3G6EQ

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g6eQ00
1VQ4Q 1Q82R 1QVFP 1VQ5Q 1YITQ 1S72Q 3CCMQ 3CCSQ 2QEXQ 1YHQQ 1N8RR 1K9MR 1YIJQ 1K73R 3CCVQ 1VQKQ 3CC7Q 3CD6Q 1YI2Q 3CCEQ 2OTJQ 3CCRQ 2QA4Q 3OW2P 3CC4Q 3CC2Q 1VQMQ 3CXCP 1QVGP 1VQ8Q 1VQLQ 1KQSP 3CCLQ 1VQ6Q 1VQNQ 1NJIR 3I56Q 1VQ7Q 1VQPQ 1K8AR 3CCJQ 3G4SQ 1YJWQ 1JJ2P 3G71Q 3CPWP 3I55Q 1W2BP 1Q81R 1KD1R 1VQ9Q 1Q86R 3CCQQ 3G6EQ 3CMAQ 1YJNQ 1YJ9Q 3CCUQ 1VQOQ 1M90R 3CMEQ 2OTLQ 1KC8R 1M1KR 1Q7YR
chains in the Genus database with same CATH superfamily
1VQLT 4HKEA 3I56T 4JJBA 2RHIA 1WQ7A 1TUDA 2MK5A 5IH2A 3JCMb 1BBZA 4PJOG 2V8JA 4A4HA 2CP0A 2KYMA 2LZ6B 2KXCA 4QQDA 1NG2A 3MJXA 2DIQA 5GAOn 2WSEE 2R5MA 3QBYA 2K5LA 4RTZA 2KY9A 4PJOB 4QKUA 4F7UF 1LOJA 5IHIA 2HBPA 1OULA 2F2XA 3EFOA 3L2VA 1BCMA 1UGRB 1ZSZC 5GAN7 3LWIA 2KR3A 5GANg 1FX7A 3TREA 1TTHB 1BU1A 1AT1B 3OQ5A 1R77A 5HCKA 1WJQA 4M7DF 4UC4A 1G3WA 4Z89A 2K3BA 3JRZA 4XTVA 2YXYA 2E65A 5FU7C 4KH0B 1HXDA 3EGDA 2K79A 2RHYA 4E7SA 2LNVA 2X4YA 1UGVA 2X3WD 3QYHB 2WACA 4M75F 4KRTA 4RTWA 3VS0A 4B6MA 3LWHA 3UATA 1VYTA 2COWA 1YI2Q 3JCMf 1EFNA 1E7OA 4J9HA 5HK3A 2GCXA 4BI3A 1PNJA 3JCMd 5GAMg 2DXTA 3PFSA 4DBHA 3G71Q 2EKOA 4JRKA 1WDXA 1BI2A 1VUBA 3UA6A 5KE3A 2RI3A 1ZSGA 4EIKA 3LH0A 5GAN4 1X6BA 2CP3A 1ZSZB 2KT8A 1VQ4A 1GCQA 1QVFA 1E6GA 2P0KA 2CP7A 1K73U 2PVOB 2YUNA 3QIIA 1U1TA 4KUDK 3VYHB 2W10A 1SRLA 3ZBDA 1H92A 1X43A 3EG9A 9ATCB 2OJ2A 2E6NA 3A8HB 3M0UA 3CCJA 3A5ZB 1W2BA 1YI2T 5FU7B 2E3IA 2QAZA 3H9NA 4PFZA 1K73C 1IREB 5KYYA 2DEQA 4OMQA 2D1XA 4NOYA 2V8KA 1PM3A 2D8HA 4M7DD 3CXCA 1HJDA 4QT7A 2FRYA 5J3BA 1WJRA 5CAIA 1YJWQ 2QEXT 1U06A 3OS1A 2DEUA 1K0XA 2DAQA 4M78C 3OYJA 5KYUB 1GRIA 2XI9A 4MZTA 2LCSA 4BB7A 2EAYA 1YIJA 2YRCA 2COYA 2PUKB 1VQKA 1FMWA 3GBQA 3OYDA 2HKQB 3JB9H 1RLQC 3E9GA 5LJ5j 2QQRA 2DKGA 5CK9A 2ZPFB 3VS5A 2GF7A 2AHJB 1FMVA 2DK3A 2FZCB 3G7ZA 2RQUA 3GP8A 2NLUA 1WHHA 1C1AA 2B86A 2M0YA 3E19A 2MCNA 1YJWT 1BI1A 2EYWA 3CC2Q 4JDSA 1Y57A 1KG1A 3HSBA 2LRQA 2JS2A 2RJCA 2DLPA 4M78G 1AVZC 3RDVA 2AK5A 4Z88A 2D8JA 4Y91A 1JRIA 1BIAA 2DL7A 1WHGA 2K6DA 1KC8R 4DOVA 2DL3A 3RKXA 4C8QG 1JQQA 1YCYA 2RB6A 4DEXA 1M9SA 5GMKl 4M78B 3BDUA 2CP6A 3P8DA 3RNJA 1QLYA 2DD5A 1QP2A 4C92C 5KYNA 1UGSB 1VQ6Q 1HYOA 1WZOA 2X3XD 5LJ5h 2QI2A 4J9CA 1JJ2S 2KYBA 2J06A 3CMEQ 3PGGA 3CC2T 3OMCA 3VUBA 4FYVB 2EBPA 1N27A 3AT1B 3EHRA 5I2MA 3OYKA 2Y90A 2O4XA 5LJ3j 3CCRQ 2P84A 2FPFA 3NPFA 2DRKA 4J6YA 2CZ1B 3EH1A 4Z02A 3OYBA 3QWYA 4PJOF 2NUTB 2X4WA 1UGPB 5L8RE 5LL6S 4Z8AA 3SHWA 1VQ5T 4KGXB 1NE8A 1T3SA 4E7ZA 2LNHB 5GMKe 2CSQA 2JOYA 1VQ6T 3VV0A 8AT1B 4C92G 4JZ3A 1D09B 1N6AA 2BIVA 2HQHA 6AT1B 1WI7A 3CMET 2QQBA 3HRSA 4XTWA 2F5TX 4D6WA 4KT0E 1WPYA 2L0AA 4C92B 2E70A 2LX9A 1UHFA 2DPPB 3MO8A 3H6ZA 1ABOA 1U3OA 3CCMQ 1S72Q 4MZMA 2BE9B 2ZPGB 4F7UE 4BUGA 1P92A 3M4YA 4RTVA 3OYLA 2DILA 2GQVA 4AFSC 1SHFA 3EFSA 4EDUA 2LJ3A 2P4TA 4FCYA 1K8AR 1M30A 3WXMB 1T0JA 2FYKA 1D1BA 3MHXA 4J9FA 3CCQA 2OTLQ 1AWWA 2OAUA 4XTXA 4HCZA 4M7DE 3KFVA 1I1JA 2CUBA 1G3SA 2K5IA 2OTJQ 2KMTA 3CCVA 5GANf 3VJPA 4JJNK 4RG8A 4HXJA 3CCMT 5GANd 1G3TA 1WYXA 2EW3A 5IT9E 2VB6A 4IUPA 5DLQE 4PJOD 2FZGB 3CMAQ 4RKUE 1QKWA 3JCMe 1D0YA 1HD3A 4KULA 3PT9A 2DMOA 2O88A 1M27C 2CYZB 4IUQA 3UWNA 2CH4W 4M75C 1SRMA 3EG3A 1B34A 2OTLT 3OYEA 2K4YA 1VQMA 1H3ZA 1NEBA 1RAGB 1NJIU 3MCAB 4CI0C 4J8OA 4X9CA 1OEBA 2QASA 3DB4A 3J7AF 2FRWA 1DJ7B 3NHNA 2DTOA 5GAMf 2YRVA 1KFZA 1IGUA 5GAMd 2SRCA 2ATCB 3CMAT 1NJIC 4J9BA 3I9QA 4BI4A 2JTFA 3JB9I 2CGHA 4IUUA 3S3NA 5IHNA 5KYXA 2K5FA 4FT4A 1M90R 4M7AA 1BCOA 3SD4A 3SFMA 1K0SA 2LT4A 4M75G 4XU3A 1AOJA 3L42A 2YDLA 2CT4A 4C0FA 4QW2A 1YP5A 2DTHA 1QVGS 1W4SA 4OVAA 2FEIA 3OS5A 4M75B 5GAOm 1ZUUA 2MI6A 1JJ2A 2LMJA 1YFNA 2KROA 1WXTA 3EFRA 3TQ7P 3J80E 2ED1A 2LQKA 1M3CA 3QSUA 1EZZB 5A0LA 3QJ6A 1SHGA 3DLLA 2M0OA 3JCMQ 3H0FA 5FLXE 1T3LA 3VS4A 4M4ZA 1XTDA 2FL7A 5ECAA 1VQ4Q 4C8QF 2ZCFB 5DY9A 5D7UA 1UUEA 5FRMA 2QQAA 3OW2P 2CZ6B 3PE0A 3ULRB 1IO6A 2QG9B 5CKDA 4DA4A 3UDCA 3CCUT 1TSFA 4PJMA 3MPUB 1PHTA 5KCHA 3RBBB 3CCJQ 2IIMA 3QPHA 1KD1U 4JRPA 4M77G 1VYUA 2RK2A 3PMTA 4RUGA 1VQOA 1G3YA 3ZFJA 2DRMA 3ASKA 1MMAA 2JW4A 2KGTA 1QVFS 3SEMA 2J6OA 2AZSA 4OMFB 2QYZA 1MGQA 3CD6A 3M0PA 4M77B 1RL2A 1VQ4T 4ZTJA 4Y92A 5GAN3 1KD1C 2DNUA 2OAWA 1KQ2A 3X28B 2RK1A 2ZPEB 4BDYA 3PVQA 2CREA 2AKLA 3M0RA 4ZGJB 3TSZA 4E7JA 3QJYA 3L2UA 3M0QA 1YIJQ 4J9IA 1VQKQ 2Y4XA 3N5BB 1MNEA 1C0MA 2ZPHB 1VIFA 4OMMA 4C5IA 3CC4A 1C6VX 4ESRA 3URGA 2EGCA 1XOVA 3I5RA 5EC7A 1LJOA 3I35A 4M78D 2PUOB 3V8KA 1LVKA 3GIBA 4PJOC 3OSSC 4J5YA 1YJNA 5IN1A 3GNGA 4CC2A 3GPLA 3VU3C 1D3BB 1D0ZA 4B9WA 4C8QD 4FSSA 3SWNB 2CP5A 3CC7A 1I5LA 1NBEB 4C5GA 2NUZA 3A8GB 1GFDA 2JN0A 3MEUA 1KHCA 3FC3A 1YIJT 1VQKT 2DE0X 3OYMA 2KT1A 2GTOA 3LH5A 2E3HA 1NYFA 2J6KA 1LNXA 4J9GA 3EG2A 4RTUA 2DL8A 2A37A 2G6FX 1OZ3A 4X1VA 1B7TA 5A2QE 2LQNA 3SDZA 4L5GA 1WHJA 3PNWC 4LD9K 3HL8A 1VQ9A 2YLCA 1IRXA 4AMCA 2PQWA 3E1SA 3OYYA 2FVUA 2BKDN 5GANe 1AWXA 1T0HA 2RN8A 4PJLA 3SB2A 1K9MU 3EHQA 1OQKA 1V29B 3HPWA 3V8LA 1VA7A 2E4HA 1JXMA 2CUDA 4C92D 2O9SA 2ZAEA 5L23A 1QVGA 2A0FB 3HKSA 3KUFA 4X9DA 2DL5A 2JMAA 1UECA 5CKHA 4N4HA 3WVDB 2EGEA 4OP0A 1K9MC 5CKBA 1GCPA 3M53A 3X26B 3X20B 3EG0A 2QK0A 2X4JA 4J6WA 2M51A 1UHCA 1RADB 2YLBA 1AHJB 2YWWA 2VGMA 3UT1A 3PMIA 2HL3A 5GAMe 2XG8D 2CP2A 1IB8A 3J81E 4A53A 2FO0A 2LP5A 2YHTA 4PNOA 2DZCA 4D8DA 4BD3A 4A4GA 1NZ9A 4TVRA 2JNGA 4RG2A 3V8JA 1KJWA 3NTKA 4BDZA 1KHIA 1H8KA 1WFWA 2QGGA 2XIDA 1KQ1A 3CCQQ 3GOXA 5KCOA 2DERA 2OX7A 1ZA2B 5HK0A 1K4US 2JTEA 4OMLA 3CCSA 1IHWA 4OMPA 3CCVQ 5FWCA 1X2QA 3CBMA 4VUBA 1Y96B 4HCBA 1KQSP 1IGQA 5KH6A 2AZVA 1M5Q1 3CCLA 3FRNA 2ZPIB 2DIGA 1VQ7A 2XDBA 4K11A 4A4FA 1O9SA 2DYIA 3G6EA 2KBTA 5GMKj 1OX9A 4ZTFA 2ENMA 2O2OA 3VS7A 4A4EA 3L2QA 4A4KA 5FRNA 1ZA1B 1NPPA 3QYGB 3G71T 3QKJA 3CCQT 4M78E 3REAB 2CKKA 1VQMQ 2RJDA 5LJ3f 1GBQA 1NJIR 1G8XA 1QWFA 1XJWB 3MP6A 5LJ3d 4HVWA 2L3SA 3CCVT 3JV3A 2JS0A 4M77F 2F69A 1RUWA 1MMDA 3PTAA 1Q7YR 1MNDA 4QVZA 1Q82U 2CZ7B 2V1QA 4XTUA 4C8QC 4M75D 2RQRA 2O9VA 3OBWA 2RHZA 3V7RA 1F1BB 2V26A 2PTKA 4KH1B 2RF0A 3EGUA 1FXXA 2ZGWA 1V76A 2EPDA 1X69A 2LC4A 3ER0A 3PVLA 2LQ8A 4LNPA 4FW2A 4XK8E 1X75C 3QHSA 2PVDB 2DXCA 1Q82C 4CRIA 2MWOA 1VQMT 2M02A 2HNIA 2PVGB 3H0IA 3OS0A 5GMKh 1YCSB 1M2VB 4F7UA 3HP9A 1JBMA 1RAAB 2M16A 5FW9A 5KYWA 4EMKC 3CPWP 1YNZA 2O31A 4J6XA 1TUCA 3JSCA 1A0NB 3JCMc 2DL4A 4C92E 1WX6A 3TCJA 2FHDA 2GBQA 2VASA 4J83A 2RO0A 1M1KU 4ME7A 4M7DA 1I5OB 1TS9A 3FDRA 1PG5B 4KBMB 1D0XA 1JXOA 1TUGB 4JS4A 4XQ3A 1I07A 2F2WA 3HTRA 4C8QB 1ZUYA 4PL6A 1RLPC 3M56A 2EQJA 4DEYA 2LVMA 1M1KC 4JRIA 2DXBA 2R58A 1ZX6A 4MZPA 1EIFA 4M77D 1B3QA 2ZZDA 1U1SA 3L1AA 3EAEA 1QMCA 1WGSA 2P0PA 3FJ5A 1SPKA 1X2KA 3EFOB 3LW5E 3CEYA 2JUFA 1M3AA 2D0NA 1PRMC 1W6XA 3MEWA 2K3YA 3M59A 4LD6A 3V7SA 4ZGDB 5CCAA 2GTJA 2BUDA 4PFPA 4ORZA 1KD1R 1ZHIA 4QQGA 1X6GA 1KIKA 1YBYA 1VQOQ 3JCMW 1GXIE 5HKCA 2EYQA 5CQYA 4EMKB 4E7IA 2VKNA 3JCMh 3QDRB 2QTXA 3CD6Q 4XU1A 3EGDB 5C6SA 4X34A 1OU8A 1M1FA 1AWJA 2RQVA 3FB9A 1ACMB 4MDWA 1QP3A 3CCRT 2QQ9A 4O5VA 2J6FA 4FYWB 1B07A 4FM4B 2RJFA 4LE9A 1NYGA 2NUPA 4NL3A 4OB1B 4C0DC 3CC4Q 1XQHA 1M1GA 2QA4A 2JXBA 4BE2A 5FU6B 2LT1A 4R0KA 2E10A 3CBPA 4J7IA 1O75A 3CD6T 1YJNQ 2A3LA 3NTHA 2KVQG 3QWXX 2HD0A 3OSVA 1TWBA 3CC7Q 3EG9B 2L89A 3CCEQ 1Y07A 2F1LA 2L2PA 1JB0E 2HAXA 2LCCA 2PU9B 5GAOp 1S72T 1OU9A 1UB4A 4M75E 4AG2C 5KYYB 1X01A 4LUDA 3CC4T 2LTOA 4FL6A 1LCKA 2BTTA 2YSQA 5LJ5g 4E6RA 1N8RU 2QEXA 1BI3A 4MMLA 1JU5C 3CBOA 2M1HA 1ZUKA 3EGXA 1HSQA 1YJNT 3O8VA 3OYGA 2K3XA 4HCKA 2HCKA 4C0DB 1VQ9Q 2LJ0A 3Q1JA 3CC7T 3M9QA 4AFQC 2DD4A 2OTJT 3X24B 3RMQA 1N8RC 1BKBA 4PFOA 1K9MR 3WVEB 2KDSA 2YT6A 1MV3A 5GAN6 4IURA 5GAN2 3JB9G 2SEMA 3JCMP 1PRLC 2AIRB 3NGPA 3HFNA 4KGVB 1X6OA 2DO3A 4WCIA 3R6OA 1RAHB 3U23A 1OV3A 3VS2A 3E2UA 2GFUA 2P4RA 1U8RA 4R55A 1LPLA 1QVFP 4ZNXA 2VXFA 5LJ3e 1NLOC 2L3RA 3MEAA 4E7HA 2KI7A 4XAXB 1VQ9T 1ZLMA 2KRMA 3QUIA 4PJOA 2FPEA 2E1HA 4HVVA 1R8OB 1W2BP 1Y7XA 3QXEB 4LUEA 1XNIA 5LJ3g 3OYIA 4BY6B 4YTLA 3GF5A 5GMKm 1UGQB 1UG1A 3FLGA 2ABLA 4M77C 4HT8A 3LYIA 3M0TA 1IXDA 1WIEA 3FIFA 2JM9A 2DBKA 1Q95G 3BE3A 2KSSA 4PJNA 1PD1A 3CXCP 3META 3D7SB 1R0CB 4CC4B 2HZYA 5FROA 4N0AC 1TG0A 2EYZA 2D0QB 2RA2A 2XHCA 2CSIA 3THKA 2O4XB 2PNIA 3S3MA 2RPNA 3CCSQ 1PKTA 3VS3A 1VQ5A 2VWFA 2VV5A 1K73R 1NLPC 5GANj 4V2SA 1WJSA 2DJQA 2IPOB 1IZ6A 2F2VA 1OOTA 2EQIA 3JAME 3RKYA 2VVKA 2FG0A 3CCLQ 1VQ7Q 4HVUA 4C5HA 1WA7A 5A0DA 4FYXB 2IVWA 4Y28E 4F17A 2L5QA 4R56A 3G4SA 3G6EQ 2DTIA 2JMCA 5HY6A 1YJ9Q 1N9RA 4E7LA 1G83A 4MMKA 3SWNC 2F5KA 5KE2A 1WLPB 1TOVA 1VIEA 2GNCA 2OI3A 4N4GA 4A54A 5GAOq 3A8OB 1ZSZA 4FSXA 3VYGA 4GY5A 4IIMA 3CCST 4QVDA 1OI1A 3HRTA 3DKMA 2IG0A 5GAMj 3RKWA 1Q82R 2E64A 3CCLT 2KEAA 3C12A 2FZKB 4L59A 3CCJT 3R6NA 1S1NA 3O5ZA 1RACB 5C0MA 4IKFA 5GANh 3G6ET 4OMNA 2CZ0B 4PJOE 3RMSA 1NPRA 1QCNA 2E6ZA 4XTZA 1QQJA 4IUTA 1RAIB 2GQIA 3I55A 5AT1B 3OYNA 4LDXA 2X51A 3QG1A 4OGEA 4XTYA 5IAYA 1AEYA 1M2OA 4RCBA 5KYUA 4JUVA 5GJVB 4EMHA 3OYFA 4M7AC 2WSFE 1WXBA 3CCEA 2RH2A 4NL2A 3DLMA 1K8AU 1GFCA 4RTXA 2EKHA 1V1CA 1M1KR 2DVJA 1Y0MA 3ZL7C 2L3PA 2K2VA 5GAMh 1B34B 3X25B 4LDYA 1SEMA 3C4SA 5DLOA 2YUOA 2M9UA 2EJFA 4IUVA 3KXTA 2RJEA 2RHUA 1K8AC 2KE9A 3BW1A 1UFFA 4GLKA 3L2ZA 1VQNA 3TSWA 4C5EA 1WHLA 2HEQA 1QCFA 3INZA 2I2LA 5CKFA 4RTTA 1BYMA 5D6WA 1AWOA 4M7AG 1UJ0A 2EIFA 3E9FA 1X27A 1TU0B 1QWEA 4M78A 5KYXB 4GLMA 1VQ8A 1RAEB 2HSEB 4M7AB 1KSWA 4N4IA 1OZ2A 3JCMJ 2MIOA 2AKKA 4C8QA 2JT4A 2QDYB 3GLXA 1WXUA 2D6FA 3VUZA 2LJ1A 2FB7A 2VC8A 4LDWA 4DBFA 2DFUA 2ROTA 4HA8A 2XD0A 3NTIA 1RI9A 3C0CA 3JB9F 2E12A 2RI5A 3REBB 4ATOA 2VGNA 2CT3A 2O01E 5LJ5f 4GBQA 2NUTA 1M90U 5LJ5d 1WNLA 2YUQA 5FWBA 2K57A 3MEVA 5CIUA 1YITA 2KNBB 2KXDA 4EMKA 2QA4Q 1PSFA 1OX8A 2W0ZA 3EH2A 3IQLA 2EJGA 3UPUA 4CC3A 4BE1A 4FIBA 4OB3B 4C0ZA 5CR2A 1M90C 1EX4A 1WHKA 1UE9A 3CCUA 4C92A 1I0CA 5I2SA 2WSCE 1G5VA 4LDUA 4NS5A 3M55A 2BE7D 1KK7A 2K9GA 4JPBW 1VQPA 2QDLA 4J7FA 2KAFA 4OB0B 2XICA 1Q86U 4PJJA 2JJ9A 2QA4T 7AT1B 4JS5A 2GFAA 2ROLA 1YJ9A 4RTYA 2QEXQ 1N8RR 3NMZC 1H3HA 1YHQA 4HCCA 4J9DA 1IHVA 2LQWA 1H641 3HHTB 3VS1A 5CKEA 4QQ6A 3JB9J 3AHUA 4LN2A 2J05A 1Z9QA 3JB9D 2K7AA 2RD1A 1JJ2P 1Q86C 1QKXA 4C8QE 2B8AA 3BDLA 4LDVA 2KRNA 1K9AA 4PKCC 3DB3A 1AZEA 3G1JA 3H0HA 3M4GA 3RUXA 1ZQ1A 2EYXA 1RAFB 4XU0A 1RI0A 2YRDA 4C0GA 4ZGEB 4BACA 4FT2A 4E47A 1FWZA 1FMKA 2NYSA 4HT9A 4OB2B 4XU2A 3C95A 1ARKA 3M54A 3F70A 2XMFA 5DM7R 3L2RA 1OPKA 2DM1A 1GL5A 2CDTA 1YWOA 1NEGA 5AYFA 3OW2A 5J26A 1W70A 4A63B 4Q5WA 2MPXC 1R0BG 1SF9A 3ME9A 1VQLA 1AD5A 3I56A 2RQWA 8ATCB 2MAMA 1PSEA 4F14A 1Q81U 5D6XA 1PWTA 5I11A 2CH4A 2D9TA 5CVIA 5IXFA 2DVEA 2MYSA 2RI2A 3VKIA 1M8MA 1M3BA 3OB9A 1D1AA 4ZN3A 3VRYA 1GBRA 4OF1A 2I0NA 4BI8B 1I81A 2AT1B 1E6HA 1KQSS 2DETA 1Q81C 2EVRA 4PLLA 1M8VA 5GAOl 1SSFA 4M75A 1TXQA 1VQ5Q 1WQWA 4E2FB 3S6WA 3FEOA 5FU6C 3JCMX 1UJYA 4WTOB 1MV0B 1GCQC 1PD0A 2JM8A 2LDMA 3G4SQ 4ELZC 2HMAA 2A28A 4RCCA 4DQ2A 3UA7A 4M7AF 4L6V5 2DX1A 3PIOA 1PKSA 3A1PA 5GAN8 2ZPBB 3HFOA 2C0OA 3LGFA 2HQEA 4P5NA 3VRZA 1ZBJA 4RMOA 2EGAA 2QGFB 2RM4A 5A0GA 2RQTA 2GGRA 5IHKA 3RESA 2RMOA 1MMGA 3G4ST 1UTIA 2H3JA 2H8HA 1ABQA 1BK2A 4QVCA 1VQOT 1YWPA 2R5AA 3BY7A 4M77A 2XDDA 3QDFA 3FJPA 3I55Q 3CPWS 4FU6A 2K2MA 2MMPA 3TVTA 4DBRA 2DBMA 1BB9A 2EFIA 4LXCA 5I21A 1N5ZA 1Y71A 1K76A 4J9EA 5J39A 3LGLA 3RR6A 3P8BB 4N0AA 4PLIA 2HQXA 1WHMA 5I22A 5LJ5e 5LJ3h 1YI2A 2A36A 4AFZC 3OMGA 2DF6A 1QVGP 2E5KA 2FPDA 3QO3A 3A8MB 3EG1A 4B9XA 3LLRA 1ZBXA 1BI0A 3OS2A 3TU4K 1K1ZA 3G71A 3M5AA 3PIPA 2XDPA 1VYVA 1U5SA 2LCLA 3I55T 4M7AD 5IXBA 1D3BA 5M9OA 2C06A 4M7DC 1VQNQ 2EWNA 3SWNA 4BY6C 1SKUB 2EQMA 3I5SA 1HK9A 3CCET 1PCXA 4D8KA 2G3RA 1I4K1 1AZGB 2RNAA 3CQTA 4JJCA 2BZ8A 4DOWA 4F7UG 2EJ9A 1VQ8Q 4KUIA 4O6JA 4OGCA 3RERA 4AFUC 3OA6A 3S3OA 3JCMg 2JZ2A 2E5QA 2DJZA 2H3EB 5EG2A 2V1RA 1YJWA 1CSKA 2EQUA 3L2WA 4F7UB 2A08A 1Q7YU 1BIBA 3T9NA 2DXUA 2KQWA 1VQNT 2VUBA 2V8IA 1CKBA 3A8LB 5GAOr 3M58A 4M7DG 1OPLA 2Y4YA 5KYWB 3MKDA 4EMGA 2C0IA 2L8DA 4WF2A 2R57A 1KQSA 3BFMA 3H41A 3OY9A 3JCMV 2X4XA 4M77E 1FYNA 2VYTA 3GNFB 2J7IA 3LX7A 4ANJA 2KRSA 2MF2A 1Q7YC 4M7DB 1VQ8T 1YITQ 3M57A 2X35A 1UEBA 4JJDA 1QVPA 2PZ1A 5GMKi 2BZXA 4OMOA 3CC2A 5CQXA 3C94A 2NWMA 4CC7A 2BZYA 3M0SA 3CCUQ 1VOMA 4E7KA 1KC8U 1J3TA 1M4ZA 1W1FA 1SSHA 3OBYA 2HDAA 1YN8A 4KGZB 5GAN5 3MP1A 3HRUA 2QTVA 3VS6A 3OYHA 3QZ9B 4M78F 1YITT 1VQPQ 1VQ6A 1TH7A 2LX7A 2E41A 1Q86R 2HL5C 1JEGA 5CO7A 3OYAA 2X9HA 1KC8C 2HBWA 5GJWB 2JVVA 1N9SA 3P8HA 2YUPA 3CMEA 1YHQQ 3ZEHA 4JLGA 3CPFA 1RABB 2C0TA 2HSPA 4II1A 3KBGA 3CCRA 3TEEA 2EYYA 1MMNA 2QXFA 1SG5A 1Y96A 4DBQA 3CPWA 2XKOC 1NM7A 2KK4A 1OYXA 2NUPB 2JTMA 1VQPT 5D6YA 1VQ7T 1QCOA 4JZ4A 4F04B 1YJ9T 4AT1B 2XK0A 4JLIA 2XU8A 1YHQT 1W2BS 1CKAA 2VXEA 4M7AE 4AG1C 3V7CA 1G2BA 1QW1A 4EPCA 2ED0A 4C92F 2DA9A 4FYYB 1S72A 3CCMA 2P0QA 3NFCA 4ELYC 1VQLQ 2MOXA 2ECZA 3CXCS 4JRQA 1D1CA 4PK4A 2CS7A 3I56Q 2EQKA 3RIRA 1MUZA 1Q81R 1PC0A 1MHNA 2QQSA 4BE0A 4ZN1A 1JO8A 1Z9ZA 2OTLA 3EGXB 1I8FA 2COZA 3H8ZA 4F16A 2DYBA 2ESWA 2HKNA 4IIOA 4FW1A 2Z0WA 2MWPA 2A7YA 2OTJA 3MP8A 3A98A 3OW2S 2L3QA 2DZ9A 1M2VA 4MDXA 3QZ5B 2RHXA 3UF4A 3OYCA 1UDLA 3CMAA
chains in the Genus database with same CATH topology
1VQ4Q 1Q82R 1QVFP 1VQ5Q 1YITQ 1S72Q 3CCMQ 3CCSQ 2QEXQ 1YHQQ 1N8RR 1K9MR 1YIJQ 1K73R 3CCVQ 1VQKQ 3CC7Q 3CD6Q 1YI2Q 3CCEQ 2OTJQ 3CCRQ 2QA4Q 3OW2P 3CC4Q 3CC2Q 1VQMQ 3CXCP 1QVGP 1VQ8Q 1VQLQ 1KQSP 3CCLQ 1VQ6Q 1VQNQ 1NJIR 3I56Q 1VQ7Q 1VQPQ 1K8AR 3CCJQ 3G4SQ 1YJWQ 1JJ2P 3G71Q 3CPWP 3I55Q 1W2BP 1Q81R 1KD1R 1VQ9Q 1Q86R 3CCQQ 3G6EQ 3CMAQ 1YJNQ 1YJ9Q 3CCUQ 1VQOQ 1M90R 3CMEQ 2OTLQ 1KC8R 1M1KR 1Q7YR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 Q;  1Q82 R;  1QVF P;  1VQ5 Q;  1YIT Q;  1S72 Q;  3CCM Q;  3CCS Q;  2QEX Q;  1YHQ Q;  1N8R R;  1K9M R;  1YIJ Q;  1K73 R;  3CCV Q;  1VQK Q;  3CC7 Q;  3CD6 Q;  1YI2 Q;  3CCE Q;  2OTJ Q;  3CCR Q;  2QA4 Q;  3OW2 P;  3CC4 Q;  3CC2 Q;  1VQM Q;  3CXC P;  1QVG P;  1VQ8 Q;  1VQL Q;  1KQS P;  3CCL Q;  1VQ6 Q;  1VQN Q;  1NJI R;  3I56 Q;  1VQ7 Q;  1VQP Q;  1K8A R;  3CCJ Q;  3G4S Q;  1YJW Q;  1JJ2 P;  3G71 Q;  3CPW P;  3I55 Q;  1W2B P;  1Q81 R;  1KD1 R;  1VQ9 Q;  1Q86 R;  3CCQ Q;  3G6E Q;  3CMA Q;  1YJN Q;  1YJ9 Q;  3CCU Q;  1VQO Q;  1M90 R;  3CME Q;  2OTL Q;  1KC8 R;  1M1K R;  1Q7Y R; 
#chains in the Genus database with same CATH topology
 1VQL T;  4HKE A;  3I56 T;  4JJB A;  2RHI A;  1WQ7 A;  1TUD A;  2MK5 A;  5IH2 A;  3JCM b;  1BBZ A;  4PJO G;  2V8J A;  4A4H A;  2CP0 A;  2KYM A;  2LZ6 B;  2KXC A;  4QQD A;  1NG2 A;  3MJX A;  2DIQ A;  5GAO n;  2WSE E;  2R5M A;  3QBY A;  2K5L A;  4RTZ A;  2KY9 A;  4PJO B;  4QKU A;  4F7U F;  1LOJ A;  5IHI A;  2HBP A;  1OUL A;  2F2X A;  3EFO A;  3L2V A;  1BCM A;  1UGR B;  1ZSZ C;  5GAN 7;  3LWI A;  2KR3 A;  5GAN g;  1FX7 A;  3TRE A;  1TTH B;  1BU1 A;  1AT1 B;  3OQ5 A;  1R77 A;  5HCK A;  1WJQ A;  4M7D F;  4UC4 A;  1G3W A;  4Z89 A;  2K3B A;  3JRZ A;  4XTV A;  2YXY A;  2E65 A;  5FU7 C;  4KH0 B;  1HXD A;  3EGD A;  2K79 A;  2RHY A;  4E7S A;  2LNV A;  2X4Y A;  1UGV A;  2X3W D;  3QYH B;  2WAC A;  4M75 F;  4KRT A;  4RTW A;  3VS0 A;  4B6M A;  3LWH A;  3UAT A;  1VYT A;  2COW A;  1YI2 Q;  3JCM f;  1EFN A;  1E7O A;  4J9H A;  5HK3 A;  2GCX A;  4BI3 A;  1PNJ A;  3JCM d;  5GAM g;  2DXT A;  3PFS A;  4DBH A;  3G71 Q;  2EKO A;  4JRK A;  1WDX A;  1BI2 A;  1VUB A;  3UA6 A;  5KE3 A;  2RI3 A;  1ZSG A;  4EIK A;  3LH0 A;  5GAN 4;  1X6B A;  2CP3 A;  1ZSZ B;  2KT8 A;  1VQ4 A;  1GCQ A;  1QVF A;  1E6G A;  2P0K A;  2CP7 A;  1K73 U;  2PVO B;  2YUN A;  3QII A;  1U1T A;  4KUD K;  3VYH B;  2W10 A;  1SRL A;  3ZBD A;  1H92 A;  1X43 A;  3EG9 A;  9ATC B;  2OJ2 A;  2E6N A;  3A8H B;  3M0U A;  3CCJ A;  3A5Z B;  1W2B A;  1YI2 T;  5FU7 B;  2E3I A;  2QAZ A;  3H9N A;  4PFZ A;  1K73 C;  1IRE B;  5KYY A;  2DEQ A;  4OMQ A;  2D1X A;  4NOY A;  2V8K A;  1PM3 A;  2D8H A;  4M7D D;  3CXC A;  1HJD A;  4QT7 A;  2FRY A;  5J3B A;  1WJR A;  5CAI A;  1YJW Q;  2QEX T;  1U06 A;  3OS1 A;  2DEU A;  1K0X A;  2DAQ A;  4M78 C;  3OYJ A;  5KYU B;  1GRI A;  2XI9 A;  4MZT A;  2LCS A;  4BB7 A;  2EAY A;  1YIJ A;  2YRC A;  2COY A;  2PUK B;  1VQK A;  1FMW A;  3GBQ A;  3OYD A;  2HKQ B;  3JB9 H;  1RLQ C;  3E9G A;  5LJ5 j;  2QQR A;  2DKG A;  5CK9 A;  2ZPF B;  3VS5 A;  2GF7 A;  2AHJ B;  1FMV A;  2DK3 A;  2FZC B;  3G7Z A;  2RQU A;  3GP8 A;  2NLU A;  1WHH A;  1C1A A;  2B86 A;  2M0Y A;  3E19 A;  2MCN A;  1YJW T;  1BI1 A;  2EYW A;  3CC2 Q;  4JDS A;  1Y57 A;  1KG1 A;  3HSB A;  2LRQ A;  2JS2 A;  2RJC A;  2DLP A;  4M78 G;  1AVZ C;  3RDV A;  2AK5 A;  4Z88 A;  2D8J A;  4Y91 A;  1JRI A;  1BIA A;  2DL7 A;  1WHG A;  2K6D A;  1KC8 R;  4DOV A;  2DL3 A;  3RKX A;  4C8Q G;  1JQQ A;  1YCY A;  2RB6 A;  4DEX A;  1M9S A;  5GMK l;  4M78 B;  3BDU A;  2CP6 A;  3P8D A;  3RNJ A;  1QLY A;  2DD5 A;  1QP2 A;  4C92 C;  5KYN A;  1UGS B;  1VQ6 Q;  1HYO A;  1WZO A;  2X3X D;  5LJ5 h;  2QI2 A;  4J9C A;  1JJ2 S;  2KYB A;  2J06 A;  3CME Q;  3PGG A;  3CC2 T;  3OMC A;  3VUB A;  4FYV B;  2EBP A;  1N27 A;  3AT1 B;  3EHR A;  5I2M A;  3OYK A;  2Y90 A;  2O4X A;  5LJ3 j;  3CCR Q;  2P84 A;  2FPF A;  3NPF A;  2DRK A;  4J6Y A;  2CZ1 B;  3EH1 A;  4Z02 A;  3OYB A;  3QWY A;  4PJO F;  2NUT B;  2X4W A;  1UGP B;  5L8R E;  5LL6 S;  4Z8A A;  3SHW A;  1VQ5 T;  4KGX B;  1NE8 A;  1T3S A;  4E7Z A;  2LNH B;  5GMK e;  2CSQ A;  2JOY A;  1VQ6 T;  3VV0 A;  8AT1 B;  4C92 G;  4JZ3 A;  1D09 B;  1N6A A;  2BIV A;  2HQH A;  6AT1 B;  1WI7 A;  3CME T;  2QQB A;  3HRS A;  4XTW A;  2F5T X;  4D6W A;  4KT0 E;  1WPY A;  2L0A A;  4C92 B;  2E70 A;  2LX9 A;  1UHF A;  2DPP B;  3MO8 A;  3H6Z A;  1ABO A;  1U3O A;  3CCM Q;  1S72 Q;  4MZM A;  2BE9 B;  2ZPG B;  4F7U E;  4BUG A;  1P92 A;  3M4Y A;  4RTV A;  3OYL A;  2DIL A;  2GQV A;  4AFS C;  1SHF A;  3EFS A;  4EDU A;  2LJ3 A;  2P4T A;  4FCY A;  1K8A R;  1M30 A;  3WXM B;  1T0J A;  2FYK A;  1D1B A;  3MHX A;  4J9F A;  3CCQ A;  2OTL Q;  1AWW A;  2OAU A;  4XTX A;  4HCZ A;  4M7D E;  3KFV A;  1I1J A;  2CUB A;  1G3S A;  2K5I A;  2OTJ Q;  2KMT A;  3CCV A;  5GAN f;  3VJP A;  4JJN K;  4RG8 A;  4HXJ A;  3CCM T;  5GAN d;  1G3T A;  1WYX A;  2EW3 A;  5IT9 E;  2VB6 A;  4IUP A;  5DLQ E;  4PJO D;  2FZG B;  3CMA Q;  4RKU E;  1QKW A;  3JCM e;  1D0Y A;  1HD3 A;  4KUL A;  3PT9 A;  2DMO A;  2O88 A;  1M27 C;  2CYZ B;  4IUQ A;  3UWN A;  2CH4 W;  4M75 C;  1SRM A;  3EG3 A;  1B34 A;  2OTL T;  3OYE A;  2K4Y A;  1VQM A;  1H3Z A;  1NEB A;  1RAG B;  1NJI U;  3MCA B;  4CI0 C;  4J8O A;  4X9C A;  1OEB A;  2QAS A;  3DB4 A;  3J7A F;  2FRW A;  1DJ7 B;  3NHN A;  2DTO A;  5GAM f;  2YRV A;  1KFZ A;  1IGU A;  5GAM d;  2SRC A;  2ATC B;  3CMA T;  1NJI C;  4J9B A;  3I9Q A;  4BI4 A;  2JTF A;  3JB9 I;  2CGH A;  4IUU A;  3S3N A;  5IHN A;  5KYX A;  2K5F A;  4FT4 A;  1M90 R;  4M7A A;  1BCO A;  3SD4 A;  3SFM A;  1K0S A;  2LT4 A;  4M75 G;  4XU3 A;  1AOJ A;  3L42 A;  2YDL A;  2CT4 A;  4C0F A;  4QW2 A;  1YP5 A;  2DTH A;  1QVG S;  1W4S A;  4OVA A;  2FEI A;  3OS5 A;  4M75 B;  5GAO m;  1ZUU A;  2MI6 A;  1JJ2 A;  2LMJ A;  1YFN A;  2KRO A;  1WXT A;  3EFR A;  3TQ7 P;  3J80 E;  2ED1 A;  2LQK A;  1M3C A;  3QSU A;  1EZZ B;  5A0L A;  3QJ6 A;  1SHG A;  3DLL A;  2M0O A;  3JCM Q;  3H0F A;  5FLX E;  1T3L A;  3VS4 A;  4M4Z A;  1XTD A;  2FL7 A;  5ECA A;  1VQ4 Q;  4C8Q F;  2ZCF B;  5DY9 A;  5D7U A;  1UUE A;  5FRM A;  2QQA A;  3OW2 P;  2CZ6 B;  3PE0 A;  3ULR B;  1IO6 A;  2QG9 B;  5CKD A;  4DA4 A;  3UDC A;  3CCU T;  1TSF A;  4PJM A;  3MPU B;  1PHT A;  5KCH A;  3RBB B;  3CCJ Q;  2IIM A;  3QPH A;  1KD1 U;  4JRP A;  4M77 G;  1VYU A;  2RK2 A;  3PMT A;  4RUG A;  1VQO A;  1G3Y A;  3ZFJ A;  2DRM A;  3ASK A;  1MMA A;  2JW4 A;  2KGT A;  1QVF S;  3SEM A;  2J6O A;  2AZS A;  4OMF B;  2QYZ A;  1MGQ A;  3CD6 A;  3M0P A;  4M77 B;  1RL2 A;  1VQ4 T;  4ZTJ A;  4Y92 A;  5GAN 3;  1KD1 C;  2DNU A;  2OAW A;  1KQ2 A;  3X28 B;  2RK1 A;  2ZPE B;  4BDY A;  3PVQ A;  2CRE A;  2AKL A;  3M0R A;  4ZGJ B;  3TSZ A;  4E7J A;  3QJY A;  3L2U A;  3M0Q A;  1YIJ Q;  4J9I A;  1VQK Q;  2Y4X A;  3N5B B;  1MNE A;  1C0M A;  2ZPH B;  1VIF A;  4OMM A;  4C5I A;  3CC4 A;  1C6V X;  4ESR A;  3URG A;  2EGC A;  1XOV A;  3I5R A;  5EC7 A;  1LJO A;  3I35 A;  4M78 D;  2PUO B;  3V8K A;  1LVK A;  3GIB A;  4PJO C;  3OSS C;  4J5Y A;  1YJN A;  5IN1 A;  3GNG A;  4CC2 A;  3GPL A;  3VU3 C;  1D3B B;  1D0Z A;  4B9W A;  4C8Q D;  4FSS A;  3SWN B;  2CP5 A;  3CC7 A;  1I5L A;  1NBE B;  4C5G A;  2NUZ A;  3A8G B;  1GFD A;  2JN0 A;  3MEU A;  1KHC A;  3FC3 A;  1YIJ T;  1VQK T;  2DE0 X;  3OYM A;  2KT1 A;  2GTO A;  3LH5 A;  2E3H A;  1NYF A;  2J6K A;  1LNX A;  4J9G A;  3EG2 A;  4RTU A;  2DL8 A;  2A37 A;  2G6F X;  1OZ3 A;  4X1V A;  1B7T A;  5A2Q E;  2LQN A;  3SDZ A;  4L5G A;  1WHJ A;  3PNW C;  4LD9 K;  3HL8 A;  1VQ9 A;  2YLC A;  1IRX A;  4AMC A;  2PQW A;  3E1S A;  3OYY A;  2FVU A;  2BKD N;  5GAN e;  1AWX A;  1T0H A;  2RN8 A;  4PJL A;  3SB2 A;  1K9M U;  3EHQ A;  1OQK A;  1V29 B;  3HPW A;  3V8L A;  1VA7 A;  2E4H A;  1JXM A;  2CUD A;  4C92 D;  2O9S A;  2ZAE A;  5L23 A;  1QVG A;  2A0F B;  3HKS A;  3KUF A;  4X9D A;  2DL5 A;  2JMA A;  1UEC A;  5CKH A;  4N4H A;  3WVD B;  2EGE A;  4OP0 A;  1K9M C;  5CKB A;  1GCP A;  3M53 A;  3X26 B;  3X20 B;  3EG0 A;  2QK0 A;  2X4J A;  4J6W A;  2M51 A;  1UHC A;  1RAD B;  2YLB A;  1AHJ B;  2YWW A;  2VGM A;  3UT1 A;  3PMI A;  2HL3 A;  5GAM e;  2XG8 D;  2CP2 A;  1IB8 A;  3J81 E;  4A53 A;  2FO0 A;  2LP5 A;  2YHT A;  4PNO A;  2DZC A;  4D8D A;  4BD3 A;  4A4G A;  1NZ9 A;  4TVR A;  2JNG A;  4RG2 A;  3V8J A;  1KJW A;  3NTK A;  4BDZ A;  1KHI A;  1H8K A;  1WFW A;  2QGG A;  2XID A;  1KQ1 A;  3CCQ Q;  3GOX A;  5KCO A;  2DER A;  2OX7 A;  1ZA2 B;  5HK0 A;  1K4U S;  2JTE A;  4OML A;  3CCS A;  1IHW A;  4OMP A;  3CCV Q;  5FWC A;  1X2Q A;  3CBM A;  4VUB A;  1Y96 B;  4HCB A;  1KQS P;  1IGQ A;  5KH6 A;  2AZV A;  1M5Q 1;  3CCL A;  3FRN A;  2ZPI B;  2DIG A;  1VQ7 A;  2XDB A;  4K11 A;  4A4F A;  1O9S A;  2DYI A;  3G6E A;  2KBT A;  5GMK j;  1OX9 A;  4ZTF A;  2ENM A;  2O2O A;  3VS7 A;  4A4E A;  3L2Q A;  4A4K A;  5FRN A;  1ZA1 B;  1NPP A;  3QYG B;  3G71 T;  3QKJ A;  3CCQ T;  4M78 E;  3REA B;  2CKK A;  1VQM Q;  2RJD A;  5LJ3 f;  1GBQ A;  1NJI R;  1G8X A;  1QWF A;  1XJW B;  3MP6 A;  5LJ3 d;  4HVW A;  2L3S A;  3CCV T;  3JV3 A;  2JS0 A;  4M77 F;  2F69 A;  1RUW A;  1MMD A;  3PTA A;  1Q7Y R;  1MND A;  4QVZ A;  1Q82 U;  2CZ7 B;  2V1Q A;  4XTU A;  4C8Q C;  4M75 D;  2RQR A;  2O9V A;  3OBW A;  2RHZ A;  3V7R A;  1F1B B;  2V26 A;  2PTK A;  4KH1 B;  2RF0 A;  3EGU A;  1FXX A;  2ZGW A;  1V76 A;  2EPD A;  1X69 A;  2LC4 A;  3ER0 A;  3PVL A;  2LQ8 A;  4LNP A;  4FW2 A;  4XK8 E;  1X75 C;  3QHS A;  2PVD B;  2DXC A;  1Q82 C;  4CRI A;  2MWO A;  1VQM T;  2M02 A;  2HNI A;  2PVG B;  3H0I A;  3OS0 A;  5GMK h;  1YCS B;  1M2V B;  4F7U A;  3HP9 A;  1JBM A;  1RAA B;  2M16 A;  5FW9 A;  5KYW A;  4EMK C;  3CPW P;  1YNZ A;  2O31 A;  4J6X A;  1TUC A;  3JSC A;  1A0N B;  3JCM c;  2DL4 A;  4C92 E;  1WX6 A;  3TCJ A;  2FHD A;  2GBQ A;  2VAS A;  4J83 A;  2RO0 A;  1M1K U;  4ME7 A;  4M7D A;  1I5O B;  1TS9 A;  3FDR A;  1PG5 B;  4KBM B;  1D0X A;  1JXO A;  1TUG B;  4JS4 A;  4XQ3 A;  1I07 A;  2F2W A;  3HTR A;  4C8Q B;  1ZUY A;  4PL6 A;  1RLP C;  3M56 A;  2EQJ A;  4DEY A;  2LVM A;  1M1K C;  4JRI A;  2DXB A;  2R58 A;  1ZX6 A;  4MZP A;  1EIF A;  4M77 D;  1B3Q A;  2ZZD A;  1U1S A;  3L1A A;  3EAE A;  1QMC A;  1WGS A;  2P0P A;  3FJ5 A;  1SPK A;  1X2K A;  3EFO B;  3LW5 E;  3CEY A;  2JUF A;  1M3A A;  2D0N A;  1PRM C;  1W6X A;  3MEW A;  2K3Y A;  3M59 A;  4LD6 A;  3V7S A;  4ZGD B;  5CCA A;  2GTJ A;  2BUD A;  4PFP A;  4ORZ A;  1KD1 R;  1ZHI A;  4QQG A;  1X6G A;  1KIK A;  1YBY A;  1VQO Q;  3JCM W;  1GXI E;  5HKC A;  2EYQ A;  5CQY A;  4EMK B;  4E7I A;  2VKN A;  3JCM h;  3QDR B;  2QTX A;  3CD6 Q;  4XU1 A;  3EGD B;  5C6S A;  4X34 A;  1OU8 A;  1M1F A;  1AWJ A;  2RQV A;  3FB9 A;  1ACM B;  4MDW A;  1QP3 A;  3CCR T;  2QQ9 A;  4O5V A;  2J6F A;  4FYW B;  1B07 A;  4FM4 B;  2RJF A;  4LE9 A;  1NYG A;  2NUP A;  4NL3 A;  4OB1 B;  4C0D C;  3CC4 Q;  1XQH A;  1M1G A;  2QA4 A;  2JXB A;  4BE2 A;  5FU6 B;  2LT1 A;  4R0K A;  2E10 A;  3CBP A;  4J7I A;  1O75 A;  3CD6 T;  1YJN Q;  2A3L A;  3NTH A;  2KVQ G;  3QWX X;  2HD0 A;  3OSV A;  1TWB A;  3CC7 Q;  3EG9 B;  2L89 A;  3CCE Q;  1Y07 A;  2F1L A;  2L2P A;  1JB0 E;  2HAX A;  2LCC A;  2PU9 B;  5GAO p;  1S72 T;  1OU9 A;  1UB4 A;  4M75 E;  4AG2 C;  5KYY B;  1X01 A;  4LUD A;  3CC4 T;  2LTO A;  4FL6 A;  1LCK A;  2BTT A;  2YSQ A;  5LJ5 g;  4E6R A;  1N8R U;  2QEX A;  1BI3 A;  4MML A;  1JU5 C;  3CBO A;  2M1H A;  1ZUK A;  3EGX A;  1HSQ A;  1YJN T;  3O8V A;  3OYG A;  2K3X A;  4HCK A;  2HCK A;  4C0D B;  1VQ9 Q;  2LJ0 A;  3Q1J A;  3CC7 T;  3M9Q A;  4AFQ C;  2DD4 A;  2OTJ T;  3X24 B;  3RMQ A;  1N8R C;  1BKB A;  4PFO A;  1K9M R;  3WVE B;  2KDS A;  2YT6 A;  1MV3 A;  5GAN 6;  4IUR A;  5GAN 2;  3JB9 G;  2SEM A;  3JCM P;  1PRL C;  2AIR B;  3NGP A;  3HFN A;  4KGV B;  1X6O A;  2DO3 A;  4WCI A;  3R6O A;  1RAH B;  3U23 A;  1OV3 A;  3VS2 A;  3E2U A;  2GFU A;  2P4R A;  1U8R A;  4R55 A;  1LPL A;  1QVF P;  4ZNX A;  2VXF A;  5LJ3 e;  1NLO C;  2L3R A;  3MEA A;  4E7H A;  2KI7 A;  4XAX B;  1VQ9 T;  1ZLM A;  2KRM A;  3QUI A;  4PJO A;  2FPE A;  2E1H A;  4HVV A;  1R8O B;  1W2B P;  1Y7X A;  3QXE B;  4LUE A;  1XNI A;  5LJ3 g;  3OYI A;  4BY6 B;  4YTL A;  3GF5 A;  5GMK m;  1UGQ B;  1UG1 A;  3FLG A;  2ABL A;  4M77 C;  4HT8 A;  3LYI A;  3M0T A;  1IXD A;  1WIE A;  3FIF A;  2JM9 A;  2DBK A;  1Q95 G;  3BE3 A;  2KSS A;  4PJN A;  1PD1 A;  3CXC P;  3MET A;  3D7S B;  1R0C B;  4CC4 B;  2HZY A;  5FRO A;  4N0A C;  1TG0 A;  2EYZ A;  2D0Q B;  2RA2 A;  2XHC A;  2CSI A;  3THK A;  2O4X B;  2PNI A;  3S3M A;  2RPN A;  3CCS Q;  1PKT A;  3VS3 A;  1VQ5 A;  2VWF A;  2VV5 A;  1K73 R;  1NLP C;  5GAN j;  4V2S A;  1WJS A;  2DJQ A;  2IPO B;  1IZ6 A;  2F2V A;  1OOT A;  2EQI A;  3JAM E;  3RKY A;  2VVK A;  2FG0 A;  3CCL Q;  1VQ7 Q;  4HVU A;  4C5H A;  1WA7 A;  5A0D A;  4FYX B;  2IVW A;  4Y28 E;  4F17 A;  2L5Q A;  4R56 A;  3G4S A;  3G6E Q;  2DTI A;  2JMC A;  5HY6 A;  1YJ9 Q;  1N9R A;  4E7L A;  1G83 A;  4MMK A;  3SWN C;  2F5K A;  5KE2 A;  1WLP B;  1TOV A;  1VIE A;  2GNC A;  2OI3 A;  4N4G A;  4A54 A;  5GAO q;  3A8O B;  1ZSZ A;  4FSX A;  3VYG A;  4GY5 A;  4IIM A;  3CCS T;  4QVD A;  1OI1 A;  3HRT A;  3DKM A;  2IG0 A;  5GAM j;  3RKW A;  1Q82 R;  2E64 A;  3CCL T;  2KEA A;  3C12 A;  2FZK B;  4L59 A;  3CCJ T;  3R6N A;  1S1N A;  3O5Z A;  1RAC B;  5C0M A;  4IKF A;  5GAN h;  3G6E T;  4OMN A;  2CZ0 B;  4PJO E;  3RMS A;  1NPR A;  1QCN A;  2E6Z A;  4XTZ A;  1QQJ A;  4IUT A;  1RAI B;  2GQI A;  3I55 A;  5AT1 B;  3OYN A;  4LDX A;  2X51 A;  3QG1 A;  4OGE A;  4XTY A;  5IAY A;  1AEY A;  1M2O A;  4RCB A;  5KYU A;  4JUV A;  5GJV B;  4EMH A;  3OYF A;  4M7A C;  2WSF E;  1WXB A;  3CCE A;  2RH2 A;  4NL2 A;  3DLM A;  1K8A U;  1GFC A;  4RTX A;  2EKH A;  1V1C A;  1M1K R;  2DVJ A;  1Y0M A;  3ZL7 C;  2L3P A;  2K2V A;  5GAM h;  1B34 B;  3X25 B;  4LDY A;  1SEM A;  3C4S A;  5DLO A;  2YUO A;  2M9U A;  2EJF A;  4IUV A;  3KXT A;  2RJE A;  2RHU A;  1K8A C;  2KE9 A;  3BW1 A;  1UFF A;  4GLK A;  3L2Z A;  1VQN A;  3TSW A;  4C5E A;  1WHL A;  2HEQ A;  1QCF A;  3INZ A;  2I2L A;  5CKF A;  4RTT A;  1BYM A;  5D6W A;  1AWO A;  4M7A G;  1UJ0 A;  2EIF A;  3E9F A;  1X27 A;  1TU0 B;  1QWE A;  4M78 A;  5KYX B;  4GLM A;  1VQ8 A;  1RAE B;  2HSE B;  4M7A B;  1KSW A;  4N4I A;  1OZ2 A;  3JCM J;  2MIO A;  2AKK A;  4C8Q A;  2JT4 A;  2QDY B;  3GLX A;  1WXU A;  2D6F A;  3VUZ A;  2LJ1 A;  2FB7 A;  2VC8 A;  4LDW A;  4DBF A;  2DFU A;  2ROT A;  4HA8 A;  2XD0 A;  3NTI A;  1RI9 A;  3C0C A;  3JB9 F;  2E12 A;  2RI5 A;  3REB B;  4ATO A;  2VGN A;  2CT3 A;  2O01 E;  5LJ5 f;  4GBQ A;  2NUT A;  1M90 U;  5LJ5 d;  1WNL A;  2YUQ A;  5FWB A;  2K57 A;  3MEV A;  5CIU A;  1YIT A;  2KNB B;  2KXD A;  4EMK A;  2QA4 Q;  1PSF A;  1OX8 A;  2W0Z A;  3EH2 A;  3IQL A;  2EJG A;  3UPU A;  4CC3 A;  4BE1 A;  4FIB A;  4OB3 B;  4C0Z A;  5CR2 A;  1M90 C;  1EX4 A;  1WHK A;  1UE9 A;  3CCU A;  4C92 A;  1I0C A;  5I2S A;  2WSC E;  1G5V A;  4LDU A;  4NS5 A;  3M55 A;  2BE7 D;  1KK7 A;  2K9G A;  4JPB W;  1VQP A;  2QDL A;  4J7F A;  2KAF A;  4OB0 B;  2XIC A;  1Q86 U;  4PJJ A;  2JJ9 A;  2QA4 T;  7AT1 B;  4JS5 A;  2GFA A;  2ROL A;  1YJ9 A;  4RTY A;  2QEX Q;  1N8R R;  3NMZ C;  1H3H A;  1YHQ A;  4HCC A;  4J9D A;  1IHV A;  2LQW A;  1H64 1;  3HHT B;  3VS1 A;  5CKE A;  4QQ6 A;  3JB9 J;  3AHU A;  4LN2 A;  2J05 A;  1Z9Q A;  3JB9 D;  2K7A A;  2RD1 A;  1JJ2 P;  1Q86 C;  1QKX A;  4C8Q E;  2B8A A;  3BDL A;  4LDV A;  2KRN A;  1K9A A;  4PKC C;  3DB3 A;  1AZE A;  3G1J A;  3H0H A;  3M4G A;  3RUX A;  1ZQ1 A;  2EYX A;  1RAF B;  4XU0 A;  1RI0 A;  2YRD A;  4C0G A;  4ZGE B;  4BAC A;  4FT2 A;  4E47 A;  1FWZ A;  1FMK A;  2NYS A;  4HT9 A;  4OB2 B;  4XU2 A;  3C95 A;  1ARK A;  3M54 A;  3F70 A;  2XMF A;  5DM7 R;  3L2R A;  1OPK A;  2DM1 A;  1GL5 A;  2CDT A;  1YWO A;  1NEG A;  5AYF A;  3OW2 A;  5J26 A;  1W70 A;  4A63 B;  4Q5W A;  2MPX C;  1R0B G;  1SF9 A;  3ME9 A;  1VQL A;  1AD5 A;  3I56 A;  2RQW A;  8ATC B;  2MAM A;  1PSE A;  4F14 A;  1Q81 U;  5D6X A;  1PWT A;  5I11 A;  2CH4 A;  2D9T A;  5CVI A;  5IXF A;  2DVE A;  2MYS A;  2RI2 A;  3VKI A;  1M8M A;  1M3B A;  3OB9 A;  1D1A A;  4ZN3 A;  3VRY A;  1GBR A;  4OF1 A;  2I0N A;  4BI8 B;  1I81 A;  2AT1 B;  1E6H A;  1KQS S;  2DET A;  1Q81 C;  2EVR A;  4PLL A;  1M8V A;  5GAO l;  1SSF A;  4M75 A;  1TXQ A;  1VQ5 Q;  1WQW A;  4E2F B;  3S6W A;  3FEO A;  5FU6 C;  3JCM X;  1UJY A;  4WTO B;  1MV0 B;  1GCQ C;  1PD0 A;  2JM8 A;  2LDM A;  3G4S Q;  4ELZ C;  2HMA A;  2A28 A;  4RCC A;  4DQ2 A;  3UA7 A;  4M7A F;  4L6V 5;  2DX1 A;  3PIO A;  1PKS A;  3A1P A;  5GAN 8;  2ZPB B;  3HFO A;  2C0O A;  3LGF A;  2HQE A;  4P5N A;  3VRZ A;  1ZBJ A;  4RMO A;  2EGA A;  2QGF B;  2RM4 A;  5A0G A;  2RQT A;  2GGR A;  5IHK A;  3RES A;  2RMO A;  1MMG A;  3G4S T;  1UTI A;  2H3J A;  2H8H A;  1ABQ A;  1BK2 A;  4QVC A;  1VQO T;  1YWP A;  2R5A A;  3BY7 A;  4M77 A;  2XDD A;  3QDF A;  3FJP A;  3I55 Q;  3CPW S;  4FU6 A;  2K2M A;  2MMP A;  3TVT A;  4DBR A;  2DBM A;  1BB9 A;  2EFI A;  4LXC A;  5I21 A;  1N5Z A;  1Y71 A;  1K76 A;  4J9E A;  5J39 A;  3LGL A;  3RR6 A;  3P8B B;  4N0A A;  4PLI A;  2HQX A;  1WHM A;  5I22 A;  5LJ5 e;  5LJ3 h;  1YI2 A;  2A36 A;  4AFZ C;  3OMG A;  2DF6 A;  1QVG P;  2E5K A;  2FPD A;  3QO3 A;  3A8M B;  3EG1 A;  4B9X A;  3LLR A;  1ZBX A;  1BI0 A;  3OS2 A;  3TU4 K;  1K1Z A;  3G71 A;  3M5A A;  3PIP A;  2XDP A;  1VYV A;  1U5S A;  2LCL A;  3I55 T;  4M7A D;  5IXB A;  1D3B A;  5M9O A;  2C06 A;  4M7D C;  1VQN Q;  2EWN A;  3SWN A;  4BY6 C;  1SKU B;  2EQM A;  3I5S A;  1HK9 A;  3CCE T;  1PCX A;  4D8K A;  2G3R A;  1I4K 1;  1AZG B;  2RNA A;  3CQT A;  4JJC A;  2BZ8 A;  4DOW A;  4F7U G;  2EJ9 A;  1VQ8 Q;  4KUI A;  4O6J A;  4OGC A;  3RER A;  4AFU C;  3OA6 A;  3S3O A;  3JCM g;  2JZ2 A;  2E5Q A;  2DJZ A;  2H3E B;  5EG2 A;  2V1R A;  1YJW A;  1CSK A;  2EQU A;  3L2W A;  4F7U B;  2A08 A;  1Q7Y U;  1BIB A;  3T9N A;  2DXU A;  2KQW A;  1VQN T;  2VUB A;  2V8I A;  1CKB A;  3A8L B;  5GAO r;  3M58 A;  4M7D G;  1OPL A;  2Y4Y A;  5KYW B;  3MKD A;  4EMG A;  2C0I A;  2L8D A;  4WF2 A;  2R57 A;  1KQS A;  3BFM A;  3H41 A;  3OY9 A;  3JCM V;  2X4X A;  4M77 E;  1FYN A;  2VYT A;  3GNF B;  2J7I A;  3LX7 A;  4ANJ A;  2KRS A;  2MF2 A;  1Q7Y C;  4M7D B;  1VQ8 T;  1YIT Q;  3M57 A;  2X35 A;  1UEB A;  4JJD A;  1QVP A;  2PZ1 A;  5GMK i;  2BZX A;  4OMO A;  3CC2 A;  5CQX A;  3C94 A;  2NWM A;  4CC7 A;  2BZY A;  3M0S A;  3CCU Q;  1VOM A;  4E7K A;  1KC8 U;  1J3T A;  1M4Z A;  1W1F A;  1SSH A;  3OBY A;  2HDA A;  1YN8 A;  4KGZ B;  5GAN 5;  3MP1 A;  3HRU A;  2QTV A;  3VS6 A;  3OYH A;  3QZ9 B;  4M78 F;  1YIT T;  1VQP Q;  1VQ6 A;  1TH7 A;  2LX7 A;  2E41 A;  1Q86 R;  2HL5 C;  1JEG A;  5CO7 A;  3OYA A;  2X9H A;  1KC8 C;  2HBW A;  5GJW B;  2JVV A;  1N9S A;  3P8H A;  2YUP A;  3CME A;  1YHQ Q;  3ZEH A;  4JLG A;  3CPF A;  1RAB B;  2C0T A;  2HSP A;  4II1 A;  3KBG A;  3CCR A;  3TEE A;  2EYY A;  1MMN A;  2QXF A;  1SG5 A;  1Y96 A;  4DBQ A;  3CPW A;  2XKO C;  1NM7 A;  2KK4 A;  1OYX A;  2NUP B;  2JTM A;  1VQP T;  5D6Y A;  1VQ7 T;  1QCO A;  4JZ4 A;  4F04 B;  1YJ9 T;  4AT1 B;  2XK0 A;  4JLI A;  2XU8 A;  1YHQ T;  1W2B S;  1CKA A;  2VXE A;  4M7A E;  4AG1 C;  3V7C A;  1G2B A;  1QW1 A;  4EPC A;  2ED0 A;  4C92 F;  2DA9 A;  4FYY B;  1S72 A;  3CCM A;  2P0Q A;  3NFC A;  4ELY C;  1VQL Q;  2MOX A;  2ECZ A;  3CXC S;  4JRQ A;  1D1C A;  4PK4 A;  2CS7 A;  3I56 Q;  2EQK A;  3RIR A;  1MUZ A;  1Q81 R;  1PC0 A;  1MHN A;  2QQS A;  4BE0 A;  4ZN1 A;  1JO8 A;  1Z9Z A;  2OTL A;  3EGX B;  1I8F A;  2COZ A;  3H8Z A;  4F16 A;  2DYB A;  2ESW A;  2HKN A;  4IIO A;  4FW1 A;  2Z0W A;  2MWP A;  2A7Y A;  2OTJ A;  3MP8 A;  3A98 A;  3OW2 S;  2L3Q A;  2DZ9 A;  1M2V A;  4MDX A;  3QZ5 B;  2RHX A;  3UF4 A;  3OYC A;  1UDL A;  3CMA A; 
#chains in the Genus database with same CATH homology
 1VQ4 Q;  1Q82 R;  1QVF P;  1VQ5 Q;  1YIT Q;  1S72 Q;  3CCM Q;  3CCS Q;  2QEX Q;  1YHQ Q;  1N8R R;  1K9M R;  1YIJ Q;  1K73 R;  3CCV Q;  1VQK Q;  3CC7 Q;  3CD6 Q;  1YI2 Q;  3CCE Q;  2OTJ Q;  3CCR Q;  2QA4 Q;  3OW2 P;  3CC4 Q;  3CC2 Q;  1VQM Q;  3CXC P;  1QVG P;  1VQ8 Q;  1VQL Q;  1KQS P;  3CCL Q;  1VQ6 Q;  1VQN Q;  1NJI R;  3I56 Q;  1VQ7 Q;  1VQP Q;  1K8A R;  3CCJ Q;  3G4S Q;  1YJW Q;  1JJ2 P;  3G71 Q;  3CPW P;  3I55 Q;  1W2B P;  1Q81 R;  1KD1 R;  1VQ9 Q;  1Q86 R;  3CCQ Q;  3G6E Q;  3CMA Q;  1YJN Q;  1YJ9 Q;  3CCU Q;  1VQO Q;  1M90 R;  3CME Q;  2OTL Q;  1KC8 R;  1M1K R;  1Q7Y R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...