3G65A

Crystal structure of the human rad9-rad1-hus1 dna damage checkpoint complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
254
Chain Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQYQALRCKILMKSFLSVFRSLAMVEKCCISLNGRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRSYHETAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHFDAPGRPAIFTIKDSLLDGHFVLATLSDTDSGTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the rad9-rad1-hus1 DNA damage checkpoint complex--implications for clamp loading and regulation.
pubmed doi rcsb
molecule keywords Cell cycle checkpoint control protein RAD9A
molecule tags Cell cycle
source organism Homo sapiens
total genus 48
structure length 254
sequence length 273
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04139 Rad9 Rad9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3g65A00
1RWZA 2IZOC 3FDSD 1SXJF 5IY4A 3GPNA 2AVTA 2ZVWA 3A1JB 3F1WA 4RJFA 2IX2C 3GPMA 3U5ZF 1YYPA 5E0TA 5B7OA 1PLRA 3I2MX 3G65A 2HIIA 1B8HA 2NTIA 4ZTDA 1U7BA 3FDSC 1VYJA 1VYMA 1UL1A 3U60F 1RXZA 2ZVMA 5IXAA 5CFKA 2IJXA 1RXMA 3AIZA 5H0TA 1IZ5A 1W60A 3G65C 4YHRA 5IWDA 2ZVVA 2NTIC 3AIXA 3IFVA 3LX2A 3P83A 1DMLA 3V61B 1CZDA 4TR6A 3AIZC 3HI8A 3GGRB 2HIKB 5A6DA 1UD9A 2Z0LA 3A1JA 1T6LA 1AXCA 2IZOB 3P87A 2OD8A 2IO4B 2ZVKA 2AWAA 2NTIB 2HIIC 3VKXA 1PLQA 3TBLA 2IX2B 3A2FB 5E0UA 1U76A 3A1JC 5E0VA 3WGWA 3V60B 1ISQA 5HACA 5AUJA 3P91A 3V62B 4CS5A 3G65B 2HIIB 4L6PA 1IZ4A 1GE8A 3GGRA 2HIKA 4HK1A 4D2GA 1B77A 2IO4A 3LX1A 3HSLX 5DA7A 3U61F 5DAIA 3K4XA 2IX2A 3AIXB 5JNED 2ZVLA 3GGRC 2HIKC 4L60A
chains in the Genus database with same CATH superfamily
1RWZA 2IZOC 3FDSD 1SXJF 5IY4A 3GPNA 2AVTA 2ZVWA 3A1JB 3F1WA 4RJFA 2IX2C 3GPMA 3U5ZF 1YYPA 5E0TA 5B7OA 1PLRA 3I2MX 3G65A 2HIIA 1B8HA 2NTIA 4ZTDA 1U7BA 3FDSC 1VYJA 1VYMA 1UL1A 3U60F 1RXZA 2ZVMA 5IXAA 5CFKA 2IJXA 1RXMA 3AIZA 5H0TA 1IZ5A 1W60A 3G65C 4YHRA 5IWDA 2ZVVA 2NTIC 3AIXA 3IFVA 3LX2A 3P83A 1DMLA 3V61B 1CZDA 4TR6A 3AIZC 3HI8A 3GGRB 2HIKB 5A6DA 1UD9A 2Z0LA 3A1JA 1T6LA 1AXCA 2IZOB 3P87A 2OD8A 2IO4B 2ZVKA 2AWAA 2NTIB 2HIIC 3VKXA 1PLQA 3TBLA 2IX2B 3A2FB 5E0UA 1U76A 3A1JC 5E0VA 3WGWA 3V60B 1ISQA 5HACA 5AUJA 3P91A 3V62B 4CS5A 3G65B 2HIIB 4L6PA 1IZ4A 1GE8A 3GGRA 2HIKA 4HK1A 4D2GA 1B77A 2IO4A 3LX1A 3HSLX 5DA7A 3U61F 5DAIA 3K4XA 2IX2A 3AIXB 5JNED 2ZVLA 3GGRC 2HIKC 4L60A
chains in the Genus database with same CATH topology
1RWZA 2IZOC 3FDSD 1SXJF 5IY4A 3GPNA 2AVTA 2ZVWA 3A1JB 3F1WA 4RJFA 2IX2C 3GPMA 3U5ZF 1YYPA 5E0TA 5B7OA 1PLRA 3I2MX 3G65A 2HIIA 1B8HA 2NTIA 4ZTDA 1U7BA 3FDSC 1VYJA 1VYMA 1UL1A 3U60F 1RXZA 2ZVMA 5IXAA 5CFKA 2IJXA 1RXMA 3AIZA 5H0TA 1IZ5A 1W60A 3G65C 4YHRA 5IWDA 2ZVVA 2NTIC 3AIXA 3IFVA 3LX2A 3P83A 1DMLA 3V61B 1CZDA 4TR6A 3AIZC 3HI8A 3GGRB 2HIKB 5A6DA 1UD9A 2Z0LA 3A1JA 1T6LA 1AXCA 2IZOB 3P87A 2OD8A 2IO4B 2ZVKA 2AWAA 2NTIB 2HIIC 3VKXA 1PLQA 3TBLA 2IX2B 3A2FB 5E0UA 1U76A 3A1JC 5E0VA 3WGWA 3V60B 1ISQA 5HACA 5AUJA 3P91A 3V62B 4CS5A 3G65B 2HIIB 4L6PA 1IZ4A 1GE8A 3GGRA 2HIKA 4HK1A 4D2GA 1B77A 2IO4A 3LX1A 3HSLX 5DA7A 3U61F 5DAIA 3K4XA 2IX2A 3AIXB 5JNED 2ZVLA 3GGRC 2HIKC 4L60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWZ A;  2IZO C;  3FDS D;  1SXJ F;  5IY4 A;  3GPN A;  2AVT A;  2ZVW A;  3A1J B;  3F1W A;  4RJF A;  2IX2 C;  3GPM A;  3U5Z F;  1YYP A;  5E0T A;  5B7O A;  1PLR A;  3I2M X;  3G65 A;  2HII A;  1B8H A;  2NTI A;  4ZTD A;  1U7B A;  3FDS C;  1VYJ A;  1VYM A;  1UL1 A;  3U60 F;  1RXZ A;  2ZVM A;  5IXA A;  5CFK A;  2IJX A;  1RXM A;  3AIZ A;  5H0T A;  1IZ5 A;  1W60 A;  3G65 C;  4YHR A;  5IWD A;  2ZVV A;  2NTI C;  3AIX A;  3IFV A;  3LX2 A;  3P83 A;  1DML A;  3V61 B;  1CZD A;  4TR6 A;  3AIZ C;  3HI8 A;  3GGR B;  2HIK B;  5A6D A;  1UD9 A;  2Z0L A;  3A1J A;  1T6L A;  1AXC A;  2IZO B;  3P87 A;  2OD8 A;  2IO4 B;  2ZVK A;  2AWA A;  2NTI B;  2HII C;  3VKX A;  1PLQ A;  3TBL A;  2IX2 B;  3A2F B;  5E0U A;  1U76 A;  3A1J C;  5E0V A;  3WGW A;  3V60 B;  1ISQ A;  5HAC A;  5AUJ A;  3P91 A;  3V62 B;  4CS5 A;  3G65 B;  2HII B;  4L6P A;  1IZ4 A;  1GE8 A;  3GGR A;  2HIK A;  4HK1 A;  4D2G A;  1B77 A;  2IO4 A;  3LX1 A;  3HSL X;  5DA7 A;  3U61 F;  5DAI A;  3K4X A;  2IX2 A;  3AIX B;  5JNE D;  2ZVL A;  3GGR C;  2HIK C;  4L60 A; 
#chains in the Genus database with same CATH topology
 1RWZ A;  2IZO C;  3FDS D;  1SXJ F;  5IY4 A;  3GPN A;  2AVT A;  2ZVW A;  3A1J B;  3F1W A;  4RJF A;  2IX2 C;  3GPM A;  3U5Z F;  1YYP A;  5E0T A;  5B7O A;  1PLR A;  3I2M X;  3G65 A;  2HII A;  1B8H A;  2NTI A;  4ZTD A;  1U7B A;  3FDS C;  1VYJ A;  1VYM A;  1UL1 A;  3U60 F;  1RXZ A;  2ZVM A;  5IXA A;  5CFK A;  2IJX A;  1RXM A;  3AIZ A;  5H0T A;  1IZ5 A;  1W60 A;  3G65 C;  4YHR A;  5IWD A;  2ZVV A;  2NTI C;  3AIX A;  3IFV A;  3LX2 A;  3P83 A;  1DML A;  3V61 B;  1CZD A;  4TR6 A;  3AIZ C;  3HI8 A;  3GGR B;  2HIK B;  5A6D A;  1UD9 A;  2Z0L A;  3A1J A;  1T6L A;  1AXC A;  2IZO B;  3P87 A;  2OD8 A;  2IO4 B;  2ZVK A;  2AWA A;  2NTI B;  2HII C;  3VKX A;  1PLQ A;  3TBL A;  2IX2 B;  3A2F B;  5E0U A;  1U76 A;  3A1J C;  5E0V A;  3WGW A;  3V60 B;  1ISQ A;  5HAC A;  5AUJ A;  3P91 A;  3V62 B;  4CS5 A;  3G65 B;  2HII B;  4L6P A;  1IZ4 A;  1GE8 A;  3GGR A;  2HIK A;  4HK1 A;  4D2G A;  1B77 A;  2IO4 A;  3LX1 A;  3HSL X;  5DA7 A;  3U61 F;  5DAI A;  3K4X A;  2IX2 A;  3AIX B;  5JNE D;  2ZVL A;  3GGR C;  2HIK C;  4L60 A; 
#chains in the Genus database with same CATH homology
 1RWZ A;  2IZO C;  3FDS D;  1SXJ F;  5IY4 A;  3GPN A;  2AVT A;  2ZVW A;  3A1J B;  3F1W A;  4RJF A;  2IX2 C;  3GPM A;  3U5Z F;  1YYP A;  5E0T A;  5B7O A;  1PLR A;  3I2M X;  3G65 A;  2HII A;  1B8H A;  2NTI A;  4ZTD A;  1U7B A;  3FDS C;  1VYJ A;  1VYM A;  1UL1 A;  3U60 F;  1RXZ A;  2ZVM A;  5IXA A;  5CFK A;  2IJX A;  1RXM A;  3AIZ A;  5H0T A;  1IZ5 A;  1W60 A;  3G65 C;  4YHR A;  5IWD A;  2ZVV A;  2NTI C;  3AIX A;  3IFV A;  3LX2 A;  3P83 A;  1DML A;  3V61 B;  1CZD A;  4TR6 A;  3AIZ C;  3HI8 A;  3GGR B;  2HIK B;  5A6D A;  1UD9 A;  2Z0L A;  3A1J A;  1T6L A;  1AXC A;  2IZO B;  3P87 A;  2OD8 A;  2IO4 B;  2ZVK A;  2AWA A;  2NTI B;  2HII C;  3VKX A;  1PLQ A;  3TBL A;  2IX2 B;  3A2F B;  5E0U A;  1U76 A;  3A1J C;  5E0V A;  3WGW A;  3V60 B;  1ISQ A;  5HAC A;  5AUJ A;  3P91 A;  3V62 B;  4CS5 A;  3G65 B;  2HII B;  4L6P A;  1IZ4 A;  1GE8 A;  3GGR A;  2HIK A;  4HK1 A;  4D2G A;  1B77 A;  2IO4 A;  3LX1 A;  3HSL X;  5DA7 A;  3U61 F;  5DAI A;  3K4X A;  2IX2 A;  3AIX B;  5JNE D;  2ZVL A;  3GGR C;  2HIK C;  4L60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...