3G65C

Crystal structure of the human rad9-rad1-hus1 dna damage checkpoint complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
279
structure length
258
Chain Sequence
MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDGGVSMWCELEQENFFNEFQMEGENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVCVTTHFKDLGNPPMAEVHIDIRKLLQFLAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the rad9-rad1-hus1 DNA damage checkpoint complex--implications for clamp loading and regulation.
pubmed doi rcsb
molecule keywords Cell cycle checkpoint control protein RAD9A
molecule tags Cell cycle
source organism Homo sapiens
total genus 53
structure length 258
sequence length 279
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04005 Hus1 Hus1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3g65C00
2Z0LA 3P91A 4L6PA 4TR6A 2ZVMA 3A1JC 3LX2A 3AIXA 1AXCA 5E0TA 4ZTDA 1DMLA 1IZ5A 3G65B 3P87A 2HIKC 3FDSC 3A1JA 3LX1A 3AIZC 2ZVLA 3K4XA 1CZDA 3U5ZF 1UL1A 2HIKA 2IZOC 1ISQA 3AIZA 5HACA 3V60B 4YHRA 1RXMA 1YYPA 5IY4A 4L60A 3TBLA 2NTIC 5AUJA 1PLQA 2IO4A 3V62B 5E0UA 5H0TA 1RXZA 2IX2B 3GGRB 1RWZA 5DA7A 2HIIC 1U76A 2NTIA 2OD8A 3FDSD 5IXAA 1B77A 3F1WA 3AIXB 2AWAA 5B7OA 3WGWA 2HIIA 1T6LA 3G65C 3HI8A 3A1JB 2IX2C 1IZ4A 5JNED 3V61B 1B8HA 1PLRA 3U60F 1VYMA 5IWDA 1GE8A 3G65A 2HIKB 5A6DA 1UD9A 2ZVWA 5E0VA 3GPMA 4D2GA 1W60A 1SXJF 4HK1A 3I2MX 1VYJA 3IFVA 3A2FB 3U61F 4CS5A 2IZOB 1U7BA 3P83A 2IO4B 2IJXA 2ZVVA 4RJFA 3GGRC 5DAIA 2NTIB 3GPNA 2ZVKA 3HSLX 2IX2A 3VKXA 3GGRA 5CFKA 2HIIB 2AVTA
chains in the Genus database with same CATH superfamily
2Z0LA 3P91A 4L6PA 4TR6A 2ZVMA 3A1JC 3LX2A 3AIXA 1AXCA 5E0TA 4ZTDA 1DMLA 1IZ5A 3G65B 3P87A 2HIKC 3FDSC 3A1JA 3LX1A 3AIZC 2ZVLA 3K4XA 1CZDA 3U5ZF 1UL1A 2HIKA 2IZOC 1ISQA 3AIZA 5HACA 3V60B 4YHRA 1RXMA 1YYPA 5IY4A 4L60A 3TBLA 2NTIC 5AUJA 1PLQA 2IO4A 3V62B 5E0UA 5H0TA 1RXZA 2IX2B 3GGRB 1RWZA 5DA7A 2HIIC 1U76A 2NTIA 2OD8A 3FDSD 5IXAA 1B77A 3F1WA 3AIXB 2AWAA 5B7OA 3WGWA 2HIIA 1T6LA 3G65C 3HI8A 3A1JB 2IX2C 1IZ4A 5JNED 3V61B 1B8HA 1PLRA 3U60F 1VYMA 5IWDA 1GE8A 3G65A 2HIKB 5A6DA 1UD9A 2ZVWA 5E0VA 3GPMA 4D2GA 1W60A 1SXJF 4HK1A 3I2MX 1VYJA 3IFVA 3A2FB 3U61F 4CS5A 2IZOB 1U7BA 3P83A 2IO4B 2IJXA 2ZVVA 4RJFA 3GGRC 5DAIA 2NTIB 3GPNA 2ZVKA 3HSLX 2IX2A 3VKXA 3GGRA 5CFKA 2HIIB 2AVTA
chains in the Genus database with same CATH topology
2Z0LA 3P91A 4L6PA 4TR6A 2ZVMA 3A1JC 3LX2A 3AIXA 1AXCA 5E0TA 4ZTDA 1DMLA 1IZ5A 3G65B 3P87A 2HIKC 3FDSC 3A1JA 3LX1A 3AIZC 2ZVLA 3K4XA 1CZDA 3U5ZF 1UL1A 2HIKA 2IZOC 1ISQA 3AIZA 5HACA 3V60B 4YHRA 1RXMA 1YYPA 5IY4A 4L60A 3TBLA 2NTIC 5AUJA 1PLQA 2IO4A 3V62B 5E0UA 5H0TA 1RXZA 2IX2B 3GGRB 1RWZA 5DA7A 2HIIC 1U76A 2NTIA 2OD8A 3FDSD 5IXAA 1B77A 3F1WA 3AIXB 2AWAA 5B7OA 3WGWA 2HIIA 1T6LA 3G65C 3HI8A 3A1JB 2IX2C 1IZ4A 5JNED 3V61B 1B8HA 1PLRA 3U60F 1VYMA 5IWDA 1GE8A 3G65A 2HIKB 5A6DA 1UD9A 2ZVWA 5E0VA 3GPMA 4D2GA 1W60A 1SXJF 4HK1A 3I2MX 1VYJA 3IFVA 3A2FB 3U61F 4CS5A 2IZOB 1U7BA 3P83A 2IO4B 2IJXA 2ZVVA 4RJFA 3GGRC 5DAIA 2NTIB 3GPNA 2ZVKA 3HSLX 2IX2A 3VKXA 3GGRA 5CFKA 2HIIB 2AVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0L A;  3P91 A;  4L6P A;  4TR6 A;  2ZVM A;  3A1J C;  3LX2 A;  3AIX A;  1AXC A;  5E0T A;  4ZTD A;  1DML A;  1IZ5 A;  3G65 B;  3P87 A;  2HIK C;  3FDS C;  3A1J A;  3LX1 A;  3AIZ C;  2ZVL A;  3K4X A;  1CZD A;  3U5Z F;  1UL1 A;  2HIK A;  2IZO C;  1ISQ A;  3AIZ A;  5HAC A;  3V60 B;  4YHR A;  1RXM A;  1YYP A;  5IY4 A;  4L60 A;  3TBL A;  2NTI C;  5AUJ A;  1PLQ A;  2IO4 A;  3V62 B;  5E0U A;  5H0T A;  1RXZ A;  2IX2 B;  3GGR B;  1RWZ A;  5DA7 A;  2HII C;  1U76 A;  2NTI A;  2OD8 A;  3FDS D;  5IXA A;  1B77 A;  3F1W A;  3AIX B;  2AWA A;  5B7O A;  3WGW A;  2HII A;  1T6L A;  3G65 C;  3HI8 A;  3A1J B;  2IX2 C;  1IZ4 A;  5JNE D;  3V61 B;  1B8H A;  1PLR A;  3U60 F;  1VYM A;  5IWD A;  1GE8 A;  3G65 A;  2HIK B;  5A6D A;  1UD9 A;  2ZVW A;  5E0V A;  3GPM A;  4D2G A;  1W60 A;  1SXJ F;  4HK1 A;  3I2M X;  1VYJ A;  3IFV A;  3A2F B;  3U61 F;  4CS5 A;  2IZO B;  1U7B A;  3P83 A;  2IO4 B;  2IJX A;  2ZVV A;  4RJF A;  3GGR C;  5DAI A;  2NTI B;  3GPN A;  2ZVK A;  3HSL X;  2IX2 A;  3VKX A;  3GGR A;  5CFK A;  2HII B;  2AVT A; 
#chains in the Genus database with same CATH topology
 2Z0L A;  3P91 A;  4L6P A;  4TR6 A;  2ZVM A;  3A1J C;  3LX2 A;  3AIX A;  1AXC A;  5E0T A;  4ZTD A;  1DML A;  1IZ5 A;  3G65 B;  3P87 A;  2HIK C;  3FDS C;  3A1J A;  3LX1 A;  3AIZ C;  2ZVL A;  3K4X A;  1CZD A;  3U5Z F;  1UL1 A;  2HIK A;  2IZO C;  1ISQ A;  3AIZ A;  5HAC A;  3V60 B;  4YHR A;  1RXM A;  1YYP A;  5IY4 A;  4L60 A;  3TBL A;  2NTI C;  5AUJ A;  1PLQ A;  2IO4 A;  3V62 B;  5E0U A;  5H0T A;  1RXZ A;  2IX2 B;  3GGR B;  1RWZ A;  5DA7 A;  2HII C;  1U76 A;  2NTI A;  2OD8 A;  3FDS D;  5IXA A;  1B77 A;  3F1W A;  3AIX B;  2AWA A;  5B7O A;  3WGW A;  2HII A;  1T6L A;  3G65 C;  3HI8 A;  3A1J B;  2IX2 C;  1IZ4 A;  5JNE D;  3V61 B;  1B8H A;  1PLR A;  3U60 F;  1VYM A;  5IWD A;  1GE8 A;  3G65 A;  2HIK B;  5A6D A;  1UD9 A;  2ZVW A;  5E0V A;  3GPM A;  4D2G A;  1W60 A;  1SXJ F;  4HK1 A;  3I2M X;  1VYJ A;  3IFV A;  3A2F B;  3U61 F;  4CS5 A;  2IZO B;  1U7B A;  3P83 A;  2IO4 B;  2IJX A;  2ZVV A;  4RJF A;  3GGR C;  5DAI A;  2NTI B;  3GPN A;  2ZVK A;  3HSL X;  2IX2 A;  3VKX A;  3GGR A;  5CFK A;  2HII B;  2AVT A; 
#chains in the Genus database with same CATH homology
 2Z0L A;  3P91 A;  4L6P A;  4TR6 A;  2ZVM A;  3A1J C;  3LX2 A;  3AIX A;  1AXC A;  5E0T A;  4ZTD A;  1DML A;  1IZ5 A;  3G65 B;  3P87 A;  2HIK C;  3FDS C;  3A1J A;  3LX1 A;  3AIZ C;  2ZVL A;  3K4X A;  1CZD A;  3U5Z F;  1UL1 A;  2HIK A;  2IZO C;  1ISQ A;  3AIZ A;  5HAC A;  3V60 B;  4YHR A;  1RXM A;  1YYP A;  5IY4 A;  4L60 A;  3TBL A;  2NTI C;  5AUJ A;  1PLQ A;  2IO4 A;  3V62 B;  5E0U A;  5H0T A;  1RXZ A;  2IX2 B;  3GGR B;  1RWZ A;  5DA7 A;  2HII C;  1U76 A;  2NTI A;  2OD8 A;  3FDS D;  5IXA A;  1B77 A;  3F1W A;  3AIX B;  2AWA A;  5B7O A;  3WGW A;  2HII A;  1T6L A;  3G65 C;  3HI8 A;  3A1J B;  2IX2 C;  1IZ4 A;  5JNE D;  3V61 B;  1B8H A;  1PLR A;  3U60 F;  1VYM A;  5IWD A;  1GE8 A;  3G65 A;  2HIK B;  5A6D A;  1UD9 A;  2ZVW A;  5E0V A;  3GPM A;  4D2G A;  1W60 A;  1SXJ F;  4HK1 A;  3I2M X;  1VYJ A;  3IFV A;  3A2F B;  3U61 F;  4CS5 A;  2IZO B;  1U7B A;  3P83 A;  2IO4 B;  2IJX A;  2ZVV A;  4RJF A;  3GGR C;  5DAI A;  2NTI B;  3GPN A;  2ZVK A;  3HSL X;  2IX2 A;  3VKX A;  3GGR A;  5CFK A;  2HII B;  2AVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...