3G6EH

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
160
Chain Sequence
b'KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 3g6eH00
2ZJQJ 3CCLH 1VQNH 1M1KJ 1Q86J 1YJ9H 1VQPH 1VQ4H 5GAHN 2QA4H 5AN9F 1JJ2H 1S72H 4U67J 3PIPJ 1QVFH 3OW2H 1VQ9H 5GAEN 4WFNJ 3CF5J 1YI2H 1W2BH 3CD6H 3CCSH 3CCMH 3CXCH 1K73J 2ZJRJ 4WCEJ 3CCEH 3G6EH 4WFBJ 1Y69K 3CMEH 1VQLH 3CC4H 1VQ5H 5JVHJ 1K8AJ 2ZJPJ 4UY8M 2OTJH 3CCQH 1VQKH 3PIOJ 1Q82J 4IOCJ 1K9MJ 4WF9J 1VQOH 5DM7J 5DM6J 1YIJH 5GAGN 1YJNH 1KD1J 1VQMH 3G4SH 4IO9J 1VQ8H 3J7ZM 1VQ6H 3I55H 2PA2A 3G71H 2QEXH 5GADN 1KC8J 1YJWH 1M90J 1WKIA 4WFAJ 1YHQH 1YITH 2OTLH 3CC7H 5MLCO 3CCRH 3CPWH 5JVGJ 3CCUH 1Q7YJ 3CCJH 4IOAJ 3DLLJ 1KQSH 3CMAH 5HL7J 3CC2H 1VQ7H 3CCVH 1Q81J 1N8RJ 3I56H 1NJIJ 5H1SO 1QVGH
chains in the Genus database with same CATH superfamily
1QPOA 1ZXIB 4I9AA 3NRZC 5HULA 2B7QA 2ZJQJ 3CCLH 1N5WB 4USAA 1FM0E 4GA4A 4US9A 4LHMA 1VQNH 1M1KJ 1VLBA 1O4UA 1UOUA 1Q86J 1FIQC 1NVIE 1SIJA 1YJ9H 2JBMA 1VQPH 1VQ4H 5GAHN 1YTEA 2QA4H 3H5QA 4KWWA 3WO1A 5AN9F 3TQVA 1JJ2H 1S72H 3ETRC 3SR6C 4U67J 1BRWA 3PIPJ 1QVFH 1WYGA 4KWVA 3OW2H 3B9JC 1VQ9H 4GA6A 5GAEN 1AZYA 1JROB 4GA5A 4WFNJ 3AN1A 1SB3A 4AP8A 3AM9A 3CF5J 1YI2H 1W2BH 1QPQA 1FMAE 1JRPB 3CD6H 1N60B 5AYYA 1NVJA 5EY3A 3CCSH 3C2RA 3CCMH 3CXCH 3GNNA 1K73J 2ZJRJ 3NVZC 5HUOA 4WCEJ 3CCEH 3G6EH 4WFBJ 1Y69K 1FFVB 3VMMA 4C7ZA 3NVWC 3CMEH 1VQLH 3CC4H 4ZOHA 2W3RB 3L0GA 2WK6A 3C2VA 1VQ5H 1FFUB 3WO0A 1V97A 1OTPA 5JVHJ 1X1OA 1K8AJ 3FAHA 2ZJPJ 4UY8M 2OTJH 1VDVA 5AYZA 3CCQH 5AYXA 4C7YA 1VQKH 2W3SB 3PIOJ 2W54B 1Q82J 4IOCJ 5EP8A 2WK5A 1YTDA 1N5XA 3RPFA 3L4PA 4WF9J 1K9MJ 1VQOH 5DM7J 3NVYC 5DM6J 5GAGN 1YIJH 1YJNH 1KD1J 3NVVC 3C2FA 1VQMH 1YTKA 3G4SH 1QAPA 4IO9J 1VQ8H 3J7ZM 2DSJA 2B7NA 1VQ6H 1FO4A 3I55H 4YEKA 2PA2A 3G71H 2QEXH 1RM6A 1N62B 4YYYA 2I14A 1QPRA 2WP4A 5GADN 1KC8J 2TPTA 4EADA 1YJWH 1M90J 1WKIA 4WFAJ 1YHQH 1YITH 2QIEA 2OTLH 2OMDA 3NS1C 5MLCO 2W55B 3BIIE 3CCRH 3CC7H 3CPWH 5JVGJ 3CCUH 2J0FA 4EAFA 1Q7YJ 3PAJA 3CCJH 4IOAJ 3DLLJ 3WNZA 4XR5A 3AMZA 1KQSH 1N63B 3CMAH 5HL7J 2B7PA 3CC2H 1VQ7H 5HUPA 3CCVH 1Q81J 2Q5WE 2E3TA 3C2OA 2I1OA 4C80A 1N8RJ 3FC4A 3I56H 3C2EA 1N61B 5MPOC 1DGJA 4US8A 1NJIJ 1QPNA 3EUB4 5H1SO 1QVGH 4X46A
chains in the Genus database with same CATH topology
2ZJQJ 3CCLH 1VQNH 1M1KJ 1Q86J 1YJ9H 1VQPH 1VQ4H 5GAHN 2QA4H 5AN9F 1JJ2H 1S72H 4U67J 3PIPJ 1QVFH 3OW2H 1VQ9H 5GAEN 4WFNJ 3CF5J 1YI2H 1W2BH 3CD6H 3CCSH 3CCMH 3CXCH 1K73J 2ZJRJ 4WCEJ 3CCEH 3G6EH 4WFBJ 1Y69K 3CMEH 1VQLH 3CC4H 1VQ5H 5JVHJ 1K8AJ 2ZJPJ 4UY8M 2OTJH 3CCQH 1VQKH 3PIOJ 1Q82J 4IOCJ 1K9MJ 4WF9J 1VQOH 5DM7J 5DM6J 1YIJH 5GAGN 1YJNH 1KD1J 1VQMH 3G4SH 4IO9J 1VQ8H 3J7ZM 1VQ6H 3I55H 2PA2A 3G71H 2QEXH 5GADN 1KC8J 1YJWH 1M90J 1WKIA 4WFAJ 1YHQH 1YITH 2OTLH 3CC7H 5MLCO 3CCRH 3CPWH 5JVGJ 3CCUH 1Q7YJ 3CCJH 4IOAJ 3DLLJ 1KQSH 3CMAH 5HL7J 3CC2H 1VQ7H 3CCVH 1Q81J 1N8RJ 3I56H 1NJIJ 5H1SO 1QVGH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJQ J;  3CCL H;  1VQN H;  1M1K J;  1Q86 J;  1YJ9 H;  1VQP H;  1VQ4 H;  5GAH N;  2QA4 H;  5AN9 F;  1JJ2 H;  1S72 H;  4U67 J;  3PIP J;  1QVF H;  3OW2 H;  1VQ9 H;  5GAE N;  4WFN J;  3CF5 J;  1YI2 H;  1W2B H;  3CD6 H;  3CCS H;  3CCM H;  3CXC H;  1K73 J;  2ZJR J;  4WCE J;  3CCE H;  3G6E H;  4WFB J;  1Y69 K;  3CME H;  1VQL H;  3CC4 H;  1VQ5 H;  5JVH J;  1K8A J;  2ZJP J;  4UY8 M;  2OTJ H;  3CCQ H;  1VQK H;  3PIO J;  1Q82 J;  4IOC J;  1K9M J;  4WF9 J;  1VQO H;  5DM7 J;  5DM6 J;  1YIJ H;  5GAG N;  1YJN H;  1KD1 J;  1VQM H;  3G4S H;  4IO9 J;  1VQ8 H;  3J7Z M;  1VQ6 H;  3I55 H;  2PA2 A;  3G71 H;  2QEX H;  5GAD N;  1KC8 J;  1YJW H;  1M90 J;  1WKI A;  4WFA J;  1YHQ H;  1YIT H;  2OTL H;  3CC7 H;  5MLC O;  3CCR H;  3CPW H;  5JVG J;  3CCU H;  1Q7Y J;  3CCJ H;  4IOA J;  3DLL J;  1KQS H;  3CMA H;  5HL7 J;  3CC2 H;  1VQ7 H;  3CCV H;  1Q81 J;  1N8R J;  3I56 H;  1NJI J;  5H1S O;  1QVG H; 
#chains in the Genus database with same CATH topology
 1QPO A;  1ZXI B;  4I9A A;  3NRZ C;  5HUL A;  2B7Q A;  2ZJQ J;  3CCL H;  1N5W B;  4USA A;  1FM0 E;  4GA4 A;  4US9 A;  4LHM A;  1VQN H;  1M1K J;  1VLB A;  1O4U A;  1UOU A;  1Q86 J;  1FIQ C;  1NVI E;  1SIJ A;  1YJ9 H;  2JBM A;  1VQP H;  1VQ4 H;  5GAH N;  1YTE A;  2QA4 H;  3H5Q A;  4KWW A;  3WO1 A;  5AN9 F;  3TQV A;  1JJ2 H;  1S72 H;  3ETR C;  3SR6 C;  4U67 J;  1BRW A;  3PIP J;  1QVF H;  1WYG A;  4KWV A;  3OW2 H;  3B9J C;  1VQ9 H;  4GA6 A;  5GAE N;  1AZY A;  1JRO B;  4GA5 A;  4WFN J;  3AN1 A;  1SB3 A;  4AP8 A;  3AM9 A;  3CF5 J;  1YI2 H;  1W2B H;  1QPQ A;  1FMA E;  1JRP B;  3CD6 H;  1N60 B;  5AYY A;  1NVJ A;  5EY3 A;  3CCS H;  3C2R A;  3CCM H;  3CXC H;  3GNN A;  1K73 J;  2ZJR J;  3NVZ C;  5HUO A;  4WCE J;  3CCE H;  3G6E H;  4WFB J;  1Y69 K;  1FFV B;  3VMM A;  4C7Z A;  3NVW C;  3CME H;  1VQL H;  3CC4 H;  4ZOH A;  2W3R B;  3L0G A;  2WK6 A;  3C2V A;  1VQ5 H;  1FFU B;  3WO0 A;  1V97 A;  1OTP A;  5JVH J;  1X1O A;  1K8A J;  3FAH A;  2ZJP J;  4UY8 M;  2OTJ H;  1VDV A;  5AYZ A;  3CCQ H;  5AYX A;  4C7Y A;  1VQK H;  2W3S B;  3PIO J;  2W54 B;  1Q82 J;  4IOC J;  5EP8 A;  2WK5 A;  1YTD A;  1N5X A;  3RPF A;  3L4P A;  4WF9 J;  1K9M J;  1VQO H;  5DM7 J;  3NVY C;  5DM6 J;  5GAG N;  1YIJ H;  1YJN H;  1KD1 J;  3NVV C;  3C2F A;  1VQM H;  1YTK A;  3G4S H;  1QAP A;  4IO9 J;  1VQ8 H;  3J7Z M;  2DSJ A;  2B7N A;  1VQ6 H;  1FO4 A;  3I55 H;  4YEK A;  2PA2 A;  3G71 H;  2QEX H;  1RM6 A;  1N62 B;  4YYY A;  2I14 A;  1QPR A;  2WP4 A;  5GAD N;  1KC8 J;  2TPT A;  4EAD A;  1YJW H;  1M90 J;  1WKI A;  4WFA J;  1YHQ H;  1YIT H;  2QIE A;  2OTL H;  2OMD A;  3NS1 C;  5MLC O;  2W55 B;  3BII E;  3CCR H;  3CC7 H;  3CPW H;  5JVG J;  3CCU H;  2J0F A;  4EAF A;  1Q7Y J;  3PAJ A;  3CCJ H;  4IOA J;  3DLL J;  3WNZ A;  4XR5 A;  3AMZ A;  1KQS H;  1N63 B;  3CMA H;  5HL7 J;  2B7P A;  3CC2 H;  1VQ7 H;  5HUP A;  3CCV H;  1Q81 J;  2Q5W E;  2E3T A;  3C2O A;  2I1O A;  4C80 A;  1N8R J;  3FC4 A;  3I56 H;  3C2E A;  1N61 B;  5MPO C;  1DGJ A;  4US8 A;  1NJI J;  1QPN A;  3EUB 4;  5H1S O;  1QVG H;  4X46 A; 
#chains in the Genus database with same CATH homology
 2ZJQ J;  3CCL H;  1VQN H;  1M1K J;  1Q86 J;  1YJ9 H;  1VQP H;  1VQ4 H;  5GAH N;  2QA4 H;  5AN9 F;  1JJ2 H;  1S72 H;  4U67 J;  3PIP J;  1QVF H;  3OW2 H;  1VQ9 H;  5GAE N;  4WFN J;  3CF5 J;  1YI2 H;  1W2B H;  3CD6 H;  3CCS H;  3CCM H;  3CXC H;  1K73 J;  2ZJR J;  4WCE J;  3CCE H;  3G6E H;  4WFB J;  1Y69 K;  3CME H;  1VQL H;  3CC4 H;  1VQ5 H;  5JVH J;  1K8A J;  2ZJP J;  4UY8 M;  2OTJ H;  3CCQ H;  1VQK H;  3PIO J;  1Q82 J;  4IOC J;  1K9M J;  4WF9 J;  1VQO H;  5DM7 J;  5DM6 J;  1YIJ H;  5GAG N;  1YJN H;  1KD1 J;  1VQM H;  3G4S H;  4IO9 J;  1VQ8 H;  3J7Z M;  1VQ6 H;  3I55 H;  2PA2 A;  3G71 H;  2QEX H;  5GAD N;  1KC8 J;  1YJW H;  1M90 J;  1WKI A;  4WFA J;  1YHQ H;  1YIT H;  2OTL H;  3CC7 H;  5MLC O;  3CCR H;  3CPW H;  5JVG J;  3CCU H;  1Q7Y J;  3CCJ H;  4IOA J;  3DLL J;  1KQS H;  3CMA H;  5HL7 J;  3CC2 H;  1VQ7 H;  3CCV H;  1Q81 J;  1N8R J;  3I56 H;  1NJI J;  5H1S O;  1QVG H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...