3G6EQ

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 16
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g6eQ00
1S72Q 1W2BP 1VQ7Q 1YJ9Q 1K73R 3CMAQ 1Q86R 3CPWP 1QVFP 1YIJQ 1VQ9Q 3CC7Q 3CCUQ 1K8AR 1KC8R 3CCJQ 1N8RR 3CMEQ 1Q82R 1M90R 1VQ5Q 1JJ2P 3CCRQ 1VQKQ 1VQOQ 1YJWQ 2OTJQ 3CCSQ 3CCVQ 3CCMQ 2OTLQ 3CXCP 1VQ6Q 1YJNQ 1YHQQ 1YITQ 3I55Q 1Q81R 1QVGP 3I56Q 1VQPQ 1VQLQ 1YI2Q 3CC4Q 1VQNQ 2QA4Q 1KQSP 3CCLQ 3G71Q 1NJIR 1Q7YR 3G6EQ 1K9MR 1KD1R 3G4SQ 3CCEQ 3OW2P 1VQ8Q 1VQMQ 1VQ4Q 2QEXQ 3CC2Q 1M1KR 3CCQQ 3CD6Q
chains in the Genus database with same CATH superfamily
1IO6A 2RJDA 3JCMW 1C6VX 4X1VA 4IUQA 3OYCA 3A8GB 4OB1B 3S3MA 2GTOA 1VQKA 5IN1A 5KE2A 2OI3A 3UDCA 1K9MC 3VRYA 2ECZA 4B9WA 1ZSZC 2BZYA 3V7CA 3ER0A 6AT1B 3NMZC 2EQUA 1K4US 1ZUUA 2EQMA 3HRTA 4C92D 3VV0A 2IVWA 2RPNA 1TG0A 2QQRA 4M78D 3CC4T 1YJ9A 3T9NA 5M9OA 1T3SA 2LC4A 3QWYA 2LDMA 3ZBDA 1NPPA 3EGDA 4C0ZA 2HDAA 3MP6A 2L8DA 3OW2P 1Y07A 2JN0A 2CS7A 3RERA 2XDBA 3CCQA 1XJWB 3JCMd 3PVLA 3FC3A 2WSEE 1G3SA 2EJ9A 2DFUA 4ME7A 3URGA 2GNCA 2PTKA 4ZN1A 1H3HA 1YJWT 1VQNA 1RABB 3RR6A 2FB7A 2RQWA 3V7SA 1Q86C 4CC2A 4Z02A 3ULRB 3MJXA 5GMKl 1QVFP 5KYUA 3CC2T 4KGVB 2XU8A 2QI2A 4KGXB 5FU6B 5GANg 1M5Q1 1M8MA 2KDSA 3CMEA 1YI2Q 3VS1A 1KJWA 4M75D 2D9TA 2RM4A 3V8KA 4E7KA 2RJCA 3CCMT 4M7DF 2CP5A 3CCUA 4M77D 4A4HA 5GAN3 4PLIA 1M4ZA 3CCVQ 1E6GA 2QQ9A 5J26A 4F7UA 3L2ZA 4NS5A 1N8RU 3G71A 1VQMQ 3CD6A 3A8HB 3OQ5A 2P0KA 5EG2A 1MMDA 2HL3A 2J05A 2KRMA 2FO0A 2XI9A 4ELZC 1ZSZA 2LP5A 4XTUA 3ME9A 3C0CA 4JRIA 4QVCA 1PHTA 2ZZDA 4E7LA 4IKFA 2CP3A 5GAN7 4EMHA 3KBGA 2B8AA 1D1BA 4J9GA 5GANj 3TVTA 4DBRA 2EGCA 1YHQT 1TOVA 2LNVA 4B6MA 2M02A 3H9NA 2CYZB 2YSQA 1ZX6A 1AVZC 3OYMA 4QW2A 2V8JA 4JLIA 4BDYA 2ENMA 4C8QF 2DTOA 1D0YA 3P8BB 2KSSA 1HD3A 2A0FB 2EVRA 1W2BA 1UE9A 2HNIA 3NTKA 1BBZA 2LT4A 2AKLA 3NPFA 2COWA 2CZ1B 3L2QA 3CC7A 2P84A 1YITT 1YITA 2MPXC 1WXTA 2AK5A 4ZGJB 3QDRB 1OULA 4ZNXA 2XIDA 4AFQC 4C5EA 2X51A 4ZTFA 3L2RA 1K73U 4J9IA 2V8KA 5C6SA 4ANJA 4J6WA 3M4YA 4X34A 1MMNA 3A8OB 4J9FA 8ATCB 2NUPA 4EMKA 1MMAA 2EPDA 4FT2A 4KUIA 2EJGA 1H641 2M51A 1RAFB 2KRSA 4JRPA 2G3RA 3A8LB 2J6KA 3VS2A 4ATOA 4IURA 1YCSB 5CIUA 1YITQ 3FEOA 2GTJA 2LCSA 2E6NA 3CC4Q 1JJ2A 2FPFA 1RI0A 2YUPA 3E19A 2O2OA 5LJ5e 1KQSA 1XNIA 2KXDA 3M0PA 4A54A 1SKUB 3REAB 3JB9I 2YT6A 2D0NA 3VUBA 2DRMA 3M0TA 5GAOl 3CCRQ 1HXDA 4QKUA 3X20B 1WJSA 3CCLT 1GCQC 3M55A 1ZBXA 3CBPA 1RADB 5GJVB 3RDVA 2E10A 1N27A 4RMOA 1UGSB 2DE0X 3CCEQ 2K6DA 3JB9J 3JB9G 2QYZA 2QXFA 3PFSA 4C8QG 2J7IA 1KFZA 4XK8E 2K9GA 4EPCA 1W70A 2DJZA 3L2WA 4E7HA 2DZCA 2HZYA 2DL4A 2K5FA 2ZAEA 2NUTA 4DOVA 1KSWA 2H3JA 5LJ3e 4PNOA 1I4K1 1PRMC 1SEMA 2GFUA 2LVMA 2LQNA 2EKHA 1YI2T 1BYMA 2LNHB 1VQMA 1D3BB 3RMQA 2QTVA 2PUOB 5L23A 4OMLA 1X75C 3X24B 1BB9A 2L2PA 1N8RR 2DIGA 2LTOA 1ZA2B 5FLXE 3CCMQ 4OB3B 1Q82C 4A63B 1YNZA 2VVKA 4QQ6A 1R8OB 2M1HA 2YUQA 4F04B 3HP9A 4M77C 1I07A 4M75B 3FLGA 3LW5E 4AMCA 1OOTA 1ABQA 1MGQA 4M7AA 4F16A 1PD1A 4VUBA 1PNJA 2YWWA 1OQKA 4C92F 5GAN6 3M53A 2JS0A 2DIQA 1KHCA 4KULA 2OTLA 1VQNT 1WGSA 1AHJB 2EGAA 1IB8A 9ATCB 1QP3A 3G4SQ 1LOJA 3CC2A 2F1LA 4M7DG 3TQ7P 4MDXA 2F5TX 1UUEA 2DL7A 1BI0A 1UJYA 2CZ6B 3JCMb 2KQWA 1KK7A 5GAOq 2OTLQ 3LX7A 3MCAB 1OZ3A 3E2UA 1ZSZB 3I55A 3C95A 2O88A 3CXCA 1X2KA 4FSXA 5CO7A 2ZPHB 4HT8A 2RN8A 1PRLC 4AT1B 1G3WA 5IXFA 2M16A 5CQYA 4EIKA 5AT1B 1K1ZA 1FMVA 3FB9A 3ASKA 4BE2A 2LCLA 1M2VA 3EFOB 2CUDA 1M3BA 2NUTB 2PZ1A 1RAEB 1TXQA 3BDLA 4BACA 4M7DC 2LJ0A 4M75C 1YWPA 3AHUA 1T0HA 1G5VA 1AWOA 3GLXA 2DYBA 1CKAA 4C92E 2L3SA 3M56A 3LGFA 1VQ4A 3GBQA 2DL3A 3E1SA 1N9SA 3OMCA 2Z0WA 4OB0B 2GGRA 2GBQA 2MWPA 2RK1A 4KBMB 2MWOA 5J39A 3GP8A 1NG2A 1VQLQ 4ZGEB 2JS2A 2OJ2A 3CC7T 1JQQA 5LJ3j 3CD6Q 3TEEA 1BKBA 1FXXA 1WXUA 2RJFA 3I55T 2FL7A 5GMKh 2RI3A 2XK0A 1M90R 2HSPA 4M7AC 5J3BA 2LQWA 2DL8A 2RHYA 3FDRA 2RNAA 4FYXB 1AOJA 3CCLA 1OPLA 2SRCA 1YP5A 3I5SA 1VQLT 4FM4B 5FWCA 2V8IA 2VV5A 3NGPA 1U1TA 3PGGA 4LN2A 2MF2A 1H3ZA 4N0AC 1IREB 3HKSA 1OZ2A 4GLKA 2O9VA 2VWFA 3PMTA 1Y71A 2V1RA 3I55Q 1QVGP 2QASA 3JCMQ 3OYLA 3NTIA 1UFFA 2KI7A 1HSQA 1ZLMA 3A8MB 2K2VA 3JCMh 2ZPFB 1N8RC 2EYQA 2R5AA 1B07A 4J6XA 4M7AF 3VS0A 2FG0A 2IG0A 1VQ9Q 4C8QC 1UECA 4PJNA 3GIBA 1MV3A 2CH4A 2YLCA 3RMSA 3EGUA 1MNDA 2ABLA 5CKDA 2RI2A 4DBQA 2DNUA 1MMGA 1Q7YR 2EGEA 1VQ6A 3Q1JA 1C0MA 3OS1A 5IT9E 5DM7R 5LJ5f 3MEUA 4J7FA 1ZBJA 3C94A 4AFUC 2V1QA 1JB0E 1W1FA 2CT3A 3SFMA 4HVWA 5D6XA 1SHFA 4YTLA 3EG3A 3CMAT 4RTZA 1M3CA 3C4SA 4C5GA 2OAWA 1RUWA 5KYYA 3CMET 1VQPQ 1YI2A 1GRIA 3G71Q 3CCST 1EZZB 3OYGA 2K2MA 2M9UA 4IIMA 1WPYA 3A1PA 5KCHA 2F69A 3G4ST 1YIJQ 3CCUQ 4F7UE 1GCQA 1U06A 3OYJA 1Q81C 1OI1A 1YJNQ 3M57A 3VKIA 2LZ6B 1MUZA 4JRKA 1UGPB 1OPKA 3L42A 4PLLA 3OYIA 1KC8U 2MIOA 4JJBA 5GANf 2DKGA 4LXCA 3L2UA 4ZN3A 3OYHA 3E9FA 2K5LA 3QYHB 2BZ8A 2E3IA 2O9SA 3V8JA 3EGXA 8AT1B 2VGNA 2D8JA 1WHLA 4N0AA 2C0TA 3OW2S 2X3WD 5CQXA 2EAYA 1SF9A 3FRNA 3GNGA 4HCBA 2A28A 3LGLA 1YFNA 1YJWQ 2RF0A 5KYWA 1D3BA 3QBYA 1WHJA 2DBMA 4J9EA 1V1CA 4QVDA 3JCMP 1Y96A 4F7UB 1JXOA 1VIEA 5IHNA 1BIBA 2AKKA 3CXCS 2ROTA 3OY9A 4J8OA 4M7AG 3CC7Q 2PVOB 3RESA 4V2SA 5GAN2 2DXCA 2EKOA 2R57A 1VQOA 5KYWB 4KGZB 3VUZA 1JU5C 3QWXX 1NEBA 2A08A 2DEUA 2DAQA 1BIAA 4MMLA 5L8RE 3J7AF 1VQ4Q 4PFZA 4L6V5 1NM7A 3S3OA 1SHGA 1GFDA 2QGGA 1TUCA 5FRNA 2XHCA 3CCVT 4BY6C 4OMPA 3J80E 2FRYA 3CCJQ 2YHTA 1LNXA 3PE0A 1KG1A 1A0NB 1LJOA 5KE3A 1RAAB 4B9XA 4IIOA 1X43A 1X6BA 1JRIA 3CPFA 5IHKA 1XTDA 2GQVA 4EMKC 3M58A 1Q82U 2JW4A 2QDLA 1WDXA 1BCOA 2GQIA 3OYNA 3EG2A 2A37A 1N5ZA 2JM8A 2QAZA 1SG5A 5GMKi 1M2OA 1SRMA 3AT1B 1VQ9T 3WVEB 2SEMA 4XTWA 4PFOA 3CCJA 1VA7A 4J5YA 5GANh 2RH2A 4BUGA 2GFAA 3EHRA 2KY9A 1VQPA 1WJRA 4P5NA 3HHTB 2KE9A 2A3LA 3EFRA 4BD3A 4D8KA 4RG8A 3LWHA 4RTXA 3TSZA 5DLOA 4HXJA 4PJOF 3GOXA 1AT1B 4KT0E 2FPDA 1M3AA 4M78C 1QVFA 2RQRA 2E1HA 3I35A 4XQ3A 1K8AU 1QCOA 1KQSS 3L1AA 5HY6A 1TUGB 2RHUA 2LMJA 2DTIA 1YJWA 4IUTA 3QXEB 5IAYA 3CCMA 1YIJT 1VQ6Q 4DBHA 4PJJA 2X4WA 5LJ3f 2HEQA 7AT1B 3G6EQ 2EYXA 4RCBA 4KRTA 5HK0A 1BCMA 2K3BA 2JUFA 4J9CA 4DEYA 3MPUB 3MP1A 1M2VB 3EFOA 2DVEA 3QKJA 4DQ2A 3BDUA 1S1NA 2ZCFB 2CZ7B 1YWOA 2CGHA 2CH4W 1M1KU 4M78B 2QA4T 2QQAA 4X9CA 2ZPEB 4OMFB 3MP8A 1RAHB 4PJOA 1PSEA 3EG9B 3QDFA 3X28B 4C5HA 1S72Q 4JPBW 3G6ET 2OTJT 2HL5C 3OA6A 4KH0B 2RK2A 3CCRT 1YBYA 4LDWA 1YJNA 1BU1A 5IHIA 3KFVA 1HJDA 4PJOB 1X6GA 4OMMA 3CCET 3TSWA 1Q86U 1JO8A 3M54A 1M8VA 2CUBA 1PWTA 4E47A 4XTVA 1X01A 3MKDA 3L2VA 1IRXA 3LWIA 4A4KA 3VS4A 4C8QE 1S72T 5CVIA 2RJEA 4BY6B 4OGCA 2K7AA 1XOVA 1EX4A 3QJYA 3VYHB 1M1FA 4FW1A 2EWNA 1WXBA 2DVJA 2H3EB 5LJ3d 4DEXA 2LQ8A 4II1A 2DXBA 3SWNB 1D0XA 1IHVA 2NUPB 4EMKB 2YRVA 2E65A 3OYDA 2KVQG 3MEAA 2CP0A 2L5QA 3UPUA 3H8ZA 3EG1A 2JTEA 3PVQA 1WA7A 1BI3A 2QK0A 2KT8A 4RUGA 2GF7A 2DILA 5GANe 1JXMA 2NUZA 4ORZA 4OF1A 4M75G 4D6WA 1YJ9Q 1VQOT 1K76A 1AWJA 3UA7A 1FX7A 3HL8A 1TUDA 3QHSA 1T3LA 4E7IA 3SD4A 2FZCB 1AWXA 2K79A 3EG9A 2FEIA 4M4ZA 2E70A 3LH5A 1PM3A 1KQSP 2PQWA 4E7SA 1HK9A 1I0CA 2CSQA 3LH0A 4XU0A 5IH2A 3DB3A 3HFOA 2AIRB 2J6FA 1VQ7Q 1WIEA 3EGXB 2A36A 5CKFA 2EQIA 2W10A 4M77B 4AFZC 1YJ9T 4A4FA 1JBMA 4O5VA 1VQOQ 3JSCA 4N4IA 1B3QA 1K9AA 2IPOB 3TREA 4C0DC 3UATA 4M77G 2HQHA 1VQ8Q 1GCPA 2KT1A 2JOYA 3EFSA 1X27A 1LVKA 2AT1B 3PTAA 1OU9A 2HMAA 3I56T 2Y90A 1F1BB 2PVGB 3HPWA 3EGDB 1MNEA 4JJNK 2XD0A 4FU6A 4JZ3A 5KYXB 2WSCE 4C8QD 1UGRB 5LJ5g 1BI2A 4KH1B 1N9RA 2CP6A 3WXMB 1VQ6T 1MV0B 2JTFA 3OBYA 5GAOp 4Y91A 5GAMh 4JLGA 4LUEA 5I21A 4F17A 3OYEA 4RKUE 2COZA 4XU3A 4MZMA 3CCRA 2YUOA 1WFWA 5ECAA 4MMKA 3M0RA 5GAN8 3I56Q 1W2BS 2QA4A 1AZEA 2M0YA 2QA4Q 4Q5WA 3RKYA 1JEGA 2KGTA 3ZFJA 2ED1A 3MEWA 2LCCA 2CSIA 3G4SA 1QCFA 2JT4A 4M75F 2FZKB 4LUDA 3OS0A 2D1XA 4M75E 3M5AA 4DBFA 5GAMf 1UDLA 5GANd 4BI4A 2OTJQ 2DM1A 1QQJA 4C92B 4QQDA 1H8KA 1NYFA 4M77E 1XQHA 2RHIA 2X4XA 5C0MA 1M90U 4E7JA 1OX8A 1GXIE 1M1KR 3JB9D 4C92G 2HQEA 3H0HA 2CZ0B 4GLMA 4IUVA 2HAXA 3A5ZB 2R5MA 3QZ5B 2DZ9A 3JAME 3PT9A 4HA8A 2VXEA 1YIJA 2Y4XA 3GNFB 1PC0A 2F2XA 1K0SA 2ED0A 3BY7A 3VS6A 1QWEA 2D0QB 3CXCP 4HT9A 1VQ8A 2RHXA 3D7SB 2MK5A 1M1GA 2I2LA 3THKA 3RUXA 3CMAA 2VYTA 5FWBA 4NL3A 1K0XA 3VU3C 4BDZA 5KCOA 1ARKA 1QWFA 1WLPB 1FMKA 2DX1A 1KD1U 1FYNA 2HKNA 1JJ2P 3VS5A 1KHIA 4A53A 4PL6A 2AZSA 2RO0A 1D1AA 1AEYA 4TVRA 2ESWA 4M78E 2X4JA 1K73R 3H6ZA 1Y0MA 1WQWA 2RD1A 3J81E 1E7OA 1SSHA 2ZPBB 4OMQA 3UA6A 3CMEQ 3META 1Y57A 3QO3A 1VYTA 5KYNA 4XAXB 2HCKA 5CKEA 3R6NA 1NE8A 4R55A 4DA4A 3NFCA 2EQKA 4O6JA 4AG2C 4M7DD 3JCMg 3DLLA 4JS5A 1ZSGA 4N4HA 1O9SA 4A4EA 5GMKm 3ZL7C 3HRSA 2EYYA 1T0JA 2BTTA 2DL5A 2DMOA 1RAGB 1Q81R 4RTWA 2NWMA 5D7UA 1B34A 3R6OA 2D8HA 2GCXA 2RHZA 2KYBA 1EIFA 1QLYA 2L89A 4J7IA 3EH1A 3LYIA 1W2BP 3BE3A 1VQ5T 3C12A 3RIRA 2Y4YA 1TS9A 2KBTA 1QVGA 3FJ5A 2DF6A 2BE9B 2DETA 1M30A 2MI6A 3RKXA 1I8FA 2VGMA 1O75A 1W4SA 3X25B 3SDZA 2L0AA 1RLQC 4LE9A 1NLPC 4M78A 2F5KA 2MCNA 3OW2A 4LDYA 2YUNA 4Y92A 4X9DA 1NEGA 3I9QA 2E4HA 5A0GA 2PU9B 1OYXA 2FRWA 2RQVA 1DJ7B 1VQ5Q 3VS7A 4Z8AA 5CR2A 3CPWS 2EYZA 2OTJA 1RL2A 1IGUA 3M0SA 1VQLA 3M59A 2CP7A 3S6WA 1NJIC 4E2FB 4M75A 3QIIA 4M7AB 1G2BA 4WTOB 2VB6A 2J06A 2O4XA 2R58A 4HVVA 3QZ9B 2P0QA 2YRCA 1TSFA 2CP2A 4L59A 4JJDA 5LJ3h 4E6RA 1QVGS 2EJFA 3QJ6A 2JXBA 3G1JA 3CCJT 5GAMe 3M9QA 2BZXA 2O4XB 4M7DE 4PKCC 1W6XA 1Y96B 5HKCA 3EHQA 2RQTA 2X3XD 1VYVA 1WQ7A 1P92A 4C5IA 1VIFA 3I5RA 2MOXA 5EC7A 2ATCB 4WF2A 2V26A 4HKEA 2VKNA 4JUVA 1PG5B 3TU4K 1PD0A 3H0FA 2MYSA 5I2SA 3JV3A 3V8LA 2CT4A 3CMAQ 4J9HA 1R77A 2C0OA 1EFNA 4LD6A 1IXDA 4FCYA 1Q82R 3G71T 3CCSQ 3EG0A 1GBQA 2VUBA 1OU8A 2RMOA 4IUPA 4CC4B 5KYUB 4FIBA 1CKBA 4M7AE 1UB4A 1ZUYA 3CCUT 1YCYA 1LPLA 1UTIA 3M0UA 5GAN5 2K3XA 2XG8D 1S72A 2RB6A 2JZ2A 5A0LA 5GAMj 5FU7B 3CCVA 1X6OA 1NPRA 2G6FX 2DEQA 1KD1R 1WYXA 1B34B 3GF5A 3N5BB 4ZTJA 2DXUA 2P4TA 5CKHA 1WNLA 3JCMV 2FPEA 2JJ9A 4UC4A 1U8RA 1U3OA 3OSVA 1QP2A 3CPWP 2JM9A 2MAMA 1Q81U 1I5LA 2DYIA 4C0FA 2F2VA 5D6YA 3OYFA 1NZ9A 1VYUA 3JCMc 3G6EA 4RTTA 4M7DB 4HCKA 2KYMA 3CCLQ 1WZOA 2KAFA 1PKSA 1G8XA 1RLPC 1Y7XA 4NL2A 4J9BA 2WACA 5FU7C 5IXBA 1NJIU 2P4RA 1LCKA 2K4YA 3M0QA 5KYXA 2FVUA 4C0GA 1VQKQ 3RBBB 1TH7A 4FL6A 1RACB 2DO3A 3LLRA 4D8DA 3QYGB 2EBPA 2QQBA 2E5QA 4ZGDB 4BI3A 2COYA 4R56A 1D1CA 2IIMA 5I11A 1ZUKA 4JZ4A 2YLBA 2KROA 1Q7YC 2RA2A 4OVAA 3RNJA 1TTHB 1NYGA 4EMGA 1KC8R 5GAOn 1TU0B 4RTYA 3CQTA 2BKDN 4PJOG 1RAIB 1GL5A 1G3TA 1M27C 1QVFS 1IHWA 1VQ4T 4GY5A 2E3HA 3KUFA 2CKKA 1CSKA 4BE0A 3GPLA 3S3NA 2NYSA 4R0KA 5FU6C 4Y28E 2RI5A 1UG1A 4XTXA 1VQ7A 3QSUA 3I56A 3OYKA 1WHKA 3EH2A 3VJPA 3WVDB 4F7UF 2E64A 2DTHA 5KYYB 2DD4A 1K9MR 2HD0A 2LJ3A 2C0IA 3PIOA 2MMPA 1AWWA 2VXFA 3RKWA 4QT7A 1UGQB 3OYBA 2XDDA 1VQ9A 4RTUA 1MHNA 3F70A 4WCIA 4EDUA 5GAMg 1KD1C 2JMCA 5GAMd 3FJPA 1VUBA 5CK9A 4JDSA 2W0ZA 2OTLT 3JB9H 2OAUA 4N4GA 2KRNA 2EIFA 3TCJA 2D6FA 5A2QE 3NHNA 1Z9QA 2KEAA 4FYYB 4JJCA 4XU1A 4QQGA 2F2WA 2LRQA 3MHXA 1I1JA 2C06A 3CBOA 4XU2A 3BFMA 3CCQT 1V29B 5LJ5d 2O01E 4FYVB 1QVPA 2PVDB 2LJ1A 1VQ7T 4BI8B 3VS3A 5LL6S 2LX7A 1K73C 4AG1C 2O31A 3MEVA 4C8QA 3DB4A 4MDWA 1HYOA 1J3TA 3DLMA 2YRDA 1ZHIA 2OX7A 2BUDA 5DLQE 3KXTA 3PNWC 2LQKA 2E6ZA 1VQ8T 4BB7A 1K8AC 1UEBA 5HCKA 2E5KA 3SHWA 1QKXA 2KNBB 2VC8A 1UHFA 2JMAA 3CBMA 2PUKB 4C92C 2DPPB 1OEBA 3UF4A 2DLPA 5A0DA 2K5IA 4PFPA 1QKWA 3SWNA 5CCAA 4NOYA 2HBPA 3E9GA 4M77F 4M77A 2DK3A 1GBRA 5I2MA 3X26B 4DOWA 1I81A 2K3YA 3FIFA 4FSSA 1M1KC 4KUDK 1H92A 2LT1A 4CRIA 2ZPIB 4ELYC 1X69A 2ROLA 1Q95G 5FROA 4LDXA 4QVZA 1KIKA 2E12A 4PK4A 2JNGA 3QPHA 5AYFA 5GAOr 1VQKT 1AD5A 3OS2A 2QEXQ 2K57A 4J83A 4FW2A 1SPKA 1SRLA 3O5ZA 4RTVA 4ESRA 2BIVA 3UWNA 1PKTA 4M7DA 2CREA 3OBWA 4PJOC 3JRZA 4L5GA 3VYGA 4LDUA 2KXCA 3OSSC 2BE7D 1YHQA 2I0NA 2B86A 4JS4A 1N6AA 2CDTA 1WI7A 2XICA 1VQNQ 1NJIR 3HTRA 1BI1A 1TWBA 3QUIA 1G3YA 2HBWA 5LJ5h 2YDLA 1AZGB 2QEXA 2AZVA 4LD9K 1V76A 4FYWB 4K11A 1FWZA 1VQ5A 4OP0A 3HFNA 3P8DA 2FYKA 5GAOm 3OB9A 4F7UG 1BK2A 4A4GA 1PSFA 1D09B 1NBEB 3CEYA 4XTYA 5GAN4 4F14A 5LJ5j 1U1SA 4C92A 1VQPT 3OS5A 4RCCA 2DERA 4OMNA 2HQXA 3PMIA 3SB2A 2KMTA 1Q86R 3QG1A 1KC8C 4PJOD 4PJMA 2X4YA 3JB9F 3CPWA 4BE1A 1WHGA 2XDPA 3JCMe 4LNPA 1OX9A 1U5SA 1FMWA 4CC3A 1RI9A 2JVVA 5GJWB 1KQ2A 1YJNT 3VRZA 4CI0C 4PJOE 2M0OA 4FT4A 2DD5A 1VOMA 4C8QB 3JCMX 3OYYA 4HVUA 2XMFA 2DA9A 1K9MU 2NLUA 2DJQA 1ZA1B 4XTZA 2L3PA 2E41A 3HRUA 1OV3A 2EW3A 3REBB 4E7ZA 3CC2Q 3CCQQ 3INZA 2QG9B 2L3RA 1GFCA 4CC7A 4MZPA 2ZGWA 3EAEA 5GMKe 3M4GA 3ZEHA 5LJ3g 3H41A 2AHJB 5HK3A 3CD6T 1M9SA 1UGVA 1K8AR 2RQUA 2ZPGB 4HCZA 2QGFB 1WHMA 4Z88A 3A98A 4C0DB 3MO8A 2A7YA 4GBQA 3IQLA 3SEMA 4IUUA 2HKQB 1UJ0A 2XKOC 2J6OA 3O8VA 2QDYB 2X9HA 3JCMJ 3V7RA 2DXTA 1SSFA 4AFSC 4RG2A 1E6HA 1ZQ1A 2EFIA 1IGQA 2DRKA 1UHCA 2QQSA 3G7ZA 1JJ2S 2LX9A 3P8HA 4J6YA 3CCSA 1QW1A 3HSBA 1VQMT 3CCEA 5DY9A 2X35A 2KR3A 1I5OB 1D0ZA 2FHDA 1QMCA 3PIPA 2EQJA 2EYWA 2DBKA 2JTMA 2WSFE 3DKMA 4M78F 1IZ6A 3NTHA 1Z9ZA 2VASA 2HSEB 4LDVA 3OMGA 1G83A 5I22A 1QCNA 1Q7YU 5D6WA 5FRMA 4OMOA 4M7AD 1ABOA 3UT1A 2P0PA 1YHQQ 4OB2B 4OGEA 5GMKj 2YXYA 1NLOC 3H0IA 1PCXA 4J9DA 3CC4A 1R0CB 4M78G 1B7TA 2L3QA 1ACMB 4Z89A 3JCMf 1X2QA 4MZTA 5CKBA 2QEXT 1WHHA 2PNIA 5FW9A 3U23A 1WX6A 3OYAA 4HCCA 4PJLA 1R0BG 3BW1A 3SWNC 2FZGB 1WJQA 5KH6A 1M90C 4JRQA 2QTXA 2H8HA 1YN8A 1C1AA 1KQ1A 2KK4A 5CAIA
chains in the Genus database with same CATH topology
1S72Q 1W2BP 1VQ7Q 1YJ9Q 1K73R 3CMAQ 1Q86R 3CPWP 1QVFP 1YIJQ 1VQ9Q 3CC7Q 3CCUQ 1K8AR 1KC8R 3CCJQ 1N8RR 3CMEQ 1Q82R 1M90R 1VQ5Q 1JJ2P 3CCRQ 1VQKQ 1VQOQ 1YJWQ 2OTJQ 3CCSQ 3CCVQ 3CCMQ 2OTLQ 3CXCP 1VQ6Q 1YJNQ 1YHQQ 1YITQ 3I55Q 1Q81R 1QVGP 3I56Q 1VQPQ 1VQLQ 1YI2Q 3CC4Q 1VQNQ 2QA4Q 1KQSP 3CCLQ 3G71Q 1NJIR 1Q7YR 3G6EQ 1K9MR 1KD1R 3G4SQ 3CCEQ 3OW2P 1VQ8Q 1VQMQ 1VQ4Q 2QEXQ 3CC2Q 1M1KR 3CCQQ 3CD6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 Q;  1W2B P;  1VQ7 Q;  1YJ9 Q;  1K73 R;  3CMA Q;  1Q86 R;  3CPW P;  1QVF P;  1YIJ Q;  1VQ9 Q;  3CC7 Q;  3CCU Q;  1K8A R;  1KC8 R;  3CCJ Q;  1N8R R;  3CME Q;  1Q82 R;  1M90 R;  1VQ5 Q;  1JJ2 P;  3CCR Q;  1VQK Q;  1VQO Q;  1YJW Q;  2OTJ Q;  3CCS Q;  3CCV Q;  3CCM Q;  2OTL Q;  3CXC P;  1VQ6 Q;  1YJN Q;  1YHQ Q;  1YIT Q;  3I55 Q;  1Q81 R;  1QVG P;  3I56 Q;  1VQP Q;  1VQL Q;  1YI2 Q;  3CC4 Q;  1VQN Q;  2QA4 Q;  1KQS P;  3CCL Q;  3G71 Q;  1NJI R;  1Q7Y R;  3G6E Q;  1K9M R;  1KD1 R;  3G4S Q;  3CCE Q;  3OW2 P;  1VQ8 Q;  1VQM Q;  1VQ4 Q;  2QEX Q;  3CC2 Q;  1M1K R;  3CCQ Q;  3CD6 Q; 
#chains in the Genus database with same CATH topology
 1IO6 A;  2RJD A;  3JCM W;  1C6V X;  4X1V A;  4IUQ A;  3OYC A;  3A8G B;  4OB1 B;  3S3M A;  2GTO A;  1VQK A;  5IN1 A;  5KE2 A;  2OI3 A;  3UDC A;  1K9M C;  3VRY A;  2ECZ A;  4B9W A;  1ZSZ C;  2BZY A;  3V7C A;  3ER0 A;  6AT1 B;  3NMZ C;  2EQU A;  1K4U S;  1ZUU A;  2EQM A;  3HRT A;  4C92 D;  3VV0 A;  2IVW A;  2RPN A;  1TG0 A;  2QQR A;  4M78 D;  3CC4 T;  1YJ9 A;  3T9N A;  5M9O A;  1T3S A;  2LC4 A;  3QWY A;  2LDM A;  3ZBD A;  1NPP A;  3EGD A;  4C0Z A;  2HDA A;  3MP6 A;  2L8D A;  3OW2 P;  1Y07 A;  2JN0 A;  2CS7 A;  3RER A;  2XDB A;  3CCQ A;  1XJW B;  3JCM d;  3PVL A;  3FC3 A;  2WSE E;  1G3S A;  2EJ9 A;  2DFU A;  4ME7 A;  3URG A;  2GNC A;  2PTK A;  4ZN1 A;  1H3H A;  1YJW T;  1VQN A;  1RAB B;  3RR6 A;  2FB7 A;  2RQW A;  3V7S A;  1Q86 C;  4CC2 A;  4Z02 A;  3ULR B;  3MJX A;  5GMK l;  1QVF P;  5KYU A;  3CC2 T;  4KGV B;  2XU8 A;  2QI2 A;  4KGX B;  5FU6 B;  5GAN g;  1M5Q 1;  1M8M A;  2KDS A;  3CME A;  1YI2 Q;  3VS1 A;  1KJW A;  4M75 D;  2D9T A;  2RM4 A;  3V8K A;  4E7K A;  2RJC A;  3CCM T;  4M7D F;  2CP5 A;  3CCU A;  4M77 D;  4A4H A;  5GAN 3;  4PLI A;  1M4Z A;  3CCV Q;  1E6G A;  2QQ9 A;  5J26 A;  4F7U A;  3L2Z A;  4NS5 A;  1N8R U;  3G71 A;  1VQM Q;  3CD6 A;  3A8H B;  3OQ5 A;  2P0K A;  5EG2 A;  1MMD A;  2HL3 A;  2J05 A;  2KRM A;  2FO0 A;  2XI9 A;  4ELZ C;  1ZSZ A;  2LP5 A;  4XTU A;  3ME9 A;  3C0C A;  4JRI A;  4QVC A;  1PHT A;  2ZZD A;  4E7L A;  4IKF A;  2CP3 A;  5GAN 7;  4EMH A;  3KBG A;  2B8A A;  1D1B A;  4J9G A;  5GAN j;  3TVT A;  4DBR A;  2EGC A;  1YHQ T;  1TOV A;  2LNV A;  4B6M A;  2M02 A;  3H9N A;  2CYZ B;  2YSQ A;  1ZX6 A;  1AVZ C;  3OYM A;  4QW2 A;  2V8J A;  4JLI A;  4BDY A;  2ENM A;  4C8Q F;  2DTO A;  1D0Y A;  3P8B B;  2KSS A;  1HD3 A;  2A0F B;  2EVR A;  1W2B A;  1UE9 A;  2HNI A;  3NTK A;  1BBZ A;  2LT4 A;  2AKL A;  3NPF A;  2COW A;  2CZ1 B;  3L2Q A;  3CC7 A;  2P84 A;  1YIT T;  1YIT A;  2MPX C;  1WXT A;  2AK5 A;  4ZGJ B;  3QDR B;  1OUL A;  4ZNX A;  2XID A;  4AFQ C;  4C5E A;  2X51 A;  4ZTF A;  3L2R A;  1K73 U;  4J9I A;  2V8K A;  5C6S A;  4ANJ A;  4J6W A;  3M4Y A;  4X34 A;  1MMN A;  3A8O B;  4J9F A;  8ATC B;  2NUP A;  4EMK A;  1MMA A;  2EPD A;  4FT2 A;  4KUI A;  2EJG A;  1H64 1;  2M51 A;  1RAF B;  2KRS A;  4JRP A;  2G3R A;  3A8L B;  2J6K A;  3VS2 A;  4ATO A;  4IUR A;  1YCS B;  5CIU A;  1YIT Q;  3FEO A;  2GTJ A;  2LCS A;  2E6N A;  3CC4 Q;  1JJ2 A;  2FPF A;  1RI0 A;  2YUP A;  3E19 A;  2O2O A;  5LJ5 e;  1KQS A;  1XNI A;  2KXD A;  3M0P A;  4A54 A;  1SKU B;  3REA B;  3JB9 I;  2YT6 A;  2D0N A;  3VUB A;  2DRM A;  3M0T A;  5GAO l;  3CCR Q;  1HXD A;  4QKU A;  3X20 B;  1WJS A;  3CCL T;  1GCQ C;  3M55 A;  1ZBX A;  3CBP A;  1RAD B;  5GJV B;  3RDV A;  2E10 A;  1N27 A;  4RMO A;  1UGS B;  2DE0 X;  3CCE Q;  2K6D A;  3JB9 J;  3JB9 G;  2QYZ A;  2QXF A;  3PFS A;  4C8Q G;  2J7I A;  1KFZ A;  4XK8 E;  2K9G A;  4EPC A;  1W70 A;  2DJZ A;  3L2W A;  4E7H A;  2DZC A;  2HZY A;  2DL4 A;  2K5F A;  2ZAE A;  2NUT A;  4DOV A;  1KSW A;  2H3J A;  5LJ3 e;  4PNO A;  1I4K 1;  1PRM C;  1SEM A;  2GFU A;  2LVM A;  2LQN A;  2EKH A;  1YI2 T;  1BYM A;  2LNH B;  1VQM A;  1D3B B;  3RMQ A;  2QTV A;  2PUO B;  5L23 A;  4OML A;  1X75 C;  3X24 B;  1BB9 A;  2L2P A;  1N8R R;  2DIG A;  2LTO A;  1ZA2 B;  5FLX E;  3CCM Q;  4OB3 B;  1Q82 C;  4A63 B;  1YNZ A;  2VVK A;  4QQ6 A;  1R8O B;  2M1H A;  2YUQ A;  4F04 B;  3HP9 A;  4M77 C;  1I07 A;  4M75 B;  3FLG A;  3LW5 E;  4AMC A;  1OOT A;  1ABQ A;  1MGQ A;  4M7A A;  4F16 A;  1PD1 A;  4VUB A;  1PNJ A;  2YWW A;  1OQK A;  4C92 F;  5GAN 6;  3M53 A;  2JS0 A;  2DIQ A;  1KHC A;  4KUL A;  2OTL A;  1VQN T;  1WGS A;  1AHJ B;  2EGA A;  1IB8 A;  9ATC B;  1QP3 A;  3G4S Q;  1LOJ A;  3CC2 A;  2F1L A;  4M7D G;  3TQ7 P;  4MDX A;  2F5T X;  1UUE A;  2DL7 A;  1BI0 A;  1UJY A;  2CZ6 B;  3JCM b;  2KQW A;  1KK7 A;  5GAO q;  2OTL Q;  3LX7 A;  3MCA B;  1OZ3 A;  3E2U A;  1ZSZ B;  3I55 A;  3C95 A;  2O88 A;  3CXC A;  1X2K A;  4FSX A;  5CO7 A;  2ZPH B;  4HT8 A;  2RN8 A;  1PRL C;  4AT1 B;  1G3W A;  5IXF A;  2M16 A;  5CQY A;  4EIK A;  5AT1 B;  1K1Z A;  1FMV A;  3FB9 A;  3ASK A;  4BE2 A;  2LCL A;  1M2V A;  3EFO B;  2CUD A;  1M3B A;  2NUT B;  2PZ1 A;  1RAE B;  1TXQ A;  3BDL A;  4BAC A;  4M7D C;  2LJ0 A;  4M75 C;  1YWP A;  3AHU A;  1T0H A;  1G5V A;  1AWO A;  3GLX A;  2DYB A;  1CKA A;  4C92 E;  2L3S A;  3M56 A;  3LGF A;  1VQ4 A;  3GBQ A;  2DL3 A;  3E1S A;  1N9S A;  3OMC A;  2Z0W A;  4OB0 B;  2GGR A;  2GBQ A;  2MWP A;  2RK1 A;  4KBM B;  2MWO A;  5J39 A;  3GP8 A;  1NG2 A;  1VQL Q;  4ZGE B;  2JS2 A;  2OJ2 A;  3CC7 T;  1JQQ A;  5LJ3 j;  3CD6 Q;  3TEE A;  1BKB A;  1FXX A;  1WXU A;  2RJF A;  3I55 T;  2FL7 A;  5GMK h;  2RI3 A;  2XK0 A;  1M90 R;  2HSP A;  4M7A C;  5J3B A;  2LQW A;  2DL8 A;  2RHY A;  3FDR A;  2RNA A;  4FYX B;  1AOJ A;  3CCL A;  1OPL A;  2SRC A;  1YP5 A;  3I5S A;  1VQL T;  4FM4 B;  5FWC A;  2V8I A;  2VV5 A;  3NGP A;  1U1T A;  3PGG A;  4LN2 A;  2MF2 A;  1H3Z A;  4N0A C;  1IRE B;  3HKS A;  1OZ2 A;  4GLK A;  2O9V A;  2VWF A;  3PMT A;  1Y71 A;  2V1R A;  3I55 Q;  1QVG P;  2QAS A;  3JCM Q;  3OYL A;  3NTI A;  1UFF A;  2KI7 A;  1HSQ A;  1ZLM A;  3A8M B;  2K2V A;  3JCM h;  2ZPF B;  1N8R C;  2EYQ A;  2R5A A;  1B07 A;  4J6X A;  4M7A F;  3VS0 A;  2FG0 A;  2IG0 A;  1VQ9 Q;  4C8Q C;  1UEC A;  4PJN A;  3GIB A;  1MV3 A;  2CH4 A;  2YLC A;  3RMS A;  3EGU A;  1MND A;  2ABL A;  5CKD A;  2RI2 A;  4DBQ A;  2DNU A;  1MMG A;  1Q7Y R;  2EGE A;  1VQ6 A;  3Q1J A;  1C0M A;  3OS1 A;  5IT9 E;  5DM7 R;  5LJ5 f;  3MEU A;  4J7F A;  1ZBJ A;  3C94 A;  4AFU C;  2V1Q A;  1JB0 E;  1W1F A;  2CT3 A;  3SFM A;  4HVW A;  5D6X A;  1SHF A;  4YTL A;  3EG3 A;  3CMA T;  4RTZ A;  1M3C A;  3C4S A;  4C5G A;  2OAW A;  1RUW A;  5KYY A;  3CME T;  1VQP Q;  1YI2 A;  1GRI A;  3G71 Q;  3CCS T;  1EZZ B;  3OYG A;  2K2M A;  2M9U A;  4IIM A;  1WPY A;  3A1P A;  5KCH A;  2F69 A;  3G4S T;  1YIJ Q;  3CCU Q;  4F7U E;  1GCQ A;  1U06 A;  3OYJ A;  1Q81 C;  1OI1 A;  1YJN Q;  3M57 A;  3VKI A;  2LZ6 B;  1MUZ A;  4JRK A;  1UGP B;  1OPK A;  3L42 A;  4PLL A;  3OYI A;  1KC8 U;  2MIO A;  4JJB A;  5GAN f;  2DKG A;  4LXC A;  3L2U A;  4ZN3 A;  3OYH A;  3E9F A;  2K5L A;  3QYH B;  2BZ8 A;  2E3I A;  2O9S A;  3V8J A;  3EGX A;  8AT1 B;  2VGN A;  2D8J A;  1WHL A;  4N0A A;  2C0T A;  3OW2 S;  2X3W D;  5CQX A;  2EAY A;  1SF9 A;  3FRN A;  3GNG A;  4HCB A;  2A28 A;  3LGL A;  1YFN A;  1YJW Q;  2RF0 A;  5KYW A;  1D3B A;  3QBY A;  1WHJ A;  2DBM A;  4J9E A;  1V1C A;  4QVD A;  3JCM P;  1Y96 A;  4F7U B;  1JXO A;  1VIE A;  5IHN A;  1BIB A;  2AKK A;  3CXC S;  2ROT A;  3OY9 A;  4J8O A;  4M7A G;  3CC7 Q;  2PVO B;  3RES A;  4V2S A;  5GAN 2;  2DXC A;  2EKO A;  2R57 A;  1VQO A;  5KYW B;  4KGZ B;  3VUZ A;  1JU5 C;  3QWX X;  1NEB A;  2A08 A;  2DEU A;  2DAQ A;  1BIA A;  4MML A;  5L8R E;  3J7A F;  1VQ4 Q;  4PFZ A;  4L6V 5;  1NM7 A;  3S3O A;  1SHG A;  1GFD A;  2QGG A;  1TUC A;  5FRN A;  2XHC A;  3CCV T;  4BY6 C;  4OMP A;  3J80 E;  2FRY A;  3CCJ Q;  2YHT A;  1LNX A;  3PE0 A;  1KG1 A;  1A0N B;  1LJO A;  5KE3 A;  1RAA B;  4B9X A;  4IIO A;  1X43 A;  1X6B A;  1JRI A;  3CPF A;  5IHK A;  1XTD A;  2GQV A;  4EMK C;  3M58 A;  1Q82 U;  2JW4 A;  2QDL A;  1WDX A;  1BCO A;  2GQI A;  3OYN A;  3EG2 A;  2A37 A;  1N5Z A;  2JM8 A;  2QAZ A;  1SG5 A;  5GMK i;  1M2O A;  1SRM A;  3AT1 B;  1VQ9 T;  3WVE B;  2SEM A;  4XTW A;  4PFO A;  3CCJ A;  1VA7 A;  4J5Y A;  5GAN h;  2RH2 A;  4BUG A;  2GFA A;  3EHR A;  2KY9 A;  1VQP A;  1WJR A;  4P5N A;  3HHT B;  2KE9 A;  2A3L A;  3EFR A;  4BD3 A;  4D8K A;  4RG8 A;  3LWH A;  4RTX A;  3TSZ A;  5DLO A;  4HXJ A;  4PJO F;  3GOX A;  1AT1 B;  4KT0 E;  2FPD A;  1M3A A;  4M78 C;  1QVF A;  2RQR A;  2E1H A;  3I35 A;  4XQ3 A;  1K8A U;  1QCO A;  1KQS S;  3L1A A;  5HY6 A;  1TUG B;  2RHU A;  2LMJ A;  2DTI A;  1YJW A;  4IUT A;  3QXE B;  5IAY A;  3CCM A;  1YIJ T;  1VQ6 Q;  4DBH A;  4PJJ A;  2X4W A;  5LJ3 f;  2HEQ A;  7AT1 B;  3G6E Q;  2EYX A;  4RCB A;  4KRT A;  5HK0 A;  1BCM A;  2K3B A;  2JUF A;  4J9C A;  4DEY A;  3MPU B;  3MP1 A;  1M2V B;  3EFO A;  2DVE A;  3QKJ A;  4DQ2 A;  3BDU A;  1S1N A;  2ZCF B;  2CZ7 B;  1YWO A;  2CGH A;  2CH4 W;  1M1K U;  4M78 B;  2QA4 T;  2QQA A;  4X9C A;  2ZPE B;  4OMF B;  3MP8 A;  1RAH B;  4PJO A;  1PSE A;  3EG9 B;  3QDF A;  3X28 B;  4C5H A;  1S72 Q;  4JPB W;  3G6E T;  2OTJ T;  2HL5 C;  3OA6 A;  4KH0 B;  2RK2 A;  3CCR T;  1YBY A;  4LDW A;  1YJN A;  1BU1 A;  5IHI A;  3KFV A;  1HJD A;  4PJO B;  1X6G A;  4OMM A;  3CCE T;  3TSW A;  1Q86 U;  1JO8 A;  3M54 A;  1M8V A;  2CUB A;  1PWT A;  4E47 A;  4XTV A;  1X01 A;  3MKD A;  3L2V A;  1IRX A;  3LWI A;  4A4K A;  3VS4 A;  4C8Q E;  1S72 T;  5CVI A;  2RJE A;  4BY6 B;  4OGC A;  2K7A A;  1XOV A;  1EX4 A;  3QJY A;  3VYH B;  1M1F A;  4FW1 A;  2EWN A;  1WXB A;  2DVJ A;  2H3E B;  5LJ3 d;  4DEX A;  2LQ8 A;  4II1 A;  2DXB A;  3SWN B;  1D0X A;  1IHV A;  2NUP B;  4EMK B;  2YRV A;  2E65 A;  3OYD A;  2KVQ G;  3MEA A;  2CP0 A;  2L5Q A;  3UPU A;  3H8Z A;  3EG1 A;  2JTE A;  3PVQ A;  1WA7 A;  1BI3 A;  2QK0 A;  2KT8 A;  4RUG A;  2GF7 A;  2DIL A;  5GAN e;  1JXM A;  2NUZ A;  4ORZ A;  4OF1 A;  4M75 G;  4D6W A;  1YJ9 Q;  1VQO T;  1K76 A;  1AWJ A;  3UA7 A;  1FX7 A;  3HL8 A;  1TUD A;  3QHS A;  1T3L A;  4E7I A;  3SD4 A;  2FZC B;  1AWX A;  2K79 A;  3EG9 A;  2FEI A;  4M4Z A;  2E70 A;  3LH5 A;  1PM3 A;  1KQS P;  2PQW A;  4E7S A;  1HK9 A;  1I0C A;  2CSQ A;  3LH0 A;  4XU0 A;  5IH2 A;  3DB3 A;  3HFO A;  2AIR B;  2J6F A;  1VQ7 Q;  1WIE A;  3EGX B;  2A36 A;  5CKF A;  2EQI A;  2W10 A;  4M77 B;  4AFZ C;  1YJ9 T;  4A4F A;  1JBM A;  4O5V A;  1VQO Q;  3JSC A;  4N4I A;  1B3Q A;  1K9A A;  2IPO B;  3TRE A;  4C0D C;  3UAT A;  4M77 G;  2HQH A;  1VQ8 Q;  1GCP A;  2KT1 A;  2JOY A;  3EFS A;  1X27 A;  1LVK A;  2AT1 B;  3PTA A;  1OU9 A;  2HMA A;  3I56 T;  2Y90 A;  1F1B B;  2PVG B;  3HPW A;  3EGD B;  1MNE A;  4JJN K;  2XD0 A;  4FU6 A;  4JZ3 A;  5KYX B;  2WSC E;  4C8Q D;  1UGR B;  5LJ5 g;  1BI2 A;  4KH1 B;  1N9R A;  2CP6 A;  3WXM B;  1VQ6 T;  1MV0 B;  2JTF A;  3OBY A;  5GAO p;  4Y91 A;  5GAM h;  4JLG A;  4LUE A;  5I21 A;  4F17 A;  3OYE A;  4RKU E;  2COZ A;  4XU3 A;  4MZM A;  3CCR A;  2YUO A;  1WFW A;  5ECA A;  4MMK A;  3M0R A;  5GAN 8;  3I56 Q;  1W2B S;  2QA4 A;  1AZE A;  2M0Y A;  2QA4 Q;  4Q5W A;  3RKY A;  1JEG A;  2KGT A;  3ZFJ A;  2ED1 A;  3MEW A;  2LCC A;  2CSI A;  3G4S A;  1QCF A;  2JT4 A;  4M75 F;  2FZK B;  4LUD A;  3OS0 A;  2D1X A;  4M75 E;  3M5A A;  4DBF A;  5GAM f;  1UDL A;  5GAN d;  4BI4 A;  2OTJ Q;  2DM1 A;  1QQJ A;  4C92 B;  4QQD A;  1H8K A;  1NYF A;  4M77 E;  1XQH A;  2RHI A;  2X4X A;  5C0M A;  1M90 U;  4E7J A;  1OX8 A;  1GXI E;  1M1K R;  3JB9 D;  4C92 G;  2HQE A;  3H0H A;  2CZ0 B;  4GLM A;  4IUV A;  2HAX A;  3A5Z B;  2R5M A;  3QZ5 B;  2DZ9 A;  3JAM E;  3PT9 A;  4HA8 A;  2VXE A;  1YIJ A;  2Y4X A;  3GNF B;  1PC0 A;  2F2X A;  1K0S A;  2ED0 A;  3BY7 A;  3VS6 A;  1QWE A;  2D0Q B;  3CXC P;  4HT9 A;  1VQ8 A;  2RHX A;  3D7S B;  2MK5 A;  1M1G A;  2I2L A;  3THK A;  3RUX A;  3CMA A;  2VYT A;  5FWB A;  4NL3 A;  1K0X A;  3VU3 C;  4BDZ A;  5KCO A;  1ARK A;  1QWF A;  1WLP B;  1FMK A;  2DX1 A;  1KD1 U;  1FYN A;  2HKN A;  1JJ2 P;  3VS5 A;  1KHI A;  4A53 A;  4PL6 A;  2AZS A;  2RO0 A;  1D1A A;  1AEY A;  4TVR A;  2ESW A;  4M78 E;  2X4J A;  1K73 R;  3H6Z A;  1Y0M A;  1WQW A;  2RD1 A;  3J81 E;  1E7O A;  1SSH A;  2ZPB B;  4OMQ A;  3UA6 A;  3CME Q;  3MET A;  1Y57 A;  3QO3 A;  1VYT A;  5KYN A;  4XAX B;  2HCK A;  5CKE A;  3R6N A;  1NE8 A;  4R55 A;  4DA4 A;  3NFC A;  2EQK A;  4O6J A;  4AG2 C;  4M7D D;  3JCM g;  3DLL A;  4JS5 A;  1ZSG A;  4N4H A;  1O9S A;  4A4E A;  5GMK m;  3ZL7 C;  3HRS A;  2EYY A;  1T0J A;  2BTT A;  2DL5 A;  2DMO A;  1RAG B;  1Q81 R;  4RTW A;  2NWM A;  5D7U A;  1B34 A;  3R6O A;  2D8H A;  2GCX A;  2RHZ A;  2KYB A;  1EIF A;  1QLY A;  2L89 A;  4J7I A;  3EH1 A;  3LYI A;  1W2B P;  3BE3 A;  1VQ5 T;  3C12 A;  3RIR A;  2Y4Y A;  1TS9 A;  2KBT A;  1QVG A;  3FJ5 A;  2DF6 A;  2BE9 B;  2DET A;  1M30 A;  2MI6 A;  3RKX A;  1I8F A;  2VGM A;  1O75 A;  1W4S A;  3X25 B;  3SDZ A;  2L0A A;  1RLQ C;  4LE9 A;  1NLP C;  4M78 A;  2F5K A;  2MCN A;  3OW2 A;  4LDY A;  2YUN A;  4Y92 A;  4X9D A;  1NEG A;  3I9Q A;  2E4H A;  5A0G A;  2PU9 B;  1OYX A;  2FRW A;  2RQV A;  1DJ7 B;  1VQ5 Q;  3VS7 A;  4Z8A A;  5CR2 A;  3CPW S;  2EYZ A;  2OTJ A;  1RL2 A;  1IGU A;  3M0S A;  1VQL A;  3M59 A;  2CP7 A;  3S6W A;  1NJI C;  4E2F B;  4M75 A;  3QII A;  4M7A B;  1G2B A;  4WTO B;  2VB6 A;  2J06 A;  2O4X A;  2R58 A;  4HVV A;  3QZ9 B;  2P0Q A;  2YRC A;  1TSF A;  2CP2 A;  4L59 A;  4JJD A;  5LJ3 h;  4E6R A;  1QVG S;  2EJF A;  3QJ6 A;  2JXB A;  3G1J A;  3CCJ T;  5GAM e;  3M9Q A;  2BZX A;  2O4X B;  4M7D E;  4PKC C;  1W6X A;  1Y96 B;  5HKC A;  3EHQ A;  2RQT A;  2X3X D;  1VYV A;  1WQ7 A;  1P92 A;  4C5I A;  1VIF A;  3I5R A;  2MOX A;  5EC7 A;  2ATC B;  4WF2 A;  2V26 A;  4HKE A;  2VKN A;  4JUV A;  1PG5 B;  3TU4 K;  1PD0 A;  3H0F A;  2MYS A;  5I2S A;  3JV3 A;  3V8L A;  2CT4 A;  3CMA Q;  4J9H A;  1R77 A;  2C0O A;  1EFN A;  4LD6 A;  1IXD A;  4FCY A;  1Q82 R;  3G71 T;  3CCS Q;  3EG0 A;  1GBQ A;  2VUB A;  1OU8 A;  2RMO A;  4IUP A;  4CC4 B;  5KYU B;  4FIB A;  1CKB A;  4M7A E;  1UB4 A;  1ZUY A;  3CCU T;  1YCY A;  1LPL A;  1UTI A;  3M0U A;  5GAN 5;  2K3X A;  2XG8 D;  1S72 A;  2RB6 A;  2JZ2 A;  5A0L A;  5GAM j;  5FU7 B;  3CCV A;  1X6O A;  1NPR A;  2G6F X;  2DEQ A;  1KD1 R;  1WYX A;  1B34 B;  3GF5 A;  3N5B B;  4ZTJ A;  2DXU A;  2P4T A;  5CKH A;  1WNL A;  3JCM V;  2FPE A;  2JJ9 A;  4UC4 A;  1U8R A;  1U3O A;  3OSV A;  1QP2 A;  3CPW P;  2JM9 A;  2MAM A;  1Q81 U;  1I5L A;  2DYI A;  4C0F A;  2F2V A;  5D6Y A;  3OYF A;  1NZ9 A;  1VYU A;  3JCM c;  3G6E A;  4RTT A;  4M7D B;  4HCK A;  2KYM A;  3CCL Q;  1WZO A;  2KAF A;  1PKS A;  1G8X A;  1RLP C;  1Y7X A;  4NL2 A;  4J9B A;  2WAC A;  5FU7 C;  5IXB A;  1NJI U;  2P4R A;  1LCK A;  2K4Y A;  3M0Q A;  5KYX A;  2FVU A;  4C0G A;  1VQK Q;  3RBB B;  1TH7 A;  4FL6 A;  1RAC B;  2DO3 A;  3LLR A;  4D8D A;  3QYG B;  2EBP A;  2QQB A;  2E5Q A;  4ZGD B;  4BI3 A;  2COY A;  4R56 A;  1D1C A;  2IIM A;  5I11 A;  1ZUK A;  4JZ4 A;  2YLB A;  2KRO A;  1Q7Y C;  2RA2 A;  4OVA A;  3RNJ A;  1TTH B;  1NYG A;  4EMG A;  1KC8 R;  5GAO n;  1TU0 B;  4RTY A;  3CQT A;  2BKD N;  4PJO G;  1RAI B;  1GL5 A;  1G3T A;  1M27 C;  1QVF S;  1IHW A;  1VQ4 T;  4GY5 A;  2E3H A;  3KUF A;  2CKK A;  1CSK A;  4BE0 A;  3GPL A;  3S3N A;  2NYS A;  4R0K A;  5FU6 C;  4Y28 E;  2RI5 A;  1UG1 A;  4XTX A;  1VQ7 A;  3QSU A;  3I56 A;  3OYK A;  1WHK A;  3EH2 A;  3VJP A;  3WVD B;  4F7U F;  2E64 A;  2DTH A;  5KYY B;  2DD4 A;  1K9M R;  2HD0 A;  2LJ3 A;  2C0I A;  3PIO A;  2MMP A;  1AWW A;  2VXF A;  3RKW A;  4QT7 A;  1UGQ B;  3OYB A;  2XDD A;  1VQ9 A;  4RTU A;  1MHN A;  3F70 A;  4WCI A;  4EDU A;  5GAM g;  1KD1 C;  2JMC A;  5GAM d;  3FJP A;  1VUB A;  5CK9 A;  4JDS A;  2W0Z A;  2OTL T;  3JB9 H;  2OAU A;  4N4G A;  2KRN A;  2EIF A;  3TCJ A;  2D6F A;  5A2Q E;  3NHN A;  1Z9Q A;  2KEA A;  4FYY B;  4JJC A;  4XU1 A;  4QQG A;  2F2W A;  2LRQ A;  3MHX A;  1I1J A;  2C06 A;  3CBO A;  4XU2 A;  3BFM A;  3CCQ T;  1V29 B;  5LJ5 d;  2O01 E;  4FYV B;  1QVP A;  2PVD B;  2LJ1 A;  1VQ7 T;  4BI8 B;  3VS3 A;  5LL6 S;  2LX7 A;  1K73 C;  4AG1 C;  2O31 A;  3MEV A;  4C8Q A;  3DB4 A;  4MDW A;  1HYO A;  1J3T A;  3DLM A;  2YRD A;  1ZHI A;  2OX7 A;  2BUD A;  5DLQ E;  3KXT A;  3PNW C;  2LQK A;  2E6Z A;  1VQ8 T;  4BB7 A;  1K8A C;  1UEB A;  5HCK A;  2E5K A;  3SHW A;  1QKX A;  2KNB B;  2VC8 A;  1UHF A;  2JMA A;  3CBM A;  2PUK B;  4C92 C;  2DPP B;  1OEB A;  3UF4 A;  2DLP A;  5A0D A;  2K5I A;  4PFP A;  1QKW A;  3SWN A;  5CCA A;  4NOY A;  2HBP A;  3E9G A;  4M77 F;  4M77 A;  2DK3 A;  1GBR A;  5I2M A;  3X26 B;  4DOW A;  1I81 A;  2K3Y A;  3FIF A;  4FSS A;  1M1K C;  4KUD K;  1H92 A;  2LT1 A;  4CRI A;  2ZPI B;  4ELY C;  1X69 A;  2ROL A;  1Q95 G;  5FRO A;  4LDX A;  4QVZ A;  1KIK A;  2E12 A;  4PK4 A;  2JNG A;  3QPH A;  5AYF A;  5GAO r;  1VQK T;  1AD5 A;  3OS2 A;  2QEX Q;  2K57 A;  4J83 A;  4FW2 A;  1SPK A;  1SRL A;  3O5Z A;  4RTV A;  4ESR A;  2BIV A;  3UWN A;  1PKT A;  4M7D A;  2CRE A;  3OBW A;  4PJO C;  3JRZ A;  4L5G A;  3VYG A;  4LDU A;  2KXC A;  3OSS C;  2BE7 D;  1YHQ A;  2I0N A;  2B86 A;  4JS4 A;  1N6A A;  2CDT A;  1WI7 A;  2XIC A;  1VQN Q;  1NJI R;  3HTR A;  1BI1 A;  1TWB A;  3QUI A;  1G3Y A;  2HBW A;  5LJ5 h;  2YDL A;  1AZG B;  2QEX A;  2AZV A;  4LD9 K;  1V76 A;  4FYW B;  4K11 A;  1FWZ A;  1VQ5 A;  4OP0 A;  3HFN A;  3P8D A;  2FYK A;  5GAO m;  3OB9 A;  4F7U G;  1BK2 A;  4A4G A;  1PSF A;  1D09 B;  1NBE B;  3CEY A;  4XTY A;  5GAN 4;  4F14 A;  5LJ5 j;  1U1S A;  4C92 A;  1VQP T;  3OS5 A;  4RCC A;  2DER A;  4OMN A;  2HQX A;  3PMI A;  3SB2 A;  2KMT A;  1Q86 R;  3QG1 A;  1KC8 C;  4PJO D;  4PJM A;  2X4Y A;  3JB9 F;  3CPW A;  4BE1 A;  1WHG A;  2XDP A;  3JCM e;  4LNP A;  1OX9 A;  1U5S A;  1FMW A;  4CC3 A;  1RI9 A;  2JVV A;  5GJW B;  1KQ2 A;  1YJN T;  3VRZ A;  4CI0 C;  4PJO E;  2M0O A;  4FT4 A;  2DD5 A;  1VOM A;  4C8Q B;  3JCM X;  3OYY A;  4HVU A;  2XMF A;  2DA9 A;  1K9M U;  2NLU A;  2DJQ A;  1ZA1 B;  4XTZ A;  2L3P A;  2E41 A;  3HRU A;  1OV3 A;  2EW3 A;  3REB B;  4E7Z A;  3CC2 Q;  3CCQ Q;  3INZ A;  2QG9 B;  2L3R A;  1GFC A;  4CC7 A;  4MZP A;  2ZGW A;  3EAE A;  5GMK e;  3M4G A;  3ZEH A;  5LJ3 g;  3H41 A;  2AHJ B;  5HK3 A;  3CD6 T;  1M9S A;  1UGV A;  1K8A R;  2RQU A;  2ZPG B;  4HCZ A;  2QGF B;  1WHM A;  4Z88 A;  3A98 A;  4C0D B;  3MO8 A;  2A7Y A;  4GBQ A;  3IQL A;  3SEM A;  4IUU A;  2HKQ B;  1UJ0 A;  2XKO C;  2J6O A;  3O8V A;  2QDY B;  2X9H A;  3JCM J;  3V7R A;  2DXT A;  1SSF A;  4AFS C;  4RG2 A;  1E6H A;  1ZQ1 A;  2EFI A;  1IGQ A;  2DRK A;  1UHC A;  2QQS A;  3G7Z A;  1JJ2 S;  2LX9 A;  3P8H A;  4J6Y A;  3CCS A;  1QW1 A;  3HSB A;  1VQM T;  3CCE A;  5DY9 A;  2X35 A;  2KR3 A;  1I5O B;  1D0Z A;  2FHD A;  1QMC A;  3PIP A;  2EQJ A;  2EYW A;  2DBK A;  2JTM A;  2WSF E;  3DKM A;  4M78 F;  1IZ6 A;  3NTH A;  1Z9Z A;  2VAS A;  2HSE B;  4LDV A;  3OMG A;  1G83 A;  5I22 A;  1QCN A;  1Q7Y U;  5D6W A;  5FRM A;  4OMO A;  4M7A D;  1ABO A;  3UT1 A;  2P0P A;  1YHQ Q;  4OB2 B;  4OGE A;  5GMK j;  2YXY A;  1NLO C;  3H0I A;  1PCX A;  4J9D A;  3CC4 A;  1R0C B;  4M78 G;  1B7T A;  2L3Q A;  1ACM B;  4Z89 A;  3JCM f;  1X2Q A;  4MZT A;  5CKB A;  2QEX T;  1WHH A;  2PNI A;  5FW9 A;  3U23 A;  1WX6 A;  3OYA A;  4HCC A;  4PJL A;  1R0B G;  3BW1 A;  3SWN C;  2FZG B;  1WJQ A;  5KH6 A;  1M90 C;  4JRQ A;  2QTX A;  2H8H A;  1YN8 A;  1C1A A;  1KQ1 A;  2KK4 A;  5CAI A; 
#chains in the Genus database with same CATH homology
 1S72 Q;  1W2B P;  1VQ7 Q;  1YJ9 Q;  1K73 R;  3CMA Q;  1Q86 R;  3CPW P;  1QVF P;  1YIJ Q;  1VQ9 Q;  3CC7 Q;  3CCU Q;  1K8A R;  1KC8 R;  3CCJ Q;  1N8R R;  3CME Q;  1Q82 R;  1M90 R;  1VQ5 Q;  1JJ2 P;  3CCR Q;  1VQK Q;  1VQO Q;  1YJW Q;  2OTJ Q;  3CCS Q;  3CCV Q;  3CCM Q;  2OTL Q;  3CXC P;  1VQ6 Q;  1YJN Q;  1YHQ Q;  1YIT Q;  3I55 Q;  1Q81 R;  1QVG P;  3I56 Q;  1VQP Q;  1VQL Q;  1YI2 Q;  3CC4 Q;  1VQN Q;  2QA4 Q;  1KQS P;  3CCL Q;  3G71 Q;  1NJI R;  1Q7Y R;  3G6E Q;  1K9M R;  1KD1 R;  3G4S Q;  3CCE Q;  3OW2 P;  1VQ8 Q;  1VQM Q;  1VQ4 Q;  2QEX Q;  3CC2 Q;  1M1K R;  3CCQ Q;  3CD6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...