1KTLA 1YEFH 2BSSB 4EOWH 3V0WL 3RGHA 1MRDL 3H3PH 3O6KL 2CGRL 5DR5H 2I5YL 5IEHB 5ISZA 3TO4D 1VKXB 1QA9A 5I1EH 2C9AA 4ZO7A 3WL9A 1AD9A 1OP5H 1DTUA 4UNUA 2IPUK 4HC1A 1IQWL 2ATPA 2VDOL 1N6QL 4G9FE 1S3KH 4NQCA 1BZ7B 1NGZB 4Z7WF 2W9DH 4ERSH 2BNUA 3S88L 2JCCE 3D87B 3ZT7A 3KXFE 3MNZB 2IQAB 1W0VB 4F7EA 4WHTB 5ID1B 5LAXB 3VRJA 1R24B 1OTUC 4L4TA 4R0LA 4TRPH 4I77L 2E7HA 1SMAA 3NIDF 4MB3A 2XQBL 5GJSH 3QXVA 5HXMA 5EIIA 5E7BA 1BVLB 4M6AA 4JZJB 5IK3B 3HI6H 3M1BA 4JHAH 4P2QE 4PJAB 4PJ8A 5FUCC 4QGYA 3BDBA 4KZEH 3R1GH 4Y5VC 5E4EB 1WT5A 4L9LB 4HGMA 5DURD 3DXAB 1UCBH 4LU5L 3S35H 4W6XB 3LPWA 4FQCH 3S97C 3BE1L 3OR7B 2Q7YA 2R56H 1S7SB 1F11B 3QFJE 1NCDL 3TZVC 1CGTA 2PYEB 1G7HA 3ARYA 2F19H 5I2IB 1H3XA 4GKNB 4PLKD 3SE9L 3IFLH 1M6OA 2EH7H 1LMKA 3HI1B 3VD7A 2DQIL 4JFEE 4HHAA 5J6GB 4UINH 4LSRL 1MRFH 2B4CH 2P47B 2F8OA 4LCIL 4ZTOL 3BAEH 3CMOH 5JR1L 1KIUA 1VEOA 4LGSB 2CKNA 5EBLA 2ZUSA 2XPGB 3OAUL 4LF3A 2V2WA 1XF4A 5HHNB 1ZHNB 1AXTH 5C0AD 4OM0L 1IM3B 4RGMC 5CIPB 3CFJB 1CICD 5JORB 3WNLA 3VXQA 3P73B 43CAA 4NOFA 3DTXA 2L0DA 1FP5A 2H9GB 4YDVA 2V5SA 4U1IA 2XXMB 4HGWA 1HXMA 3VDCA 5HVHB 1RK0A 3QUXA 3K7UA 4M5YL 4OLYL 1JGVL 1PKQA 5IROA 3RVXD 2FJFA 4ZFGH 3CAFA 2DWEB 2W0PA 2CLRB 3QQ9C 3V9FA 3GMLB 3G04A 4KK5D 5CP3H 3JV6B 2NY1B 4X98A 1U8QA 3FAXA 5SWSA 5EFIA 1NFDF 2J1KA 4WU7A 5GRXG 2Z4QA 3D9AL 3TO4A 1ZLWK 1NGWA 2OR9H 5EBMA 5F7FA 3TPUB 3G5ZA 4RQQA 4AZ8A 4LVOC 4X9GA 5E5MB 3EO0A 4GAJH 5DO2D 1AO7B 4YUEL 5HJ3B 2EDYA 4ZPTA 3O6LH 4H26A 1FFOA 3D48R 1DBMH 2P48B 5E00B 3PQYE 5EG6C 2GSIB 1ZAGA 4NKMB 1S7UA 5DFTA 5F7DA 4OB5H 1KB9K 4ODHL 5C08B 3WHXB 1YMHB 3H9HB 5DZOA 3V5KB 2BMKA 1I4FB 1KCLA 5JUEL 4DK3A 5CCKL 3ZE1F 1TJIL 2DL9A 4L3CA 2R39A 5JW4Q 3LKRB 4I0PB 4MAYB 3RTQA 5AG8A 2MSPA 3P9LA 4PFEA 1IKNC 5IKCB 4HC1H 4R4BB 5EA0H 5FK9A 3FB8A 1HWHB 5FYKD 2XZCH 1GVIA 3MRDA 4CVUA 3VMNA 2G60H 2FX9H 3SKJL 4HK3J 1JZ7A 1A6UH 4ORZC 5IMKA 1IQDB 5DRXB 1MIML 3IJYA 4PJFA 2OBGA 4ELMF 4BFEA 5IV2B 1IT9L 5DHVB 3UBXB 1UC6A 5KSVB 3GI9H 4OZIB 1DJSA 2OSLB 4M93C 1AGCB 3IFNL 4P23A 4XX1G 5DZNA 4JM2C 5CINL 1PG7L 5EPMA 2UZYB 5DJAB 1S9KC 3ULUH 5F88A 4NNPH 5EOTA 3V6ZA 4MD5A 4A2MA 2V17L 1MNUL 5I0ZA 3FFDB 5E2WH 2ZNXA 3QEQD 3THMH 1FDLH 1MUJA 1YN7B 5J9PA 3EZ8A 5C0AA 5GGQH 1FYTB 1XZ0A 5GRUL 1TJHH 2DM7A 5FKPA 4OZGF 3BPCB 4UT6L 3U83A 4QRQB 1T0MA 4OF7A 4YHZH 1MFBH 4HS6A 2A1WH 4LCCC 1QR1A 2HRLA 1J0IA 4OGAC 4Y5VB 4EXPX 3LEYL 4P59H 43C9B 3U0WL 4K7PH 1DN0B 4V1DE 4OZHB 2E6QA 1N6UA 3Q5TA 3WD5H 4X4ME 3CLFL 3D85B 3OZ9H 4Z0XB 4JO1H 5JPNB 1TZGH 3DX7A 3TZVB 3QDME 5KG9A 2R0LL 4Y4KA 5DMKA 4KKBD 1U3ZA 3Q3GB 1UQSB 1M7XA 5GXBB 2OTPA 2PF6A 5CD5C 1CK0L 1KIQA 2MHAB 4MHHG 4NBZB 3WUZA 4ZS6D 1KT2B 2FD6H 1KCUH 2N56A 4K3EL 4XC1L 1G0XA 1BVZA 1UB5A 4FFZH 4YXLL 2FJGA 4ODSH 4DTGL 2UY7A 1I8KA 5ACZB 4LAQH 3PP4L 3TBYB 5ITFB 3BJ91 4PJGE 1S7TB 1J05B 3I50H 1JVKA 5IQ9B 3MJ9L 4IRJC 5FGBC 3DUSA 3MODL 4RGMB 4WNQA 4LNRB 3IKKA 4Z6AT 1KJ2L 2EO1A 4D9QE 2NTSP 5C0BA 2QJDA 5E8OA 4M1GH 4NN5B 2P5ED 1AGBB 4DFIA 5EU6D 4Y88A 3ZKMD 3GDBA 1MCPL 5CZVL 4WUUE 1Q9WB 4X6CA 5I1KH 1DLFH 4JCLA 4PJ5D 3JV5A 1NEUA 1XAUA 4WTZA 4MNGB 4OJFL 3MRNA 3JUYA 1NKRA 1DFBH 1N8ZA 4NRXB 3GMRB 4DVRH 3BESR 4QXGL 1CXLA 4KVCL 4JFPA 2X4UA 2VXVL 2NTFB 3N0PB 2XTJB 4NFBA 3OXSA 4JZNB 2VXTH 3N1QC 5GGTA 5EO1A 2NY0C 1ITBB 3OB0K 2LQRA 1KIRB 5I74C 4AJ0A 3PHOA 3QEQA 1QFWM 4AG4H 3LOWA 1LK3L 2A77H 2AERT 1WVZA 4S1SH 4P5TC 1O7VA 3M45A 2EE3A 5EUOF 4PBVC 4DOHE 3SGEH 5HHQA 4RMSA 2GTWB 3OKMA 2A38A 1JNLL 3MV01 1JF1B 1FNSL 4KROB 4D9RE 3S37X 3QBTB 3MFFB 4RMVA 2E8ZA 4LPYA 1FO0L 2K1MA 1OQOA 1ORQA 3SCMD 1HHGB 3REWB 2R69L 1A8JH 1WC7A 4ZD3H 4PRBA 2D03L 4CDHA 4XNZC 5HHOD 3IKCA 1J0YA 1IAIL 1R3JB 2AJZA 4LL9A 2VZTA 2ZCHH 5CJXA 3ZSTA 1YNTB 2CJUL 3JWDL 3O6MH 2QHRL 1HK6A 4RZCA 2NY3C 5DT1H 3G5XB 3AROA 2XOTA 4ORGB 2G2RB 5I16A 3TBVA 3IFPB 4WWID 3OX8B 1EEZB 3PWPD 3V0WH 4WFED 4K3JL 3PWLB 2D2OA 2GTZA 5DLML 3WS3A 2QBWA 4ZXBC 2Y06L 4P3DB 3U9UA 5ICZB 1MAJA 2CDGB 1C5DA 1M4KA 3ROOA 2B5IC 4KI5D 3VFGH 3AREC 1EO7A 4OD3L 3N1PC 4AIZA 3MJ6A 4XP1H 4TSAL 2AVGA 2XWJA 1ZV5A 3T0EC 1O0VA 2YR3A 1S5HA 5AZEH 4N8CL 5E6ID 2DYPB 4YHMH 3MCLL 4HUVB 2UUDK 4HKXA 3QI9C 3MRBB 4Y19D 5F3HB 5BOZG 3IJSB 4DKFL 5B38A 1XF3A 4MAUL 4P4RA 3QAZC 1WISA 4P2OD 4YHYC 4DUVA 1NLDL 4MCYA 2AJSL 3BGAA 4KQ3H 2P5EA 4HWZA 3O2WL 2O93L 2Y36L 4JFQA 3WFDH 4FTVB 2GCYB 5D7IA 4YX2H 5JW3L 4YZFF 2AJYL 4C56E 5JLZA 5KSBE 1RIUH 2X4OA 4PJ5A 4NGHL 1QO3A 3ROLA 3HNSL 5I8KL 1VPOH 3UZEA 1A0QH 4POUB 4NSKA 2WUBL 4HH8A 2VC2L 1K6QH 4CNIB 5E08H 1IC1A 4TTDD 4JRWA 5FF6B 1YUHA 1NCDH 4LMQI 4PB0H 5DVNA 2X70B 4BH8A 4U1MB 1DUZB 5E03A 1FQ9C 1I1AC 4X6FB 2Z93A 5FYKH 4JZOA 4KUCF 5DC4B 4BELD 3FONB 2EDDA 5DA4A 1JHKL 5F44A 2BFVH 5ERWB 2ITCA 3RNQB 1QKZH 2X5PA 4NM4H 4AEIL 1H3GA 3AMLA 3BI9X 1MRCL 4ZTOH 2DQEL 2CK0L 3OQ3B 4RRPG 1LO0L 3Q2CA 3GIVB 1H0DB 3RWEB 2YUXA 3LIZH 2RQ8A 4KRPD 5DS8A 3WFHB 3LS4H 3SBWA 4IRJB 3TO2B 4EUPH 2NZIA 5GGTH 4P46C 1ZT7A 1E6JL 4LSSL 1KNOB 5E9DB 5HHOA 1J0ZA 5D71L 4HUWA 5L88L 3LQZB 2AP2A 3HG1E 4Q0XH 5GS1C 3I75B 4M9PA 4MVBD 5DK2A 1TZHB 2PXYC 2WWKO 3C9NB 4U2ZA 1MWAB 5IHZA 3QJHB 2WV3A 1MJ8H 2C3XA 4PRHD 1NL0L 1J8HE 1T66D 3MO1B 5LGJA 2RCSH 3I84A 5I8CA 1UKSA 4FG6D 5GS2D 5FA3B 5DRNB 4BSVA 3PWPA 1G7PB 5IMMA 3V5HB 1W72B 3H9SE 2Z35B 4KV5E 4U0QB 4AENA 1I3GL 3D9AH 3MC0A 4GAYB 1FZJB 5TE7H 3I9GL 3VFVB 3MRLB 3QT2A 3OKEA 1UWXK 4NQED 1FVCB 3VI4E 3VFSB 3ZDYE 4U2YA 1KJ2A 3SGDI 2XV6B 3IAQA 2NY0B 2DQDH 2Y25A 4WENB 5F1NA 1RZGB 4Q6YA 5I74B 2MMXA 2VWEE 4JRXD 1PW3A 1R5WB 1KFAH 1XH3A 3UTSE 5B4MD 1NBVH 5CWSB 4P5TB 4Y19A 5GSRA 3DURB 3PGDB 2BOCB 1RV6X 2EIBA 3X3FL 3KDMA 1BM3H 3CFBA 4P2OA 5CCKH 1D6EB 1JBJA 1KBGH 1FC1A 3SDDB 2P24B 4WUKL 3RVVC 1N64L 2VDNL 3C5ZD 4MMXC 2V2TA 3MRRA 4XMPH 4JGJA 2DKMA 3TV3H 5I8OH 1BQUA 4XNZB 2XZQH 4XX1E 4E41D 1I7ZA 3N1FC 1IAII 4OI9A 3KYMB 2DQCH 4N90D 3KG5A 4ENED 3IU4H 4K7FB 1MIMH 4XXCC 5E8EA 2ZJSL 1YEDA 1NCAL 2NY3B 2KBGA 3N1MC 3WS6A 2LFGA 4B0MM 5I71B 1BD2E 2FX8H 4XCYA 3U1SH 4IM8A 5CINH 1PG7H 4F3FA 4L1DA 5ESAB 5E8PA 4L9DA 4OLWH 4ZXBB 1A21A 1IEAA 2OP4H 3JVGC 4E0RB 9CGTA 5A2IH 1EBAA 1HKLH 3AREB 3QIBC 3WO3B 2FIKB 3A6BL 4WDIA 1QSEA 4MA1B 2EDHA 3T0EB 3U79A 4HK3N 1EHNA 1FCGA 3NIGF 5F7WC 1L0YA 2IH1B 2W59A 5F7HA 3QI9B 2DMBA 3MJ8A 4NCC1 3EJZD 3F8UB 4RGOH 3R8BB 3ZDXF 2Q76A 3LKPA 3LRGA 3QAZB 4YHYB 3MZGB 5KVEL 2ARJA 1VACA 5L2JA 2J8UB 1FIGH 1X5GA 4PRHA 4FQ2L 4H25B 1T3FB 2UVFA 1Z9LA 5F9WC 4GG6F 3NABL 3U0WH 2O26U 4W4NA 3G9AB 4F57L 1YPZB 5IVOA 2Y7QB 5IQ7H 3I3EA 1XIWD 4OF8A 1JGUL 5FUZL 2O61B 2BZDA 4XNYL 3HE7D 4HPOL 4XH2B 1A7RL 3VFMA 1JJUA 1T2JA 4IOIB 1I1AB 2FBOJ 1T1WB 4L1HA 2PTTA 2YUWA 2ZUYA 4NZUH 4R7DB 2ERJC 1ZLWH 3WIFB 1S9VB 4Y16B 4PGEA 4H0HB 1ZLVK 3VXMB 1Q1JL 4N0CD 5IGXH 1UVQA 3RA7L 4K3EH 3O6FC 2EIZA 2HTKD 3PWUA 5GGUA 5BS0B 4F33B 1HSAB 4QY8B 1A6PA 4WEBL 2V5YA 5CUSL 4YHOL 1CBVL 2CR6A 5EUKB 3OBAA 3BN9D 1OSPH 3C5ZA 4E5XB 3MODH 3JSSA 3UTZA 2WP3O 2R2HB 3T3PF 5BW7A 3HZMA 3RJQB 3JXAA 1PQZB 3FO2A 4I3GA 4E41A 5C07D 4OIIH 1AXSB 4YEEA 3GMNB 4FFWD 5ELIA 4WV1A 5GS1B 1CXEA 4KH2A 1EUTA 3MRJA 2PXYB 4QTHA 3QXDB 3WFEH 3VI3E 3TH3T 1RZKH 3MV7E 1R3KA 2CRZA 4PGJA 4G7YL 3PGCA 4OJFH 3T77B 5SWZD 3WJJC 4J3XA 3DGGA 5EO9A 3VJ6A 4IHOA 4IIQC 3L6FB 2CD0A 3MRGB 3RAJH 4QXGH 2BC4A 4HJ0D 2HFFA 4NKQB 4OTXH 4RMUA 5KAQF 3O8XA 4R96B 1INQB 1TJGL 4DQOH 2ZZUT 3MA7A 3UTPE 1MCCA 3BH9B 1LK3H 4JFXB 2VQ1A 1KELL 5HGAB 4MDJA 2F74A 3HR5B 4HWBL 5KN5B 4HDIA 3CVIH 3FHAA 4LGRB 2Z92B 3VFRB 2ATKA 3MX0A 2DLHA 1U36A 4WHYG 2B1AH 3HC0A 2FEDD 2KZ1B 3BWAB 2RJMA 4JAMB 1ZSDA 1CDHA 1GJIA 4XCCL 2P8LB 3JWOH 4Y4FD 1UT9A 2VXUL 2PW2B 3PXHA 5J6HA 3D39B 4KKLD 3T1FB 5SV3A 4Z7UA 4ZUWB 3HNVH 2D7QA 1DBKH 1HNFA 3VWKC 3DMMA 1G9NL 4XCEA 1NEZG 1WZ1L 1QR4A 4HQQH 4M4RA 1MFAH 2IG2H 2YPKA 4GXUN 4CVWA 4HGKC 1Q0XL 1IJ9A 1UYWL 1KENH 4Y8AA 5GISH 3TYFB 1IL1A 4X80L 2X1OA 5TDPB 1ZE3C 5F1IB 1A3LL 2GJ6A 3QIUC 4M1DL 1Q0YL 5HVFB 1OP3K 5IWLC 4ZUTB 4GRWF 3O41A 5LXGH 3K4DA 1EMTL 1NMAH 1FL5A 5FV2A 2N1KA 4PJBB 3BW9B 3QIBB 4JFYB 4WFHE 5GS2H 1EGJA 4AT6A 3OG6B 3PL6D 3SDAD 1YJDC 1F58L 4H1LB 2FHFA 2JJVA 3FB6B 1KPVB 1ZVYA 4WI2A 4WHCA 1JZ5A 1GSMA 5JZ7C 5KOVC 4TUOB 3WKMH 5BOPA 4DKFH 2VDLH 4GS7C 4OQTH 5GZOD 3BQUD 4HIIA 1BFVL 4IRSB 5C07A 2YMXH 2ZCLL 4XBEH 1XMWA 1S9WA 3FFCE 1EERB 4TTGA 4OCRH 3U46A 5DSCB 1OGAD 3NMEA 4N0UA 4TOYL 1LP9F 5L7XH 3P0GB 1AHWA 4JDVA 1CFBA 2X7LB 4N0FB 5IOPA 4YR6A 3HNSH 4OLUH 5DYOA 3MRIB 3H7BB 3TFKC 5GS0L 4LLDB 2HTLD 2VC2H 3RY5A 2DMCA 2P4AB 3FT2B 2HA1A 1ZT1A 5ID0A 3EDFA 1L0QA 1T1ZA 1W0WA 2AQ3A 1EEUA 2VLRB 1J5OL 3O3BA 1QACA 3KHOA 2ERJB 1P69B 3L95A 1FZMB 1JHKH 3AS0A 2HKFH 4JG0H 3MNWA 1NBZB 3OB0H 2LAGB 1MJJA 1MRCH 1P5UA 3O6FB 3RVTD 1GH7A 2DQEH 2CK0H 5GSVA 2QQLH 2R9HD 3HHRB 1NMBL 2CMRL 3FQUA 3WLWD 5I1IH 3V6OE 5DHYA 1P7KB 3ZDZE 1RZJL 4JDZA 1JPTH 1P4IH 1FFNB 2XRAH 5C6TH 4Q7DA 4XVJH 1T04A 4H0IA 3FOLA 3U30C 1BVKA 3S37L 5IJKA 2AEIT 2BDNH 4Y4FA 1UM5L 2NX5A 4X7SL 5DJ6A 4LSSH 1BQSA 4MCZA 4MYWB 3DRQB 2H6PB 3QUML 3WFBL 3HUJA 2K7QA 2A6DB 4JPKH 4LSVH 1I8IA 5EU5A 5D2NE 1YEIH 5DD6B 1FLTX 3UTQB 1KB5B 4O5LH 2P44B 4N8PA 5FYLL 4KY1L 2VDMH 1KXTB 4U1LB 2OK0H 3EUUA 5SX4I 1NCCL 2VRAA 1QFHA 3STZA 4KMTL 1LO4L 2AEWA 4Z9KB 1LQSR 1A2YA 4QRTA 1INDH 5ENWA 4WFGD 5DD3L 4JQVC 4TPRL 3L3GB 3RUGE 1HINL 4MD0B 4GXVH 4GAFB 4HCRL 1CWVA 4O51B 4QHMA 4YFDB 3WIIL 1CLYL 3PL6A 2W60A 3D3VD 4LFHG 4YPJA 1JI1A 1VSCA 2D4FA 4G80B 4M62L 3VWJD 2EICA 4X5LA 4GT7A 2VIRA 3U48A 4PRIE 1H15A 1N2RA 2EDRA 1U0QA 2JB5H 3X3FH 2H8PB 4GRLD 5GS0D 1I7UA 3P30H 1BEYH 3BQUA 1OD7A 1C1EH 1J1OL 1SM3H 4Z76B 3NFNA 1FFPA 4EBQH 4LP4A 5K9JH 1OGAA 1TQCC 4F7CB 5BJTB 1BBJA 5D6CA 1YQ2A 3QUZC 1EGJH 4LCWE 1MFCL 4JPWH 4JY5L 1U6AL 2HLFD 5J56B 4PRNB 5F8QC 2NW3B 1KPUB 3OGCA 4P2RA 2FGWH 4X7DC 3P4OB 3GGWA 5H2BB 3VA2C 3C5JB 2EZ0C 3TESA 4HMEA 5A2KH 2ZJSH 4HWBA 4WW2C 5JPMA 3MZTA 5CEXB 4F9LC 2VLJA 3A6OA 1NANI 4L8SC 4JREB 4EIGB 5IBLD 1HHHA 1G6RB 3FRPG 3CFKB 3IDNA 3KPRE 5EBGA 2GY7B 3KPQA 1QQDB 3DROB 3LPFA 4KTDL 1JWSA 4K94C 1PG7W 1P84K 4Z7VF 1PZ5B 1TENA 5F7UA 5IW1A 4C4KO 2VZ3A 1OAZH 1NBQA 4LHQB 5I18H 4ZSOB 2N4IA 1BBDL 2CRIA 1E4WH 4KXZH 5F71A 3D69A 5FYLD 1A7BA 2VDQL 4Y2DB 3SGJA 5KSAD 1I9JH 2BVPA 3LKSB 4GS7B 1IGCL 3NH7H 3HNTL 1BWMA 2EEAA 1F8TL 2ZOLA 3F6IA 3KVQA 3B9KC 3P0VL 2G9HA 3V5DB 4PP2A 4FXKB 1JHTA 5JTWA 4GXUM 3NABH 2Y5EA 4N9GB 5D7LD 4OIBA 2IAMD 3CVHL 5DFVC 1UWEL 2XFXA 5JO5B 1OAUH 4O00A 5LBSL 1HHKB 1P2CB 4PB9H 4QHUB 5CZXC 2NXZD 1T5XB 3SO5A 3L3IB 1XR8A 2NXYB 5IB4B 2VKXA 4OI7A 4PJEF 5FYKU 3M8OL 3BD3A 2YSSB 4HKZA 2CIKA 3QPQC 3D3VA 5GGVH 4NWUH 1UWXH 5MEQB 3I2CL 4WCYH 3OJDA 4H8WL 1V7NH 3GBMH 5IR1A 3FTGA 3RA7H 3KYAA 3VWJA 4JFFE 5E94A 1YNKH 1IAKB 4XMKH 2OXHA 2JJWA 1CDIA 5HYSB 5E2JA 3GBNH 1B0GB 4FFVD 4HIJB 4I0KA 3WLBA 4YHOH 1PEZA 1MLBA 5T1LD 2LE9A 5AUMB 4Y7MA 3EKCA 2QR0B 3N9GL 2VDRL 4EIZC 3T65A 3ARDB 3DVNA 3SDXB 1ZLSH 2Y1VA 1K3IA 1UACH 1NFIB 1SYSB 5ANMA 4NO2A 1WK0A 2ICWJ 1LEKB 1JP5A 4OUUA 3VD4A 2JTDA 3D2UD 1MCSA 2PYFA 5I1AB 2XQYG 1NUNB 2Q86A 3MR9A 1DQDH 5EZLB 5D6DA 4NYLB 2CKBH 4G7YH 3GSQB 4Z7WE 3QCVH 3NACH 2VZSA 1GGBL 3L9RB 15C8L 3U0PA 3GJFK 5L0QC 5I1LB 5GQBA 5T1DL 5T33H 1U8NA 3B8YA 4XNQB 2EXYD 1QLRB 4D3CL 3LN5A 3FOMB 1PX4A 3VXRE 1URLA 1ZGLA 2XY1A 2X10A 5A2FA 3L3HA 1DVFC 2B4CC 1AP2B 3QPXL 2R1XB 3QUMA 3DO7A 3GSVA 1JPSH 5MEPB 1JNHA 1U92B 5TQ2L 3ZTNL 2PETA 1HH9B 5K9OA 3RL2B 4ZS7L 3K80A 2BVQB 1XGQA 4M43L 3MTRA 2DS4A 1MCRA 1YEHH 4DN3H 5KSAA 1YYMH 3O0RL 2ENYA 3WNMA 4PJIB 2CDFA 5EU4B 4QHNA 4KFZC 3VFWA 5JHDB 2A0LD 4ZUUA 3MA9L 4XCCH 2EDOA 1TQCB 5KSUA 3C6LD 4YDIH 5JW5A 3LAFA 4P5MA 1S9YB 1RUPH 3K81A 2ITDA 2IAMA 3EYSL 3DUUB 4PPTA 2HKHL 1DQML 4X7EC 4M7ZC 1HZHH 5BZDA 5D1XD 1UYWH 4HIEA 4G8EB 4L3EA 1ROWA 1MELA 4JR9H 4WW2B 3K0WA 1CVSC 5EDXA 3PDDA 1A1NB 2DMKA 2ZUQC 2VITA 5IMOA 1IAOB 4XPAH 4L8SB 1MHCB 1ZLVH 1RVFL 4X5WA 2L7UA 1PAMA 2P8MA 4Y1AB 5C8JA 3OB8A 3TNMA 2IMMA 5T1LA 2DLFH 4XBGA 3CSYB 4XNUH 3BO8A 1JNNL 3EGSB 5D5MF 1EO8L 3ULVF 4CN4A 4RIRA 4AL8L 2BSRB 2W65A 3GSNB 4PGDB 32C2A 2V2XB 2NYYD 2ZCLH 1F13A 1NFDE 4KJYB 1RUQH 4I5BA 2W07A 1RIVH 2I9LA 5D8JH 1WV7T 2BERA 1UENA 3BEWB 3D2UA 5DQDL 2BJML 3MRHA 1Q8MA 1CGSH 1QG3A 4LQFH 3DXAD 1RK1A 5ESVB 3TNNB 1A6ZA 2F54B 1NUDA 4PBWD 1DP0A 1UB6B 2CUMA 4ELKA 3GUTB 3STBA 2XG4A 1I8MB 4G8GA 3BZ4A 3QEQE 3MYJB 4PJDF 4R0LC 1FV1B 2XWTA 3WXWL 2QEJA 3S6CA 3PP3K 1PY9A 4P9MH 3S3SA 3KJ4B 1INEH 3TWCH 4V2BA 4PJ8C 3X14B 3W39B 3ULUC 3VXTB 2ICEA 1WT5C 3PE9A 5E2VL 1CGYA 5J12B 4J8RB 3S96B 1U8KA 4OLZH 1JRHL 4UV7L 5HHPA 3EJYC 3EYUL 4DCQA 4WTXA 5J3HD 4AQOA 5EC1B 2UWEB 3NIFF 3BIAX 3CZFB 4NO0B 3EHBC 3ALPA 4P3CH 5FO8B 3CVHA 3UTTD 1FL6A 2HVKB 5EBWB 3O4OB 2XQYK 1A7NL 5DJXA 4PRPA 3RNKA 2V7NB 3S37H 1FORH 4XRCB 6FABH 1UM5H 4X7SH 2GAZA 3G6JF 5CEZL 5KVGH 1AIFB 3U7WH 2AK4B 2YKLH 3MROB 1J11A 4NQXB 4X6DF 5L2KE 4JGUA 5F97E 1BAFL 2IQ9L 2X1XR 4OKVA 1QFUH 4MXVF 3N85L 2OJEA 4EDWH 1I7TA 4GLRH 4LDOB 1UZ8A 2BSSA 5D7JD 2NY1D 4DJMA 4OZGE 1CLZH 3ORJA 2XACC 4K3DH 5HI3C 4QRUB 1HINH 3IJHB 3O3DA 1A6WL 1MEXL 1X7QB 3NCJL 4OFYD 5IVZB 5BRZB 3H0TA 3QWOB 3QUXC 4QF1A 5FO7B 1AO7D 1DVFB 1BZ7A 1QLEH 3E2HC 1EEYB 3SKNB 2PW1B 4FQHB 1NGZA 5IROC 1R3IL 2EE6A 5LCVH 3IDMB 4LHUB 2AXFB 3TPKA 5EU6E 2J4WH 3QNYB 4WHTA 4HIHB 5ID1A 5C08D 2AAVA 1ZKAA 3R0NA 2HFEB 3TO4C 4FQ1L 4POYA 1BVLA 3CDGA 4JZJA 1D6VL 1I9EA 5IK3A 3MBEB 1V3LA 1F6AA 4PJAA 4BFBD 5C70A 4I0PD 4MAYD 2J6EL 4PV9A 3Q6GH 2GK0B 2BSTA 4F9PA 1BFTA 4JPVH 4JY5H 3KPLB 3BEVA 3CGTA 2IANB 4KK9C 1YECH 4NKOB 4UI2A 3W11C 4PREB 3OR7A 3KYKH 4L29B 1OTTC 1XGYL 4J3UA 3WN5A 1I1YA 4G43B 5I2IA 1X4YA 3FQTA 1F5WA 4HAGA 3RTQC 2ZUQB 1FE8H 2EDJA 2EYSB 3MQIA 5HDBF 4PJCB 1NCBL 2E9IA 1U8OB 4W68A 5CEZD 1IC7L 2NLJB 4PJXF 3ZYJA 1HN1A 5HTSA 3LHPH 3UTTA 5HHOE 5BXFB 1DEDA 1JTTA 1ZWIB 3QULB 5CHNB 5F8RC 1FYTD 1KTLB 2DF3A 4MZ2A 4P23C 2E3VA 2FECL 1OTUD 3S4SA 4ZNCD 1AXIB 5ISZB 1QA9B 1OM3H 2N7BA 2O5YL 2V9TA 3NPSC 1AD9B 3H8NA 4WFEE 4LVHC 3LKQA 1U3HB 3MOAH 3UYPA 1RPQA 3EFDH 4NQCB 4NQDD 5T3XD 2DWEA 4J4PD 2HN7B 3T04D 2CLRA 4KI5E 2BNUB 3EOTL 3TBWB 5CEYA 3GMLA 5D7JA 5K59F 4ODTL 1RFDL 1DEEA 1ZANH 4KUZH 4NRZB 4F7EB 3D85D 4L4TB 4XWGH 3FN9A 4R0LB 3TPUA 4ELMA 5EIIB 5KAQG 3MLPA 3O2DL 3M8OH 4HH9A 4S2SB 3SE8L 4W6YB 3M1BB 5E5MA 3FMGL 5D93C 4PJ8B 5HJ3A 3I2CH 3C60D 1V3JA 4H8WH 4WHYH 1JFQL 2C4XA 5E00A 2WMPA 2GSIA 2IPTL 4YH6A 4NKMA 5E2UL 4KHXH 3PWNA 3MLRH 1K2DA 1JRHI 4O4YL 4U6TA 3H9HA 3UBXI 2Q7YB 2W0FB 3O2VH 1YEKH 4Y4KC 3Q1SH 1G7HB 4JKMA 3LKRA 2X05A 4I0PA 2BVUA 4BSWB 4JO3H 4U6HB 1L7TH 5IKCA 3GJFA 5E6ZA 4HHAB 2OMNA 4KC3B 4F7MA 4RISL 2YS4A 1IQDA 2X6MA 1TTUA 1CR9H 3UTOA 4P49A 2I27N 3NCFB 2IBGA 3FZUD 5DD0H 1FPTH 1XF4B 1GGUA 2AS5M 1RULL 3GMPB 3KS0H 3QQ9D 1ZOXA 1B0RB 2AK1H 1BGXL 4WU5A 4R4NC 2X4QA 1WTLA 4UMGA 2XTJD 4GOSA 4TUKL 2XN9E 4HGWB 3MSPA 4JM2F 1WGOA 3FFDA 3Q5OA 3QUXB 5D7SL 3RIAF 1NKOA 4F37K 1PKQB 2XXCB 1RIHH 4JLRB 4GO6B 2A74A 4KKNA 4KMLB 2DQGH 3BP5A 3WSQL 1F4YH 1U8QB 3O0RH 4U1KB 4KROD 4DFHA 5SWSB 5EFIB 4WU7B 1JPFB 2ESVD 2Z4QB 3LEXB 4LVEA 3TO4B 2R2BA 1RAMA 1AR2A 2VR5A 5CFHA 4OCYL 4RQQB 5JA9A 3B43A 1REIA 4JY6A 2C3WA 5HYJA 3EO0B 3VRLF 4NQDA 1ONQA 1NCWH 1RJZA 4J4PA 4ZPTB 4H26B 5HGBB 4BQBA 4NQEE 2EIEA 4EVNB 3FQXA 1S7UB 4OZHA 5F7DB 1YMMB 5C7XL 5CILH 4PJ9C 4YXHL 2BMKB 2OL3H 5JPNA 5E99L 3IRPX 4JRXE 4K2UL 3RIFF 1B88A 5CJOL 2X1WL 3HMXL 4QTIH 3RTQB 3C60A 2B2XL 1KT2A 3X3GL 3T09A 1MWAL 5DURB 5FK9B 1IFHH 3FB8B 1LDPH 3CDCA 5IESH 2J6EA 1L9NA 4U6VH 3UO1L 5JOFB 5CJXC 3D18B 4QOKA 4CVZB 4G42B 1I3VA 5IMKB 2IWGA 2OM5A 2YPLA 4PJFB 3TBYA 1ND0A 5ITFA 5F9AC 1W72L 2CQVA 1J05A 5E5UB 4KKBC 3K4AA 2DYPD 5IQ9A 1ZLUH 3JTTA 2JCCB 4WFFD 4N90E 5BVPL 5BMFH 4LNRA 5DUPH 5GPRA 4ZS6C 2E9JA 4P23B 5F70A 5EUOA 5LG1A 4U7SA 5A3ID 2FECI 4KQ4H 4MQTB 3PWJA 3ES6A 3LRHA 4LLQB 1OVZA 3U9PL 1AGBA 5EOTB 3NPSB 4JANA 4FTVD 4MD5B 1NAMH 4NZTL 3HPJA 2A6JA 3CD4A 3EOAB 3NFSH 1BJMA 4OGYL 2QQNH 4OFKA 3BDYL 4LDEB 4XXDA 5GGRY 1CN4A 5J9PB 5DVKA 5C0AB 1X5IA 1XZ0B 4KRMB 3H2WA 5FKPB 4NRXA 2UY6A 3GMRA 3NFPB 1WWBX 1HDMA 3VFUB 1X5XA 3B83A 4WHDA 3GJFH 2NTFA 4YJZL 3P11L 3T0DA 4JKPH 3KR3L 4HS6B 5CD5D 2YRLA 1KIRA 5D93B 5JXAL 1QR1B 3TYGH 1KXVC 1FBIL 4XVUD 5AZ2L 4CKVX 1Z3GH 1MFDH 2YOCA 5D7KD 1J9CT 1BFOA 4S1QH 3PUCA 5D1QC 1N0LA 2ESVA 5IBUG 3DX7B 5KG9B 3MFFA 4DGYH 5DMKB 4Y4KB 5CAYB 3OF6D 3KAAA 1HHGA 4IRJD 4Z7OE 1KIQB 4XB7A 3SY0A 5K9QG 4WY7L 3ESVF 5E9DD 4IDJL 1CGUA 1R3JA 5IEKA 2FNBA 1T6VN 4M7JH 2IQ9H 3W2DH 3L5XL 2EH8H 1YNTA 2FJGB 2AV7A 5FHBH 2WQ8A 1QFWL 2OCFD 4JO4L 4ORGA 1KGCD 4TSBH 3OV6A 1LNUA 4MNQE 4UILL 1EEZA 3FQNA 4RAVA 3RVUD 3SBWC 3FHQA 4MJIE 3DUSB 3PWLA 2LTQB 5D70L 3QDGA 2F9BT 5IP4A 5ICZA 2VZUA 2VLKE 2X4TB 1GZPB 5C0BB 1DQLH 1MSPA 1MREL 1A6WH 5T3XH 3MJ7A 3U2SA 2NY0D 2P7TB 3DVIA 3ZHLA 3V0VA 4X6CB 12E8L 5F9OH 1FNGB 4Y5YB 1IGYA 3F62A 4HUVA 3ZO0A 3PQYB 4UT9H 3VW3L 4GG6E 1WSST 3RFZC 3MRNB 3RGVB 3IJSA 1N8ZB 3EYFB 4ONFL 4LLVB 1NGPL 2BNQE 3SDDD 4JFPB 2X4UB 4XMLL 3OXSB 3GO1H 4M1CC 5SWZE 4EUPB 4P2YA 4FTVA 5EO1B 4LSUL 5D2LE 3PHOB 1RD6A 1YEJL 2HFGH 2RFXA 1E27A 2J8UF 4FFYL 4YE4H 1NC4D 1YY9C 5DEFB 1EA9C 1J1XH 2JJTA 3LCYA 4LPTA 5FF6A 5HHQB 2ARWA 4PJ9B 1RUML 2HMID 3JTSB 1F4AA 1DUZA 1K8IA 4P2OC 4U1MA 4TNWK 2NY3D 4OCSL 2BVYA 7FABL 3GHBL 5E2TL 5FYJE 3PP3H 1T2QH 2F58H 3TIEA 3FONA 2DICA 1WC7B 3RNQA 4PRBB 4FQJH 1HKFA 3ARGC 5FGRA 5JIKA 3U0TB 4Z7NE 1UEYA 4ZXBD 3T3PE 4DZ8A 3SJVE 1KF9B 4YPGB 3ARED 4IDLA 5E8NA 1UADC 5EOCH 3RRQA 3QWRA 1NBYA 3HPLA 4DGVL 5IFAL 3KS0J 3RWEA 5HPOA 4XPBL 1RZ7H 1UM6L 3T0ED 1FG2A 4RZCB 3WS6C 3MLWL 3HUJE 5I16B 5BV7H 3OF6A 3TBVB 1ZVSB 3QI9D 5DGRA 1G9MH 1D5XB 5E9DA 3K3QA 2AABL 2GTZB 2F5BH 4Z95H 2IEPA 3CH1A 3BGFB 4OF5A 3U9UB 1CD1A 4KVNL 1C5DB 3I75A 3ROOB 5C0CE 2UZXB 3JWOC 5TPWL 1MWAA 1F4HA 1J18A 2C7UA 5IW6B 2YWYA 4HT1H 5EIVA 3TT1H 3MO1A 4MA8L 1A9EA 1ETZB 2E27L 5I8EB 5HYEA 1RJLB 4RGNC 5FA3A 2QL1A 3JWDC 4JRYA 2AEPH 1G7PA 4HKXB 2M1KA 3UJIL 1C7TA 3V5HA 4K8RD 2Z35A 1TETL 4UV4L 5DMGD 2F5AL 1XF3B 2EE9A 4GAYA 4P4RB 3AU1B 5J57B 1IEHA 4MCYB 1I1AD 3VFVA 3WXVL 2P5EB 1KTDA 4HWZB 3SE8H 1LO2L 2Q1EA 5TE6H 4Y16D 3MLYL 3BKML 2FHCA 4XPHL 1PFCA 5D7IB 3VXMD 1T66C 3REVA 5JLZB 4XAKE 2ZSWB 2XKSA 4BM7A 4FG6C 1JFQH 4PJ5B 3ROLB 3GSRA 4NSKB 1H8OA 5BS0D 4O4YH 1TCMA 3DURA 3QRGL 1V3MA 3VXOB 3SDCA 5D1QB 4R4FL 5FM8A 1NLBL 2E5EA 4BZ2H 3SDDA 2P24A 3S3PA 4BH8B 5ECJE 2GW5A 2A6KA 2VSCA 4XCFL 4OSUH 2Z93B 2BK8A 4JZOB 1NQBA 5DJCA 1G1CA 4WI8A 2ITCB 3E8UH 3QB7C 5KW9H 3SE4A 3K1DA 1JIBA 4AM0A 3MV9D 5B4MC 1NC4A 3KYMA 4GRWE 3KPSE 1EFXA 4JB9H 1LWRA 1AY1H 4WUUB 4YFEA 4MNHA 4NJAL 1QRNE 4TSCL 2AJXH 4ODUA 1HI6A 4TVPL 5DEZA 4NRYA 4OT1L 1RZIB 1KN4H 3LMJH 3C5ZC 2A73A 3LQMA 3B5HA 4MX7B 5BW7C 2PTVA 1ZT7B 2BRRL 4E9LA 1BGXH 1JPGB 4HUWB 4TUKH 3RJDA 4TN9A 3K74B 3G5VA 4WV1C 5F93C 5A2LH 5KS9E 4ENEC 5DK2B 3DBXB 1NGQL 1G7LB 4J6RL 5IHZB 2FIKA 2Y6SC 4PJGF 3F5WA 5TQ0L 4HEME 2EKSA 2IGFL 5LGJB 4MXWL 2H45A 5I8CB 4YBHA 3TCXA 5L9DL 3ECBA 1PVHA 4TQEH 4N0YL 5FEBA 5IMMB 2XY2A 4KTYA 4AENB 1MI5E 4OV5A 2WANA 5KANG 4POZD 3EYQD 3OKEB 1NFKA 1GXEA 1W8NA 3O8XC 1FL3A 2UZIH 3KJ6L 3G9VA 1QZ1A 4N8VB 4H25A 5F1NB 1F45A 3GRWH 3PV7A 4NNYB 3X13A 1UXSA 2P46B 3FCTB 4U6YA 2O61A 5GSRB 3OXRB 3HI5H 5CJQL 4R97C 3KLSA 4O9HH 3CFBB 5JQ6L 4XT1C 4XAWL 4IOIA 1I1AA 5B22A 1U3JA 4K3HA 4Y16A 3RVWD 2V2TB 4HS8H 3VXMA 3QSKB 5I15L 3MRCB 3L5HA 1C5BL 1RZFL 3L5WA 4WI7A 3ARGB 4NC1E 1KB5L 3DSFH 3MV8A 4LSTL 4A6YH 1JHLL 2E8YA 3QG7L 4G3YH 1GGTA 1H3PH 3DMMC 4OGZA 3QIBD 1WAAA 2P8PA 3OJ2C 5J89A 1EVUA 2CK2A 5C0FA 5E8EB 2PCPB 5DHXB 1A3RH 5I1HH 3KLHC 5EUKA 3LN9A 4YXKH 4XHQA 1IGIL 3U4BH 2EO9A 1WWCA 2NY2C 5JIHA 5BVPH 2BXZA 4GG8A 2GITA 1KCRL 2J12B 2R1YB 1QOKA 2O5ZL 3T0XA 4GKSA 1QSFD 1V7ML 1G6VK 4TVPD 5TDNA 4F3FB 3N06B 4IRSD 3MV9A 4GMTH 5AWNH 2HTKC 3SGKA 5DVOA 3ZT5A 5FUOL 3GM0A 3V79C 1GC1H 3BWUC 3C8DA 3QXDA 5KVDL 1Q9KA 2CSPA 4C56B 3ARXA 3EYOA 1FZKB 1QSEB 2V5TA 4C59B 3BGMB 4JHWL 4OCXL 4RGNB 3NAAH 5IHUH 1YN6B 4W81A 3E3QC 4KGLA 3QDJA 4NPYA 5DGQA 4U1JB 3MRGA 3WEXA 2Q76B 4JHZA 2VLRD 4WI5A 4FFWC 2X44D 2ARJB 1INQA 5FYLE 3CIQA 1AHWC 4DUWA 3L3DA 3BH9A 4YQXL 4JFXA 5M95B 1A1OA 3O6FD 2DBJA 5KN5A 4JJ5A 1HYSD 3TIDB 3ARVA 3LVEA 2ICWB 4J7RA 5C92A 3CFCL 1NC2B 3IGAB 3DV6A 4BYHA 4NN6B 1WZLA 4MA3A 4HJ0C 4OCWL 2E7LA 3BZFA 2BP3A 4U1NA 5D7LE 1DBBL 1FRGL 4OZFG 4JAMA 4EI5B 3KYNA 2P8LA 4QLRA 5E5RB 1UVQB 1BZQK 4BFGA 1C7SA 3H6JA 2EIZB 1OTSD 3PWUB 5GGUB 2GIYA 3QQNA 4XP6H 1JMZA 1GGCH 3O81A 1QFWH 1MCOL 1J8HB 3TM6A 1Z2KA 4C54A 2FEDC 4LIQH 1I7RA 3MLTB 2Q6WA 3MOBH 2EYTA 2WUCH 5TDPA 1UFUA 1AQKH 5IJKC 4Y4FC 3BYYA 5FYJH 4KKLC 3HZMB 4ZUTA 3GSXB 5M94B 3FO2B 1MCEA 5DUML 1ZK9A 3SKMA 3MLSL 4OV6F 3BW9A 3HAEG 3QIBA 4JFYA 5FDWA 2WSKA 2VN7A 4WV1B 4YEFA 4GQ9L 4K8RH 4H1LA 4F2MB 3MUY1 3IDXL 2VNCA 3DSNA 3FB6A 1KPVA 2P5WB 2VO5A 1HHJB 1MJ7H 1B9ZA 4RAHA 3A0OA 4PGBB 4C55A 5J7CC 4TUOA 1N59B 3VJ6B 1QSFA 1X5YA 2YUZA 3DGGB 3VFNA 1IKFL 3S36L 4IHOB 1VEMA 4IRSA 3GMOA 4IBLT 2BC4B 1VFUA 3HRZA 5B21A 4PJEE 3O8XB 4PJ7E 2YZ8A 4Y8DC 3PL6C 4HK0B 1S7RA 2X7LA 4N0FA 5IG7B 3MA7B 4FFYH 4LLDA 1T2XA 4XP9H 4YC2C 2VQ1B 5T3ZE 4RWYH 4MDJB 4KV5F 3I6KA 4M7LL 5I1JL 3HE6D 1RUMH 4RNRB 2EEDA 1PSKL 4AY0A 5KJRL 1QFPA 2ATKB 4R97B 5HVGB 1QPPA 3UJTL 3BQUC 4P5KA 4N68A 4OCSH 2AJUL 3ZDYF 1EIBA 3GHBH 1OB1B 3HC0B 2Q20A 4ZO8A 1RU9L 1KCVH 2W0LA 1S7QB 4PJHE 2NY5L 4ZFZB 3BP4B 3GEWB 4Z7UB 4FS0A 4XPGH 3DMMB 4J3OC 2OJZH 4XCEB 4DGVH 2VSDA 4PS4L 2GY5A 1DE4B 3BPOC 2YPKB 3MLWH 4CADB 3RWGB 3WFCH 1FFNA 5FB8A 3BJLA 3SPVB 1FCCA 5E8DL 1BQHG 2NY2B 3GKWL 4L8BA 4ZTPL 5JZ7D 1ZVHA 4OD2B 4Y2DD 2AABH 2GJ6B 2X42A 1DZBA 3WHE0 3DRQA 1NSNL 2A6DA 2E9BA 1XCQB 3O41B 4KVNH 1OAQL 4OBRA 1QNZL 4L8CA 3GB7B 3GIZL 2R9HC 5E7FA 3ZSSA 1YC8A 5T5FH 4AT6B 1KB5A 4LHJB 4Q74A 4EKXA 4U1LA 1SBSH 2R29L 4JQIL 5DJYA 2VDPL 1ZHLA 4MJ2A 3UAJC 1K4DA 3B6SB 3SGJC 1A7OL 1HSBA 4JKLA 3BZDA 3K2UL 2NXYD 3L3GA 4MD0A 5JHLL 3GSUA 3ZTJG 4GKOA 4O51A 1GGIL 5C3TA 4FZEH 4HWEH 1MAKA 4KPHH 4YR6B 1T21B 1F02I 5DYOB 3DETC 5EU7E 1I9IL 3QUYB 4ESKA 2FO1A 4JO2L 5C0ND 2H8PA 3CUPB 1ZT1B 5ID0B 2BNRE 5HBBA 1NLBH 3DV4A 4QRPE 3ZYZA 4Z7VA 1T1ZB 3DXAE 4Z76A 1W0WB 4KJQC 3O3BB 4H88L 4F7CA 5GJTL 3ARDD 4KK8D 5ADOH 4YWGH 4TUJA 3L95B 4PJIF 4K94L 5HY9B 3IRZA 2PYEE 3AFLA 4FQIH 3E6FB 5KVFH 3VWJC 4ZUVB 3L1OH 3JZ7A 4FNLL 4S10A 2A9MH 1MJJB 3TJHD 1A6VH 1AE6L 1KPUA 3HE6A 1XGPA 3C5JA 3FQUB 4LASL 2KUTA 5DHYB 1EHLH 2MQ3A 1JK8B 5HD8D 1T1YB 5IB5A 1CLCA 1G0YR 1JUFA 1VGEH 4Y4FB 5HI5C 2NX5B 3MLVL 4MCZB 4M5ZL 2HLFC