3G6EQ

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g6eQ00
1JJ2P 3CD6Q 2QA4Q 1M1KR 1VQPQ 1M90R 3CCUQ 1QVGP 3CCEQ 3G71Q 1YJNQ 3OW2P 1Q86R 1NJIR 1Q7YR 1Q82R 1VQNQ 3CCMQ 3I55Q 2QEXQ 3CXCP 1YITQ 1KQSP 1VQKQ 1VQ6Q 3CMEQ 1VQMQ 1K9MR 1YIJQ 2OTJQ 1Q81R 3CMAQ 3CCLQ 3CPWP 1K73R 1N8RR 3G6EQ 1S72Q 1VQLQ 3I56Q 1VQ4Q 3CCSQ 1YJ9Q 3CCJQ 1VQ5Q 1KD1R 1VQOQ 2OTLQ 3CC2Q 1K8AR 3CCVQ 3CCQQ 1VQ7Q 1KC8R 1YI2Q 1W2BP 3G4SQ 3CC4Q 3CCRQ 1YJWQ 3CC7Q 1QVFP 1VQ8Q 1VQ9Q 1YHQQ
chains in the Genus database with same CATH superfamily
3CD6Q 2RO0A 1QQJA 1RUWA 4QT7A 2VV5A 2RHXA 1VQ8T 4XAXB 5KYWA 4JRKA 5L23A 1K8AR 1M1KU 3X28B 4C92B 2RJFA 3M0PA 4ZTFA 1M2VB 1SF9A 5GAOm 2DF6A 3EGDB 2V26A 1F1BB 3JCMP 1G83A 1VQMQ 2LQ8A 2QK0A 4TVRA 3OS1A 2PQWA 3M54A 1YCYA 4J7IA 3A8GB 1I1JA 2ED0A 2D0NA 2EQIA 2MK5A 2X3XD 4Y28E 1ZBXA 4XU2A 3VYGA 4C0DC 1RAAB 1OU9A 3G4ST 2AKKA 2EW3A 1K8AU 2X4YA 4M7AB 4F14A 4DEXA 2FG0A 5GAN6 4OMPA 1M8MA 4QVDA 3OW2S 1M3AA 5CIUA 1KQSS 3VUBA 4EMKA 1Q7YU 1WQWA 2ATCB 3A8HB 1BCOA 1W2BA 1YITQ 3EGXB 2EQUA 4CC4B 3UDCA 1Q86C 3CCMA 1VQ9T 3QIIA 5D6YA 4LDUA 1K4US 2FL7A 2DZ9A 2HSPA 1KJWA 4RCCA 2KYMA 2FPDA 3E9FA 4L6V5 4J9EA 1XNIA 3CCLT 3LGLA 1VQOT 3P8BB 2Z0WA 5LL6S 4FM4B 2VASA 3TSWA 3I5SA 1WA7A 4PFPA 3A98A 3EG9A 1YP5A 2A7YA 3BDLA 4JUVA 2LC4A 1TG0A 3KUFA 2G6FX 3HHTB 3CCRQ 4O5VA 4OMFB 2JT4A 4RTTA 4KH0B 3CC4A 1I07A 4GLKA 4XTUA 4BACA 4J9GA 4M7DE 3QZ5B 1KHCA 2K2VA 3M56A 1FMKA 2JZ2A 1PHTA 1S72Q 2E5QA 4A53A 1WHKA 2BZ8A 4A63B 2FPFA 2DD4A 5FU7B 4J6WA 2QAZA 3EG2A 1X01A 1GBRA 2OX7A 2JOYA 2DKGA 4WF2A 1U06A 2O2OA 1VQ5T 3QZ9B 3CC2T 2QGGA 4FSSA 1WXTA 2KROA 3SEMA 1B34B 3VV0A 5DLOA 3EAEA 2XHCA 1B7TA 1K9MR 1U1TA 3A8LB 1QVFA 1SEMA 2OAWA 5GANg 1YIJA 4IUUA 4BD3A 1AWJA 3OA6A 1VQ6T 1CKAA 1ABOA 5A0GA 3CXCA 4M7DD 1WHGA 1BIAA 8ATCB 2E41A 1WIEA 4PJOB 4XTZA 4FIBA 5GANf 4AT1B 2DXUA 3GNFB 1N9RA 1VQMA 3G6EQ 1K73C 1GCQC 4KULA 4JJDA 5HK3A 1KD1C 1JQQA 3O5ZA 3EFSA 2FZGB 1I81A 1N5ZA 2GNCA 2KMTA 2NUPA 3G7ZA 3HRTA 3JCMd 3VRZA 2K57A 2K5IA 4Y91A 2DXCA 4DEYA 5M9OA 2YWWA 4Z8AA 4E7LA 1Q81C 5D6WA 1V29B 3CCQQ 2ROTA 3C94A 1X6GA 4XTXA 5FU7C 2M9UA 3OYLA 1WI7A 2K6DA 2DERA 1M30A 3JCMb 3EH2A 4F04B 4JRIA 3PT9A 1VQ8A 4M78C 3CCEQ 5CKEA 4NOYA 2O31A 1NG2A 3SB2A 4FYVB 4D6WA 1K0XA 3H0HA 1YITA 4M77B 4LXCA 4PNOA 3LGFA 4RMOA 4J83A 1SHFA 3X25B 2AIRB 1SG5A 2QA4Q 3OYYA 3EG3A 2W0ZA 1XOVA 4PJOC 3UWNA 1ZX6A 4OVAA 2KK4A 2NUTA 5KYUB 1AEYA 1QW1A 1Y07A 1TU0B 4KRTA 2RHUA 1G8XA 3J7AF 2BE7D 4C0FA 3GNGA 2KDSA 4JPBW 4PLLA 4JRQA 3G4SA 3CCRA 3FEOA 1VA7A 2GF7A 3E19A 4K11A 1UJYA 4HVWA 5I22A 3L2VA 2K5LA 3L2QA 3OYHA 4BUGA 2EVRA 2J6FA 2JUFA 3ER0A 2KY9A 1VQPT 1OZ2A 1JJ2A 4M78E 2GTJA 5GAOn 1RAIB 4ZGEB 3OYBA 2AZVA 2F69A 1IZ6A 1MHNA 1CKBA 2CKKA 1RADB 1KG1A 2VYTA 2DEUA 4C92F 3ZL7C 1NE8A 1FWZA 2M1HA 1VQ9A 1YJNQ 2BTTA 1X43A 2LZ6B 1WHJA 2RF0A 3F70A 1U5SA 3RIRA 1OEBA 1G3SA 1OV3A 2J05A 4PJOE 3OSVA 1VQLQ 3CCLA 2I0NA 2JS2A 3LH5A 3A8MB 1VQOA 1AZGB 1YJWQ 3M4YA 3M53A 1GXIE 4M7DG 2KQWA 4A54A 4AG2C 4KGVB 2CZ6B 4Z89A 1U8RA 2L3SA 4BDZA 3M0UA 3VS4A 2JNGA 3RUXA 2RI3A 3G6EA 4M7AF 4J9HA 2DTHA 2OTLA 5L8RE 3LWHA 1YWOA 3JB9D 3SWNB 1QCNA 1K1ZA 2ROLA 3S3NA 3I35A 2DYIA 4J9FA 1PD0A 3G71Q 2DTOA 1BI1A 4MMKA 3I55A 1H641 4HCKA 4FW2A 1TSFA 4BY6C 4ME7A 5GAOq 1H3ZA 5CCAA 4LUEA 1QVGS 1VQ5A 2X4WA 1B07A 3CCQA 1KC8C 3VS0A 2HZYA 3IQLA 2EAYA 2RHYA 3DLMA 5J39A 4JS5A 1WJSA 3A1PA 3EGDA 1N27A 3TQ7P 3V7RA 4FYYB 4E7JA 2ZPFB 2NWMA 5CAIA 1AWXA 4KT0E 2CT3A 3QDFA 3DB4A 2A37A 3OYJA 3SDZA 5KYXB 3JAME 3CCMT 2XDBA 3CC7Q 3T9NA 3JCMf 2KE9A 4NL3A 2YLBA 2L0AA 4XK8E 3OMCA 2R58A 1WJQA 4ZN3A 2QA4A 2RQUA 4QVZA 2CH4W 2EGCA 1ZSGA 1ABQA 2K3YA 2QEXA 2QQ9A 5GAMe 2RK2A 3DKMA 3NMZC 2RK1A 4ZNXA 3JCMh 1BK2A 3SWNC 1M9SA 2CP3A 1GL5A 3JB9I 1QVGP 1QCOA 4RTVA 2HQXA 2YUPA 1UG1A 3GF5A 3CC4T 2HKNA 4OF1A 3EGXA 5AYFA 1NBEB 2E65A 2NYSA 4RTXA 3QWYA 4QKUA 1PCXA 7AT1B 2KGTA 1R0BG 2EQJA 3CCSA 2YRDA 2BE9B 3HTRA 3INZA 1JU5C 2OTJT 4ELZC 2KVQG 4FYXB 2DRMA 3OSSC 4HXJA 2DJQA 2MPXC 3EGUA 3E9GA 1VQNQ 4E2FB 1Y7XA 4FT4A 4XQ3A 2KRNA 2HKQB 4GBQA 5LJ3e 1MMGA 3MP6A 1LOJA 1GCQA 1VQLA 1YI2Q 3RKWA 3MEVA 2RI2A 1BBZA 3A8OB 4Y92A 2RMOA 3PGGA 2M0YA 1Q86U 1SSFA 1M3BA 3A5ZB 1B3QA 3JCMc 1XTDA 2JXBA 5EC7A 3QSUA 2HBPA 2X9HA 5LJ5e 2E5KA 2P84A 2KAFA 2SEMA 3JCMV 5GMKi 1ZUYA 1NYGA 3U23A 2A08A 4M78G 1RLPC 4DBRA 3MO8A 1UE9A 2MMPA 2FEIA 5CQXA 1VYTA 3X20B 2CT4A 2F5TX 1VQMT 1RAHB 5AT1B 4E7HA 1GRIA 4ZTJA 2COZA 3JB9G 2IG0A 4M78A 3GBQA 3Q1JA 1UDLA 1EFNA 2FYKA 2DRKA 4JZ4A 1WHMA 5GAN5 1B34A 2CYZB 4X9CA 5A0DA 2NLUA 4PJOG 1X6OA 1MMDA 1VQ4Q 5KCOA 5GANd 4M77F 1OULA 4A4HA 1PD1A 1JRIA 2KBTA 4F7UB 2F2WA 4II1A 5CKFA 3EG1A 1MUZA 1W4SA 3I9QA 4PJOA 4CC3A 1MNDA 2JTEA 2DEQA 1VQKQ 4ORZA 3CMEQ 1UGSB 1K73R 3ASKA 3VYHB 3OYGA 2QI2A 1KD1R 3VRYA 3MKDA 4JRPA 1P92A 1YITT 1X2KA 2FHDA 2AT1B 2LJ3A 3DB3A 3CC7A 1W1FA 4F17A 5CO7A 1WXUA 4DQ2A 1VIFA 1EIFA 2KT8A 2LJ1A 3EG0A 4A4KA 2OI3A 3QUIA 2CP6A 1Q81R 3BW1A 2B8AA 1W6XA 2AK5A 4OB3B 1NPRA 3M0RA 2X3WD 3UT1A 5CR2A 2EBPA 1YJ9A 1IGQA 2WSEE 1QLYA 4XU0A 1RI9A 2D8HA 2LRQA 1VUBA 1KSWA 1K73U 3D7SB 5KYYB 3ZFJA 1HK9A 1K9AA 3OBYA 2DFUA 2HEQA 3QG1A 3NGPA 3CCRT 1D3BB 1W2BS 1KD1U 3TVTA 3E1SA 2CZ0B 2E64A 4J9DA 1TUGB 3CEYA 2DILA 3JB9H 1D0XA 2WSFE 2H8HA 3H0IA 3MEAA 1E7OA 3OS0A 2L5QA 2LCSA 4XTWA 2GFUA 2EYYA 4M75B 1Y96B 1S72T 4LUDA 4X9DA 4E7KA 5GAMg 1M90C 5KYUA 2HSEB 1VQNA 4JJNK 4DOWA 1UB4A 3AHUA 1RI0A 2LNVA 3M4GA 5ECAA 4C92C 4OB0B 4WCIA 3I5RA 1UGVA 2QXFA 4HA8A 4MMLA 2AKLA 3JCMX 1LJOA 3QPHA 5I21A 1IHVA 4IUVA 2BZYA 3WVEB 1T3LA 4C8QB 3MPUB 4PKCC 4FU6A 3OYDA 4CC2A 2K3BA 1JXMA 1VQ7Q 1GCPA 3EHQA 1R8OB 4RTYA 2K2MA 3PIOA 2DPPB 4RTUA 1YHQQ 2C0TA 4PFZA 2KXDA 3G6ET 5I2MA 3FB9A 5LJ3g 3RMSA 2OTLT 3OW2P 1OQKA 1KQSP 2A36A 4HCCA 1EX4A 2RQTA 1BU1A 4M7AC 1WDXA 1QVFS 1X75C 3MP1A 2OTJA 3M0SA 3TEEA 3UA7A 3VS7A 1QKXA 1MV0B 5LJ5g 3OYAA 3I55T 4L59A 1MGQA 2VC8A 4M75C 3CXCS 4JLGA 3E2UA 3CD6A 4PJNA 3ULRB 2COWA 3CCQT 1BIBA 4ZGDB 2XIDA 4C92E 2CH4A 2HAXA 3O8VA 1VQKA 1GFDA 2K7AA 3JRZA 2DNUA 2EIFA 3QJ6A 3SWNA 2XD0A 2EJGA 1AHJB 2C0OA 4C5EA 5GMKe 4C8QC 2QA4T 5HY6A 2LT4A 4LD9K 1K76A 4UC4A 1KC8R 2QEXT 3PFSA 4M7AE 3JV3A 1Q95G 3VS5A 2W10A 5GANh 4C92D 2J7IA 5GAOl 4HVVA 1K9MU 4FT2A 1BI3A 2WSCE 1NJIC 5KYWB 5IT9E 3CMAQ 3OYNA 4XTYA 2KNBB 4PFOA 1BI2A 3RKYA 4XU3A 4IKFA 4CI0C 2ZPIB 2QDYB 5KYXA 2DETA 5GMKm 3HFOA 1UGPB 1LCKA 1PRMC 2LTOA 2O9SA 5IHKA 3M59A 4KGZB 1TH7A 4HKEA 1ACMB 2E12A 4LE9A 4AFQC 2Y90A 3CCST 2CUDA 3FLGA 1SRLA 2YLCA 1PWTA 3OBWA 5FW9A 1KC8U 2BKDN 1WJRA 5IXBA 3CC2Q 1QMCA 1GBQA 3FC3A 5GANj 1YJNT 3QO3A 4M7AD 4BE2A 4OGCA 3CQTA 2VXFA 3JB9J 4L5GA 2LT1A 3CCUQ 1SKUB 1VQLT 5CK9A 2XK0A 3V8JA 1NEBA 4MDWA 3M9QA 1YJWT 1VQ6Q 1UGQB 3OYCA 1M5Q1 2G3RA 1UHCA 3RESA 3EFRA 1JJ2S 3QKJA 3HRSA 1TXQA 3H8ZA 4HCBA 4CC7A 3KFVA 3ZBDA 3QXEB 1HSQA 2ZZDA 4EMKB 4LNPA 4F7UF 1YHQA 1WX6A 3JCMJ 2EFIA 2JMCA 4IUQA 2DAQA 3QHSA 4JDSA 4ANJA 2O4XA 2BIVA 3SHWA 2EYQA 3I56Q 1IXDA 1X69A 2CP2A 1S72A 2J6OA 2DM1A 5GAN3 1TTHB 2CSIA 4PK4A 1R0CB 2PZ1A 3HKSA 1M4ZA 1D1CA 3VUZA 2V8IA 3EHRA 1PNJA 4M77C 2RD1A 1IHWA 2CP0A 2L8DA 2QQSA 1RLQC 3C0CA 3L2UA 2LQNA 4NS5A 4IURA 1YN8A 4KGXB 3REAB 3CC7T 3OYMA 4LD6A 4M78D 2LQWA 2HL5C 5KE3A 2RPNA 2CP5A 3QWXX 2XDDA 4OMLA 2QQAA 1QVPA 2DJZA 1UGRB 2YUOA 4F7UA 3QJYA 2L3PA 1ZUUA 2DX1A 5FWCA 3LYIA 2E3HA 1I4K1 2BUDA 4Z88A 1AT1B 3FJPA 1NPPA 3CPWS 1YJ9T 3X26B 4C92G 4M75F 1PSEA 2MOXA 2NUZA 2CZ7B 2P0QA 2EGEA 2XU8A 1ZBJA 4PJOD 1S1NA 3PIPA 1FXXA 2ECZA 3CMAA 5C6SA 3NTIA 1KK7A 4B9WA 5IN1A 2D0QB 2L2PA 1C0MA 4J6XA 3FDRA 3RR6A 4C92A 2LVMA 2VGNA 2L3QA 1UHFA 3HFNA 4M77E 5J26A 1MV3A 2L3RA 1M2VA 2YT6A 3P8HA 1AD5A 1TUDA 2A3LA 3KBGA 2PUKB 4Q5WA 2DLPA 3CCEA 2KEAA 2LNHB 2L89A 4J7FA 5IH2A 1JEGA 2QASA 1BCMA 1WGSA 3V7CA 1OX8A 3PVLA 1RABB 2QGFB 3NPFA 4C8QF 3LW5E 1VQNT 5KYNA 4N4GA 1I5OB 4M7AG 3S3OA 2MI6A 2XMFA 4VUBA 4J8OA 2RQWA 1E6HA 2NUPB 5D7UA 3CCUA 4RTWA 1YI2T 4J9CA 1ZQ1A 4AFSC 3HPWA 4E47A 1ZA2B 5FRNA 3PMIA 3CPWP 1YNZA 4M7AA 3QDRB 2MYSA 4XU1A 4LDYA 1QVGA 2FB7A 1NEGA 1UJ0A 2RN8A 3V8LA 3GLXA 4M77D 2D8JA 4C0ZA 1HJDA 1FMWA 3G1JA 1O9SA 1M90R 3LH0A 1UTIA 4BE1A 2QTXA 5GAMd 1Q82R 1Y71A 1BI0A 2FVUA 3WXMB 2O01E 2DZCA 2EPDA 3FRNA 6AT1B 1BB9A 3I56A 3R6NA 2LQKA 2IIMA 3NHNA 4EMGA 1YCSB 2QYZA 1QWEA 2GGRA 3GP8A 5I11A 1AZEA 2RJEA 1KQ2A 1FX7A 2DIGA 1VQ4T 2QDLA 2HQEA 1FYNA 4ZN1A 1V76A 1YJNA 4O6JA 3PTAA 4DA4A 1M2OA 4C8QA 3GIBA 4OMMA 3CD6T 3THKA 2EGAA 3CPFA 1K0SA 1WYXA 2DK3A 1M90U 2DL8A 1VQKT 1WZOA 4JZ3A 2DBKA 2J06A 1YJWA 4YTLA 4D8DA 2DA9A 3OYKA 2P0PA 4J5YA 2F1LA 3CBMA 2ESWA 2V1QA 9ATCB 5LJ3d 1H92A 3OYFA 2DO3A 1Y57A 2EKOA 2VUBA 4FL6A 2DMOA 1LNXA 2CZ1B 1N9SA 1D1BA 3LLRA 4MZPA 2MCNA 1ZLMA 4DBHA 2AZSA 3META 2FO0A 4RKUE 2RA2A 5LJ5d 3UF4A 4ELYC 4DBQA 1T0HA 1IB8A 3QYGB 3H6ZA 2JS0A 4R0KA 3SFMA 3BY7A 4PJLA 2YHTA 2VGMA 3G71A 2RHIA 2E1HA 4QQDA 4CRIA 2KRMA 2KRSA 1KQ1A 1PKSA 2YSQA 3CC4Q 2FRWA 4BDYA 2HMAA 1VYVA 1KFZA 4N0AC 3J81E 1NLOC 2VXEA 1BKBA 1AWWA 4BI8B 1SPKA 2V8JA 5D6XA 2P4RA 1OPLA 4AFUC 4M7DB 2ZPHB 3UATA 2MIOA 2YUQA 4C5IA 4NL2A 4FSXA 2CS7A 1TOVA 2RJCA 5FROA 1QP3A 2A28A 4KUIA 3RDVA 1TWBA 2LCLA 3R6OA 2KI7A 3KXTA 4E7IA 2ZPBB 1NJIR 2K5FA 1D0ZA 1YIJQ 5GAOr 2J6KA 3MHXA 2IVWA 1QKWA 5FRMA 2XDPA 1HD3A 4PLIA 2OJ2A 4ATOA 3C12A 1E6GA 2RNAA 4OB1B 2PVGB 2PVDB 1CSKA 2PU9B 1V1CA 2HNIA 4M77G 1SHGA 4P5NA 2X4JA 3VS3A 2KT1A 3URGA 1PG5B 1NLPC 4IUTA 1VQ7T 1JXOA 1Q7YR 2DL3A 1PC0A 3UPUA 1YHQT 4M77A 3CCJQ 1W70A 3CCVQ 1JO8A 2JMAA 1RAFB 2C0IA 1NJIU 2SRCA 2ABLA 4J9IA 1MMAA 1ARKA 4PL6A 1Q81U 2M0OA 2H3JA 3M0TA 3RMQA 4A4FA 3VU3C 3M0QA 1Q82C 4X34A 4JJBA 2ED1A 1G2BA 4M7DC 2X35A 1OX9A 2AHJB 5CKHA 4RG8A 5GAMf 3OYIA 1AWOA 2F2XA 1YI2A 3L2RA 1VQ8Q 1X6BA 1QCFA 2VWFA 1D1AA 1I0CA 1OYXA 4E6RA 4R55A 2EWNA 1EZZB 1Z9QA 2MF2A 3EFOB 2LX7A 4HCZA 4N4HA 3BDUA 2EJ9A 5HCKA 2JM8A 3V8KA 5GAMh 5GAOp 1W2BP 3OW2A 2V8KA 1KQSA 2JM9A 3C95A 1ZA1B 2QG9B 1WXBA 5DY9A 2GFAA 4LDXA 3PNWC 4OGEA 1M1FA 4PJMA 2E10A 2IPOB 4F7UE 1M3CA 1T0JA 1H3HA 3N5BB 2HQHA 1PSFA 1N8RC 2DL4A 1M1GA 3G4SQ 1VQ4A 1WHLA 2CP7A 5LJ3f 4BB7A 4JS4A 3CMAT 5CVIA 2ZCFB 2E4HA 2K3XA 5GAMj 1MMNA 3J80E 3RNJA 2FZKB 2K9GA 2YRVA 1OI1A 4HT9A 5LJ5f 2GQVA 2D9TA 3CMEA 1SSHA 2E6ZA 5EG2A 5LJ3h 3CCET 3TSZA 4B9XA 3S6WA 3TU4K 2KYBA 2QQBA 1VQ9Q 4AFZC 3JSCA 2DBMA 2JTFA 2R57A 1ZSZB 3LWIA 4DOVA 4KBMB 4M78B 2YUNA 1M1KC 1RACB 2CREA 2RQVA 5LJ5h 4GY5A 1YFNA 3PMTA 3GPLA 3CCLQ 4JJCA 3CCUT 4PJJA 3L1AA 1HYOA 1VQOQ 3CBOA 3L2WA 4OMQA 2VB6A 2E6NA 1QVFP 1C6VX 1WPYA 4WTOB 4QVCA 2XI9A 2LDMA 1UFFA 1UECA 4MZTA 1Y0MA 5LJ3j 5GAN2 2EJFA 3CXCP 4EPCA 1XQHA 4EIKA 4M75E 2R5MA 2JJ9A 3JCMe 2OTLQ 1KIKA 3CCJA 1GFCA 1K8AC 3CCVA 3S3MA 1QWFA 5LJ5j 4BI3A 1I8FA 3I56T 2MAMA 1WQ7A 1RL2A 5A2QE 3I55Q 4AMCA 3C4SA 5HKCA 2D1XA 5C0MA 1Q7YC 2XICA 1BYMA 1I5LA 3TCJA 1RAGB 2RHZA 1IREB 2M16A 1VQ5Q 4EDUA 5IXFA 2R5AA 4A4EA 5KH6A 3P8DA 4C5HA 1NM7A 1IGUA 2BZXA 4OMOA 4C8QE 1ZSZC 1VIEA 1G3WA 2RJDA 4HT8A 4FCYA 1MNEA 5IAYA 2DYBA 3NFCA 4M75D 3TREA 4IUPA 2LX9A 3MJXA 3AT1B 4KUDK 2X4XA 1U3OA 2LCCA 2COYA 5HK0A 2K4YA 2XG8D 2YXYA 1JB0E 1VQ7A 3L2ZA 2EYZA 4R56A 1X27A 4OB2B 4MZMA 1A0NB 4N0AA 1HXDA 4C0GA 2QEXQ 2F5KA 3ZEHA 4MDXA 2ZGWA 4GLMA 5GAN4 1WFWA 3RKXA 2MWPA 5DLQE 5GJVB 2B86A 3OYEA 3G71T 4C8QD 2MWOA 2P4TA 3JCMW 2DTIA 4M7DF 1SRMA 1AOJA 1T3SA 2RI5A 3CBPA 2WACA 3OS2A 1YWPA 4C5GA 2EYXA 3REBB 2ZAEA 1JBMA 1OOTA 2DL7A 4E7SA 3EG9B 1PRLC 1DJ7B 4ESRA 2Y4XA 4D8KA 4BY6B 2DXTA 3GOXA 3CCSQ 2LMJA 2EQMA 4J6YA 2CSQA 3ME9A 2V1RA 1JJ2P 5IHIA 4DBFA 4KH1B 2DXBA 4F7UG 1WLPB 2M51A 1OPKA 3OS5A 1FMVA 4LN2A 3MCAB 3RBBB 3VS1A 2RQRA 3OMGA 1G3YA 1G5VA 2LJ0A 3LX7A 4V2SA 2PVOB 5KCHA 4EMKC 2FZCB 5IHNA 4RUGA 2JTMA 2HD0A 3SD4A 2D6FA 2PTKA 3HL8A 2VVKA 1XJWB 1K9MC 1J3TA 1ZHIA 2JW4A 1R77A 4M7DA 2DE0X 3MEUA 1U1SA 3HSBA 3OB9A 2FPEA 2KSSA 5DM7R 1VQPQ 5I2SA 2C06A 2ZPEB 1D0YA 1AVZC 1G3TA 1IO6A 2OAUA 2EQKA 1PM3A 1Z9ZA 3H41A 1M27C 3OY9A 4FYWB 2PNIA 2F2VA 5GMKl 4QW2A 3CC2A 2HL3A 1LPLA 1C1AA 2I2LA 1VYUA 3H0FA 3UA6A 1YBYA 2K79A 3CPWA 2DVJA 3JCMg 5KYYA 3M58A 4LDWA 3FIFA 5KE2A 1D3BA 4M75G 4A4GA 2GBQA 5FU6B 5GMKh 1VQ6A 2CUBA 3EH1A 3QYHB 5CKBA 5GAN7 1OU8A 2ENMA 1ZUKA 3QBYA 4OP0A 2CGHA 3JCMQ 1OZ3A 3FJ5A 4XTVA 2KXCA 3VS6A 4BE0A 5CQYA 2EKHA 1O75A 1Y96A 4JLIA 4M75A 3VKIA 5GAN8 3DLLA 3MEWA 3PVQA 1TS9A 2DD5A 2GCXA 2RH2A 3HP9A 3NTHA 1RAEB 1KHIA 2JVVA 4HVUA 1YJ9Q 1QP2A 2E3IA 2GQIA 1WNLA 5J3BA 3HRUA 5GJWB 4C8QG 4E7ZA 2DIQA 2EYWA 1H8KA 2HCKA 5GMKj 1UUEA 3VS2A 1IRXA 3BE3A 1NYFA 1Q86R 1M8VA 1NZ9A 4M78F 2NUTB 4M4ZA 2RM4A 4BI4A 3EFOA 5CKDA 1X2QA 2PUOB 2O88A 3V7SA 4EMHA 2LP5A 2GTOA 3JB9F 3CMET 4QQGA 2H3EB 1Q82U 3BFMA 4Z02A 3NTKA 1UEBA 8AT1B 3CCMQ 2E70A 4PJOF 2O4XB 5FU6C 3VJPA 2XKOC 1N8RR 2FRYA 2QQRA 3L42A 1WHHA 4QQ6A 3M5AA 4B6MA 4ZGJB 4OMNA 2CDTA 1YIJT 2VKNA 1VOMA 2HDAA 4IIMA 2M02A 2ZPGB 2JN0A 3OQ5A 1D09B 4J9BA 5FWBA 4IIOA 3RERA 2DVEA 2P0KA 2YDLA 2A0FB 3M57A 1LVKA 4FW1A 4AG1C 4LDVA 5GANe 4X1VA 2YRCA 1M1KR 1ZSZA 4F16A 2KR3A 3CCJT 4N4IA 3WVDB 1VQPA 3MP8A 4C0DB 3CCVT 2X51A 1N8RU 3PE0A 2QTVA 2OTJQ 1N6AA 1TUCA 2HBWA 5FLXE 4RTZA 2Y4YA 2O9VA 2RB6A 5A0LA 3H9NA 4RG2A 1PKTA 2DL5A 4RCBA 3M55A 3X24B
chains in the Genus database with same CATH topology
1JJ2P 3CD6Q 2QA4Q 1M1KR 1VQPQ 1M90R 3CCUQ 1QVGP 3CCEQ 3G71Q 1YJNQ 3OW2P 1Q86R 1NJIR 1Q7YR 1Q82R 1VQNQ 3CCMQ 3I55Q 2QEXQ 3CXCP 1YITQ 1KQSP 1VQKQ 1VQ6Q 3CMEQ 1VQMQ 1K9MR 1YIJQ 2OTJQ 1Q81R 3CMAQ 3CCLQ 3CPWP 1K73R 1N8RR 3G6EQ 1S72Q 1VQLQ 3I56Q 1VQ4Q 3CCSQ 1YJ9Q 3CCJQ 1VQ5Q 1KD1R 1VQOQ 2OTLQ 3CC2Q 1K8AR 3CCVQ 3CCQQ 1VQ7Q 1KC8R 1YI2Q 1W2BP 3G4SQ 3CC4Q 3CCRQ 1YJWQ 3CC7Q 1QVFP 1VQ8Q 1VQ9Q 1YHQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 P;  3CD6 Q;  2QA4 Q;  1M1K R;  1VQP Q;  1M90 R;  3CCU Q;  1QVG P;  3CCE Q;  3G71 Q;  1YJN Q;  3OW2 P;  1Q86 R;  1NJI R;  1Q7Y R;  1Q82 R;  1VQN Q;  3CCM Q;  3I55 Q;  2QEX Q;  3CXC P;  1YIT Q;  1KQS P;  1VQK Q;  1VQ6 Q;  3CME Q;  1VQM Q;  1K9M R;  1YIJ Q;  2OTJ Q;  1Q81 R;  3CMA Q;  3CCL Q;  3CPW P;  1K73 R;  1N8R R;  3G6E Q;  1S72 Q;  1VQL Q;  3I56 Q;  1VQ4 Q;  3CCS Q;  1YJ9 Q;  3CCJ Q;  1VQ5 Q;  1KD1 R;  1VQO Q;  2OTL Q;  3CC2 Q;  1K8A R;  3CCV Q;  3CCQ Q;  1VQ7 Q;  1KC8 R;  1YI2 Q;  1W2B P;  3G4S Q;  3CC4 Q;  3CCR Q;  1YJW Q;  3CC7 Q;  1QVF P;  1VQ8 Q;  1VQ9 Q;  1YHQ Q; 
#chains in the Genus database with same CATH topology
 3CD6 Q;  2RO0 A;  1QQJ A;  1RUW A;  4QT7 A;  2VV5 A;  2RHX A;  1VQ8 T;  4XAX B;  5KYW A;  4JRK A;  5L23 A;  1K8A R;  1M1K U;  3X28 B;  4C92 B;  2RJF A;  3M0P A;  4ZTF A;  1M2V B;  1SF9 A;  5GAO m;  2DF6 A;  3EGD B;  2V26 A;  1F1B B;  3JCM P;  1G83 A;  1VQM Q;  2LQ8 A;  2QK0 A;  4TVR A;  3OS1 A;  2PQW A;  3M54 A;  1YCY A;  4J7I A;  3A8G B;  1I1J A;  2ED0 A;  2D0N A;  2EQI A;  2MK5 A;  2X3X D;  4Y28 E;  1ZBX A;  4XU2 A;  3VYG A;  4C0D C;  1RAA B;  1OU9 A;  3G4S T;  2AKK A;  2EW3 A;  1K8A U;  2X4Y A;  4M7A B;  4F14 A;  4DEX A;  2FG0 A;  5GAN 6;  4OMP A;  1M8M A;  4QVD A;  3OW2 S;  1M3A A;  5CIU A;  1KQS S;  3VUB A;  4EMK A;  1Q7Y U;  1WQW A;  2ATC B;  3A8H B;  1BCO A;  1W2B A;  1YIT Q;  3EGX B;  2EQU A;  4CC4 B;  3UDC A;  1Q86 C;  3CCM A;  1VQ9 T;  3QII A;  5D6Y A;  4LDU A;  1K4U S;  2FL7 A;  2DZ9 A;  2HSP A;  1KJW A;  4RCC A;  2KYM A;  2FPD A;  3E9F A;  4L6V 5;  4J9E A;  1XNI A;  3CCL T;  3LGL A;  1VQO T;  3P8B B;  2Z0W A;  5LL6 S;  4FM4 B;  2VAS A;  3TSW A;  3I5S A;  1WA7 A;  4PFP A;  3A98 A;  3EG9 A;  1YP5 A;  2A7Y A;  3BDL A;  4JUV A;  2LC4 A;  1TG0 A;  3KUF A;  2G6F X;  3HHT B;  3CCR Q;  4O5V A;  4OMF B;  2JT4 A;  4RTT A;  4KH0 B;  3CC4 A;  1I07 A;  4GLK A;  4XTU A;  4BAC A;  4J9G A;  4M7D E;  3QZ5 B;  1KHC A;  2K2V A;  3M56 A;  1FMK A;  2JZ2 A;  1PHT A;  1S72 Q;  2E5Q A;  4A53 A;  1WHK A;  2BZ8 A;  4A63 B;  2FPF A;  2DD4 A;  5FU7 B;  4J6W A;  2QAZ A;  3EG2 A;  1X01 A;  1GBR A;  2OX7 A;  2JOY A;  2DKG A;  4WF2 A;  1U06 A;  2O2O A;  1VQ5 T;  3QZ9 B;  3CC2 T;  2QGG A;  4FSS A;  1WXT A;  2KRO A;  3SEM A;  1B34 B;  3VV0 A;  5DLO A;  3EAE A;  2XHC A;  1B7T A;  1K9M R;  1U1T A;  3A8L B;  1QVF A;  1SEM A;  2OAW A;  5GAN g;  1YIJ A;  4IUU A;  4BD3 A;  1AWJ A;  3OA6 A;  1VQ6 T;  1CKA A;  1ABO A;  5A0G A;  3CXC A;  4M7D D;  1WHG A;  1BIA A;  8ATC B;  2E41 A;  1WIE A;  4PJO B;  4XTZ A;  4FIB A;  5GAN f;  4AT1 B;  2DXU A;  3GNF B;  1N9R A;  1VQM A;  3G6E Q;  1K73 C;  1GCQ C;  4KUL A;  4JJD A;  5HK3 A;  1KD1 C;  1JQQ A;  3O5Z A;  3EFS A;  2FZG B;  1I81 A;  1N5Z A;  2GNC A;  2KMT A;  2NUP A;  3G7Z A;  3HRT A;  3JCM d;  3VRZ A;  2K57 A;  2K5I A;  4Y91 A;  2DXC A;  4DEY A;  5M9O A;  2YWW A;  4Z8A A;  4E7L A;  1Q81 C;  5D6W A;  1V29 B;  3CCQ Q;  2ROT A;  3C94 A;  1X6G A;  4XTX A;  5FU7 C;  2M9U A;  3OYL A;  1WI7 A;  2K6D A;  2DER A;  1M30 A;  3JCM b;  3EH2 A;  4F04 B;  4JRI A;  3PT9 A;  1VQ8 A;  4M78 C;  3CCE Q;  5CKE A;  4NOY A;  2O31 A;  1NG2 A;  3SB2 A;  4FYV B;  4D6W A;  1K0X A;  3H0H A;  1YIT A;  4M77 B;  4LXC A;  4PNO A;  3LGF A;  4RMO A;  4J83 A;  1SHF A;  3X25 B;  2AIR B;  1SG5 A;  2QA4 Q;  3OYY A;  3EG3 A;  2W0Z A;  1XOV A;  4PJO C;  3UWN A;  1ZX6 A;  4OVA A;  2KK4 A;  2NUT A;  5KYU B;  1AEY A;  1QW1 A;  1Y07 A;  1TU0 B;  4KRT A;  2RHU A;  1G8X A;  3J7A F;  2BE7 D;  4C0F A;  3GNG A;  2KDS A;  4JPB W;  4PLL A;  4JRQ A;  3G4S A;  3CCR A;  3FEO A;  1VA7 A;  2GF7 A;  3E19 A;  4K11 A;  1UJY A;  4HVW A;  5I22 A;  3L2V A;  2K5L A;  3L2Q A;  3OYH A;  4BUG A;  2EVR A;  2J6F A;  2JUF A;  3ER0 A;  2KY9 A;  1VQP T;  1OZ2 A;  1JJ2 A;  4M78 E;  2GTJ A;  5GAO n;  1RAI B;  4ZGE B;  3OYB A;  2AZV A;  2F69 A;  1IZ6 A;  1MHN A;  1CKB A;  2CKK A;  1RAD B;  1KG1 A;  2VYT A;  2DEU A;  4C92 F;  3ZL7 C;  1NE8 A;  1FWZ A;  2M1H A;  1VQ9 A;  1YJN Q;  2BTT A;  1X43 A;  2LZ6 B;  1WHJ A;  2RF0 A;  3F70 A;  1U5S A;  3RIR A;  1OEB A;  1G3S A;  1OV3 A;  2J05 A;  4PJO E;  3OSV A;  1VQL Q;  3CCL A;  2I0N A;  2JS2 A;  3LH5 A;  3A8M B;  1VQO A;  1AZG B;  1YJW Q;  3M4Y A;  3M53 A;  1GXI E;  4M7D G;  2KQW A;  4A54 A;  4AG2 C;  4KGV B;  2CZ6 B;  4Z89 A;  1U8R A;  2L3S A;  4BDZ A;  3M0U A;  3VS4 A;  2JNG A;  3RUX A;  2RI3 A;  3G6E A;  4M7A F;  4J9H A;  2DTH A;  2OTL A;  5L8R E;  3LWH A;  1YWO A;  3JB9 D;  3SWN B;  1QCN A;  1K1Z A;  2ROL A;  3S3N A;  3I35 A;  2DYI A;  4J9F A;  1PD0 A;  3G71 Q;  2DTO A;  1BI1 A;  4MMK A;  3I55 A;  1H64 1;  4HCK A;  4FW2 A;  1TSF A;  4BY6 C;  4ME7 A;  5GAO q;  1H3Z A;  5CCA A;  4LUE A;  1QVG S;  1VQ5 A;  2X4W A;  1B07 A;  3CCQ A;  1KC8 C;  3VS0 A;  2HZY A;  3IQL A;  2EAY A;  2RHY A;  3DLM A;  5J39 A;  4JS5 A;  1WJS A;  3A1P A;  3EGD A;  1N27 A;  3TQ7 P;  3V7R A;  4FYY B;  4E7J A;  2ZPF B;  2NWM A;  5CAI A;  1AWX A;  4KT0 E;  2CT3 A;  3QDF A;  3DB4 A;  2A37 A;  3OYJ A;  3SDZ A;  5KYX B;  3JAM E;  3CCM T;  2XDB A;  3CC7 Q;  3T9N A;  3JCM f;  2KE9 A;  4NL3 A;  2YLB A;  2L0A A;  4XK8 E;  3OMC A;  2R58 A;  1WJQ A;  4ZN3 A;  2QA4 A;  2RQU A;  4QVZ A;  2CH4 W;  2EGC A;  1ZSG A;  1ABQ A;  2K3Y A;  2QEX A;  2QQ9 A;  5GAM e;  2RK2 A;  3DKM A;  3NMZ C;  2RK1 A;  4ZNX A;  3JCM h;  1BK2 A;  3SWN C;  1M9S A;  2CP3 A;  1GL5 A;  3JB9 I;  1QVG P;  1QCO A;  4RTV A;  2HQX A;  2YUP A;  1UG1 A;  3GF5 A;  3CC4 T;  2HKN A;  4OF1 A;  3EGX A;  5AYF A;  1NBE B;  2E65 A;  2NYS A;  4RTX A;  3QWY A;  4QKU A;  1PCX A;  7AT1 B;  2KGT A;  1R0B G;  2EQJ A;  3CCS A;  2YRD A;  2BE9 B;  3HTR A;  3INZ A;  1JU5 C;  2OTJ T;  4ELZ C;  2KVQ G;  4FYX B;  2DRM A;  3OSS C;  4HXJ A;  2DJQ A;  2MPX C;  3EGU A;  3E9G A;  1VQN Q;  4E2F B;  1Y7X A;  4FT4 A;  4XQ3 A;  2KRN A;  2HKQ B;  4GBQ A;  5LJ3 e;  1MMG A;  3MP6 A;  1LOJ A;  1GCQ A;  1VQL A;  1YI2 Q;  3RKW A;  3MEV A;  2RI2 A;  1BBZ A;  3A8O B;  4Y92 A;  2RMO A;  3PGG A;  2M0Y A;  1Q86 U;  1SSF A;  1M3B A;  3A5Z B;  1B3Q A;  3JCM c;  1XTD A;  2JXB A;  5EC7 A;  3QSU A;  2HBP A;  2X9H A;  5LJ5 e;  2E5K A;  2P84 A;  2KAF A;  2SEM A;  3JCM V;  5GMK i;  1ZUY A;  1NYG A;  3U23 A;  2A08 A;  4M78 G;  1RLP C;  4DBR A;  3MO8 A;  1UE9 A;  2MMP A;  2FEI A;  5CQX A;  1VYT A;  3X20 B;  2CT4 A;  2F5T X;  1VQM T;  1RAH B;  5AT1 B;  4E7H A;  1GRI A;  4ZTJ A;  2COZ A;  3JB9 G;  2IG0 A;  4M78 A;  3GBQ A;  3Q1J A;  1UDL A;  1EFN A;  2FYK A;  2DRK A;  4JZ4 A;  1WHM A;  5GAN 5;  1B34 A;  2CYZ B;  4X9C A;  5A0D A;  2NLU A;  4PJO G;  1X6O A;  1MMD A;  1VQ4 Q;  5KCO A;  5GAN d;  4M77 F;  1OUL A;  4A4H A;  1PD1 A;  1JRI A;  2KBT A;  4F7U B;  2F2W A;  4II1 A;  5CKF A;  3EG1 A;  1MUZ A;  1W4S A;  3I9Q A;  4PJO A;  4CC3 A;  1MND A;  2JTE A;  2DEQ A;  1VQK Q;  4ORZ A;  3CME Q;  1UGS B;  1K73 R;  3ASK A;  3VYH B;  3OYG A;  2QI2 A;  1KD1 R;  3VRY A;  3MKD A;  4JRP A;  1P92 A;  1YIT T;  1X2K A;  2FHD A;  2AT1 B;  2LJ3 A;  3DB3 A;  3CC7 A;  1W1F A;  4F17 A;  5CO7 A;  1WXU A;  4DQ2 A;  1VIF A;  1EIF A;  2KT8 A;  2LJ1 A;  3EG0 A;  4A4K A;  2OI3 A;  3QUI A;  2CP6 A;  1Q81 R;  3BW1 A;  2B8A A;  1W6X A;  2AK5 A;  4OB3 B;  1NPR A;  3M0R A;  2X3W D;  3UT1 A;  5CR2 A;  2EBP A;  1YJ9 A;  1IGQ A;  2WSE E;  1QLY A;  4XU0 A;  1RI9 A;  2D8H A;  2LRQ A;  1VUB A;  1KSW A;  1K73 U;  3D7S B;  5KYY B;  3ZFJ A;  1HK9 A;  1K9A A;  3OBY A;  2DFU A;  2HEQ A;  3QG1 A;  3NGP A;  3CCR T;  1D3B B;  1W2B S;  1KD1 U;  3TVT A;  3E1S A;  2CZ0 B;  2E64 A;  4J9D A;  1TUG B;  3CEY A;  2DIL A;  3JB9 H;  1D0X A;  2WSF E;  2H8H A;  3H0I A;  3MEA A;  1E7O A;  3OS0 A;  2L5Q A;  2LCS A;  4XTW A;  2GFU A;  2EYY A;  4M75 B;  1Y96 B;  1S72 T;  4LUD A;  4X9D A;  4E7K A;  5GAM g;  1M90 C;  5KYU A;  2HSE B;  1VQN A;  4JJN K;  4DOW A;  1UB4 A;  3AHU A;  1RI0 A;  2LNV A;  3M4G A;  5ECA A;  4C92 C;  4OB0 B;  4WCI A;  3I5R A;  1UGV A;  2QXF A;  4HA8 A;  4MML A;  2AKL A;  3JCM X;  1LJO A;  3QPH A;  5I21 A;  1IHV A;  4IUV A;  2BZY A;  3WVE B;  1T3L A;  4C8Q B;  3MPU B;  4PKC C;  4FU6 A;  3OYD A;  4CC2 A;  2K3B A;  1JXM A;  1VQ7 Q;  1GCP A;  3EHQ A;  1R8O B;  4RTY A;  2K2M A;  3PIO A;  2DPP B;  4RTU A;  1YHQ Q;  2C0T A;  4PFZ A;  2KXD A;  3G6E T;  5I2M A;  3FB9 A;  5LJ3 g;  3RMS A;  2OTL T;  3OW2 P;  1OQK A;  1KQS P;  2A36 A;  4HCC A;  1EX4 A;  2RQT A;  1BU1 A;  4M7A C;  1WDX A;  1QVF S;  1X75 C;  3MP1 A;  2OTJ A;  3M0S A;  3TEE A;  3UA7 A;  3VS7 A;  1QKX A;  1MV0 B;  5LJ5 g;  3OYA A;  3I55 T;  4L59 A;  1MGQ A;  2VC8 A;  4M75 C;  3CXC S;  4JLG A;  3E2U A;  3CD6 A;  4PJN A;  3ULR B;  2COW A;  3CCQ T;  1BIB A;  4ZGD B;  2XID A;  4C92 E;  2CH4 A;  2HAX A;  3O8V A;  1VQK A;  1GFD A;  2K7A A;  3JRZ A;  2DNU A;  2EIF A;  3QJ6 A;  3SWN A;  2XD0 A;  2EJG A;  1AHJ B;  2C0O A;  4C5E A;  5GMK e;  4C8Q C;  2QA4 T;  5HY6 A;  2LT4 A;  4LD9 K;  1K76 A;  4UC4 A;  1KC8 R;  2QEX T;  3PFS A;  4M7A E;  3JV3 A;  1Q95 G;  3VS5 A;  2W10 A;  5GAN h;  4C92 D;  2J7I A;  5GAO l;  4HVV A;  1K9M U;  4FT2 A;  1BI3 A;  2WSC E;  1NJI C;  5KYW B;  5IT9 E;  3CMA Q;  3OYN A;  4XTY A;  2KNB B;  4PFO A;  1BI2 A;  3RKY A;  4XU3 A;  4IKF A;  4CI0 C;  2ZPI B;  2QDY B;  5KYX A;  2DET A;  5GMK m;  3HFO A;  1UGP B;  1LCK A;  1PRM C;  2LTO A;  2O9S A;  5IHK A;  3M59 A;  4KGZ B;  1TH7 A;  4HKE A;  1ACM B;  2E12 A;  4LE9 A;  4AFQ C;  2Y90 A;  3CCS T;  2CUD A;  3FLG A;  1SRL A;  2YLC A;  1PWT A;  3OBW A;  5FW9 A;  1KC8 U;  2BKD N;  1WJR A;  5IXB A;  3CC2 Q;  1QMC A;  1GBQ A;  3FC3 A;  5GAN j;  1YJN T;  3QO3 A;  4M7A D;  4BE2 A;  4OGC A;  3CQT A;  2VXF A;  3JB9 J;  4L5G A;  2LT1 A;  3CCU Q;  1SKU B;  1VQL T;  5CK9 A;  2XK0 A;  3V8J A;  1NEB A;  4MDW A;  3M9Q A;  1YJW T;  1VQ6 Q;  1UGQ B;  3OYC A;  1M5Q 1;  2G3R A;  1UHC A;  3RES A;  3EFR A;  1JJ2 S;  3QKJ A;  3HRS A;  1TXQ A;  3H8Z A;  4HCB A;  4CC7 A;  3KFV A;  3ZBD A;  3QXE B;  1HSQ A;  2ZZD A;  4EMK B;  4LNP A;  4F7U F;  1YHQ A;  1WX6 A;  3JCM J;  2EFI A;  2JMC A;  4IUQ A;  2DAQ A;  3QHS A;  4JDS A;  4ANJ A;  2O4X A;  2BIV A;  3SHW A;  2EYQ A;  3I56 Q;  1IXD A;  1X69 A;  2CP2 A;  1S72 A;  2J6O A;  2DM1 A;  5GAN 3;  1TTH B;  2CSI A;  4PK4 A;  1R0C B;  2PZ1 A;  3HKS A;  1M4Z A;  1D1C A;  3VUZ A;  2V8I A;  3EHR A;  1PNJ A;  4M77 C;  2RD1 A;  1IHW A;  2CP0 A;  2L8D A;  2QQS A;  1RLQ C;  3C0C A;  3L2U A;  2LQN A;  4NS5 A;  4IUR A;  1YN8 A;  4KGX B;  3REA B;  3CC7 T;  3OYM A;  4LD6 A;  4M78 D;  2LQW A;  2HL5 C;  5KE3 A;  2RPN A;  2CP5 A;  3QWX X;  2XDD A;  4OML A;  2QQA A;  1QVP A;  2DJZ A;  1UGR B;  2YUO A;  4F7U A;  3QJY A;  2L3P A;  1ZUU A;  2DX1 A;  5FWC A;  3LYI A;  2E3H A;  1I4K 1;  2BUD A;  4Z88 A;  1AT1 B;  3FJP A;  1NPP A;  3CPW S;  1YJ9 T;  3X26 B;  4C92 G;  4M75 F;  1PSE A;  2MOX A;  2NUZ A;  2CZ7 B;  2P0Q A;  2EGE A;  2XU8 A;  1ZBJ A;  4PJO D;  1S1N A;  3PIP A;  1FXX A;  2ECZ A;  3CMA A;  5C6S A;  3NTI A;  1KK7 A;  4B9W A;  5IN1 A;  2D0Q B;  2L2P A;  1C0M A;  4J6X A;  3FDR A;  3RR6 A;  4C92 A;  2LVM A;  2VGN A;  2L3Q A;  1UHF A;  3HFN A;  4M77 E;  5J26 A;  1MV3 A;  2L3R A;  1M2V A;  2YT6 A;  3P8H A;  1AD5 A;  1TUD A;  2A3L A;  3KBG A;  2PUK B;  4Q5W A;  2DLP A;  3CCE A;  2KEA A;  2LNH B;  2L89 A;  4J7F A;  5IH2 A;  1JEG A;  2QAS A;  1BCM A;  1WGS A;  3V7C A;  1OX8 A;  3PVL A;  1RAB B;  2QGF B;  3NPF A;  4C8Q F;  3LW5 E;  1VQN T;  5KYN A;  4N4G A;  1I5O B;  4M7A G;  3S3O A;  2MI6 A;  2XMF A;  4VUB A;  4J8O A;  2RQW A;  1E6H A;  2NUP B;  5D7U A;  3CCU A;  4RTW A;  1YI2 T;  4J9C A;  1ZQ1 A;  4AFS C;  3HPW A;  4E47 A;  1ZA2 B;  5FRN A;  3PMI A;  3CPW P;  1YNZ A;  4M7A A;  3QDR B;  2MYS A;  4XU1 A;  4LDY A;  1QVG A;  2FB7 A;  1NEG A;  1UJ0 A;  2RN8 A;  3V8L A;  3GLX A;  4M77 D;  2D8J A;  4C0Z A;  1HJD A;  1FMW A;  3G1J A;  1O9S A;  1M90 R;  3LH0 A;  1UTI A;  4BE1 A;  2QTX A;  5GAM d;  1Q82 R;  1Y71 A;  1BI0 A;  2FVU A;  3WXM B;  2O01 E;  2DZC A;  2EPD A;  3FRN A;  6AT1 B;  1BB9 A;  3I56 A;  3R6N A;  2LQK A;  2IIM A;  3NHN A;  4EMG A;  1YCS B;  2QYZ A;  1QWE A;  2GGR A;  3GP8 A;  5I11 A;  1AZE A;  2RJE A;  1KQ2 A;  1FX7 A;  2DIG A;  1VQ4 T;  2QDL A;  2HQE A;  1FYN A;  4ZN1 A;  1V76 A;  1YJN A;  4O6J A;  3PTA A;  4DA4 A;  1M2O A;  4C8Q A;  3GIB A;  4OMM A;  3CD6 T;  3THK A;  2EGA A;  3CPF A;  1K0S A;  1WYX A;  2DK3 A;  1M90 U;  2DL8 A;  1VQK T;  1WZO A;  4JZ3 A;  2DBK A;  2J06 A;  1YJW A;  4YTL A;  4D8D A;  2DA9 A;  3OYK A;  2P0P A;  4J5Y A;  2F1L A;  3CBM A;  2ESW A;  2V1Q A;  9ATC B;  5LJ3 d;  1H92 A;  3OYF A;  2DO3 A;  1Y57 A;  2EKO A;  2VUB A;  4FL6 A;  2DMO A;  1LNX A;  2CZ1 B;  1N9S A;  1D1B A;  3LLR A;  4MZP A;  2MCN A;  1ZLM A;  4DBH A;  2AZS A;  3MET A;  2FO0 A;  4RKU E;  2RA2 A;  5LJ5 d;  3UF4 A;  4ELY C;  4DBQ A;  1T0H A;  1IB8 A;  3QYG B;  3H6Z A;  2JS0 A;  4R0K A;  3SFM A;  3BY7 A;  4PJL A;  2YHT A;  2VGM A;  3G71 A;  2RHI A;  2E1H A;  4QQD A;  4CRI A;  2KRM A;  2KRS A;  1KQ1 A;  1PKS A;  2YSQ A;  3CC4 Q;  2FRW A;  4BDY A;  2HMA A;  1VYV A;  1KFZ A;  4N0A C;  3J81 E;  1NLO C;  2VXE A;  1BKB A;  1AWW A;  4BI8 B;  1SPK A;  2V8J A;  5D6X A;  2P4R A;  1OPL A;  4AFU C;  4M7D B;  2ZPH B;  3UAT A;  2MIO A;  2YUQ A;  4C5I A;  4NL2 A;  4FSX A;  2CS7 A;  1TOV A;  2RJC A;  5FRO A;  1QP3 A;  2A28 A;  4KUI A;  3RDV A;  1TWB A;  2LCL A;  3R6O A;  2KI7 A;  3KXT A;  4E7I A;  2ZPB B;  1NJI R;  2K5F A;  1D0Z A;  1YIJ Q;  5GAO r;  2J6K A;  3MHX A;  2IVW A;  1QKW A;  5FRM A;  2XDP A;  1HD3 A;  4PLI A;  2OJ2 A;  4ATO A;  3C12 A;  1E6G A;  2RNA A;  4OB1 B;  2PVG B;  2PVD B;  1CSK A;  2PU9 B;  1V1C A;  2HNI A;  4M77 G;  1SHG A;  4P5N A;  2X4J A;  3VS3 A;  2KT1 A;  3URG A;  1PG5 B;  1NLP C;  4IUT A;  1VQ7 T;  1JXO A;  1Q7Y R;  2DL3 A;  1PC0 A;  3UPU A;  1YHQ T;  4M77 A;  3CCJ Q;  1W70 A;  3CCV Q;  1JO8 A;  2JMA A;  1RAF B;  2C0I A;  1NJI U;  2SRC A;  2ABL A;  4J9I A;  1MMA A;  1ARK A;  4PL6 A;  1Q81 U;  2M0O A;  2H3J A;  3M0T A;  3RMQ A;  4A4F A;  3VU3 C;  3M0Q A;  1Q82 C;  4X34 A;  4JJB A;  2ED1 A;  1G2B A;  4M7D C;  2X35 A;  1OX9 A;  2AHJ B;  5CKH A;  4RG8 A;  5GAM f;  3OYI A;  1AWO A;  2F2X A;  1YI2 A;  3L2R A;  1VQ8 Q;  1X6B A;  1QCF A;  2VWF A;  1D1A A;  1I0C A;  1OYX A;  4E6R A;  4R55 A;  2EWN A;  1EZZ B;  1Z9Q A;  2MF2 A;  3EFO B;  2LX7 A;  4HCZ A;  4N4H A;  3BDU A;  2EJ9 A;  5HCK A;  2JM8 A;  3V8K A;  5GAM h;  5GAO p;  1W2B P;  3OW2 A;  2V8K A;  1KQS A;  2JM9 A;  3C95 A;  1ZA1 B;  2QG9 B;  1WXB A;  5DY9 A;  2GFA A;  4LDX A;  3PNW C;  4OGE A;  1M1F A;  4PJM A;  2E10 A;  2IPO B;  4F7U E;  1M3C A;  1T0J A;  1H3H A;  3N5B B;  2HQH A;  1PSF A;  1N8R C;  2DL4 A;  1M1G A;  3G4S Q;  1VQ4 A;  1WHL A;  2CP7 A;  5LJ3 f;  4BB7 A;  4JS4 A;  3CMA T;  5CVI A;  2ZCF B;  2E4H A;  2K3X A;  5GAM j;  1MMN A;  3J80 E;  3RNJ A;  2FZK B;  2K9G A;  2YRV A;  1OI1 A;  4HT9 A;  5LJ5 f;  2GQV A;  2D9T A;  3CME A;  1SSH A;  2E6Z A;  5EG2 A;  5LJ3 h;  3CCE T;  3TSZ A;  4B9X A;  3S6W A;  3TU4 K;  2KYB A;  2QQB A;  1VQ9 Q;  4AFZ C;  3JSC A;  2DBM A;  2JTF A;  2R57 A;  1ZSZ B;  3LWI A;  4DOV A;  4KBM B;  4M78 B;  2YUN A;  1M1K C;  1RAC B;  2CRE A;  2RQV A;  5LJ5 h;  4GY5 A;  1YFN A;  3PMT A;  3GPL A;  3CCL Q;  4JJC A;  3CCU T;  4PJJ A;  3L1A A;  1HYO A;  1VQO Q;  3CBO A;  3L2W A;  4OMQ A;  2VB6 A;  2E6N A;  1QVF P;  1C6V X;  1WPY A;  4WTO B;  4QVC A;  2XI9 A;  2LDM A;  1UFF A;  1UEC A;  4MZT A;  1Y0M A;  5LJ3 j;  5GAN 2;  2EJF A;  3CXC P;  4EPC A;  1XQH A;  4EIK A;  4M75 E;  2R5M A;  2JJ9 A;  3JCM e;  2OTL Q;  1KIK A;  3CCJ A;  1GFC A;  1K8A C;  3CCV A;  3S3M A;  1QWF A;  5LJ5 j;  4BI3 A;  1I8F A;  3I56 T;  2MAM A;  1WQ7 A;  1RL2 A;  5A2Q E;  3I55 Q;  4AMC A;  3C4S A;  5HKC A;  2D1X A;  5C0M A;  1Q7Y C;  2XIC A;  1BYM A;  1I5L A;  3TCJ A;  1RAG B;  2RHZ A;  1IRE B;  2M16 A;  1VQ5 Q;  4EDU A;  5IXF A;  2R5A A;  4A4E A;  5KH6 A;  3P8D A;  4C5H A;  1NM7 A;  1IGU A;  2BZX A;  4OMO A;  4C8Q E;  1ZSZ C;  1VIE A;  1G3W A;  2RJD A;  4HT8 A;  4FCY A;  1MNE A;  5IAY A;  2DYB A;  3NFC A;  4M75 D;  3TRE A;  4IUP A;  2LX9 A;  3MJX A;  3AT1 B;  4KUD K;  2X4X A;  1U3O A;  2LCC A;  2COY A;  5HK0 A;  2K4Y A;  2XG8 D;  2YXY A;  1JB0 E;  1VQ7 A;  3L2Z A;  2EYZ A;  4R56 A;  1X27 A;  4OB2 B;  4MZM A;  1A0N B;  4N0A A;  1HXD A;  4C0G A;  2QEX Q;  2F5K A;  3ZEH A;  4MDX A;  2ZGW A;  4GLM A;  5GAN 4;  1WFW A;  3RKX A;  2MWP A;  5DLQ E;  5GJV B;  2B86 A;  3OYE A;  3G71 T;  4C8Q D;  2MWO A;  2P4T A;  3JCM W;  2DTI A;  4M7D F;  1SRM A;  1AOJ A;  1T3S A;  2RI5 A;  3CBP A;  2WAC A;  3OS2 A;  1YWP A;  4C5G A;  2EYX A;  3REB B;  2ZAE A;  1JBM A;  1OOT A;  2DL7 A;  4E7S A;  3EG9 B;  1PRL C;  1DJ7 B;  4ESR A;  2Y4X A;  4D8K A;  4BY6 B;  2DXT A;  3GOX A;  3CCS Q;  2LMJ A;  2EQM A;  4J6Y A;  2CSQ A;  3ME9 A;  2V1R A;  1JJ2 P;  5IHI A;  4DBF A;  4KH1 B;  2DXB A;  4F7U G;  1WLP B;  2M51 A;  1OPK A;  3OS5 A;  1FMV A;  4LN2 A;  3MCA B;  3RBB B;  3VS1 A;  2RQR A;  3OMG A;  1G3Y A;  1G5V A;  2LJ0 A;  3LX7 A;  4V2S A;  2PVO B;  5KCH A;  4EMK C;  2FZC B;  5IHN A;  4RUG A;  2JTM A;  2HD0 A;  3SD4 A;  2D6F A;  2PTK A;  3HL8 A;  2VVK A;  1XJW B;  1K9M C;  1J3T A;  1ZHI A;  2JW4 A;  1R77 A;  4M7D A;  2DE0 X;  3MEU A;  1U1S A;  3HSB A;  3OB9 A;  2FPE A;  2KSS A;  5DM7 R;  1VQP Q;  5I2S A;  2C06 A;  2ZPE B;  1D0Y A;  1AVZ C;  1G3T A;  1IO6 A;  2OAU A;  2EQK A;  1PM3 A;  1Z9Z A;  3H41 A;  1M27 C;  3OY9 A;  4FYW B;  2PNI A;  2F2V A;  5GMK l;  4QW2 A;  3CC2 A;  2HL3 A;  1LPL A;  1C1A A;  2I2L A;  1VYU A;  3H0F A;  3UA6 A;  1YBY A;  2K79 A;  3CPW A;  2DVJ A;  3JCM g;  5KYY A;  3M58 A;  4LDW A;  3FIF A;  5KE2 A;  1D3B A;  4M75 G;  4A4G A;  2GBQ A;  5FU6 B;  5GMK h;  1VQ6 A;  2CUB A;  3EH1 A;  3QYH B;  5CKB A;  5GAN 7;  1OU8 A;  2ENM A;  1ZUK A;  3QBY A;  4OP0 A;  2CGH A;  3JCM Q;  1OZ3 A;  3FJ5 A;  4XTV A;  2KXC A;  3VS6 A;  4BE0 A;  5CQY A;  2EKH A;  1O75 A;  1Y96 A;  4JLI A;  4M75 A;  3VKI A;  5GAN 8;  3DLL A;  3MEW A;  3PVQ A;  1TS9 A;  2DD5 A;  2GCX A;  2RH2 A;  3HP9 A;  3NTH A;  1RAE B;  1KHI A;  2JVV A;  4HVU A;  1YJ9 Q;  1QP2 A;  2E3I A;  2GQI A;  1WNL A;  5J3B A;  3HRU A;  5GJW B;  4C8Q G;  4E7Z A;  2DIQ A;  2EYW A;  1H8K A;  2HCK A;  5GMK j;  1UUE A;  3VS2 A;  1IRX A;  3BE3 A;  1NYF A;  1Q86 R;  1M8V A;  1NZ9 A;  4M78 F;  2NUT B;  4M4Z A;  2RM4 A;  4BI4 A;  3EFO A;  5CKD A;  1X2Q A;  2PUO B;  2O88 A;  3V7S A;  4EMH A;  2LP5 A;  2GTO A;  3JB9 F;  3CME T;  4QQG A;  2H3E B;  1Q82 U;  3BFM A;  4Z02 A;  3NTK A;  1UEB A;  8AT1 B;  3CCM Q;  2E70 A;  4PJO F;  2O4X B;  5FU6 C;  3VJP A;  2XKO C;  1N8R R;  2FRY A;  2QQR A;  3L42 A;  1WHH A;  4QQ6 A;  3M5A A;  4B6M A;  4ZGJ B;  4OMN A;  2CDT A;  1YIJ T;  2VKN A;  1VOM A;  2HDA A;  4IIM A;  2M02 A;  2ZPG B;  2JN0 A;  3OQ5 A;  1D09 B;  4J9B A;  5FWB A;  4IIO A;  3RER A;  2DVE A;  2P0K A;  2YDL A;  2A0F B;  3M57 A;  1LVK A;  4FW1 A;  4AG1 C;  4LDV A;  5GAN e;  4X1V A;  2YRC A;  1M1K R;  1ZSZ A;  4F16 A;  2KR3 A;  3CCJ T;  4N4I A;  3WVD B;  1VQP A;  3MP8 A;  4C0D B;  3CCV T;  2X51 A;  1N8R U;  3PE0 A;  2QTV A;  2OTJ Q;  1N6A A;  1TUC A;  2HBW A;  5FLX E;  4RTZ A;  2Y4Y A;  2O9V A;  2RB6 A;  5A0L A;  3H9N A;  4RG2 A;  1PKT A;  2DL5 A;  4RCB A;  3M55 A;  3X24 B; 
#chains in the Genus database with same CATH homology
 1JJ2 P;  3CD6 Q;  2QA4 Q;  1M1K R;  1VQP Q;  1M90 R;  3CCU Q;  1QVG P;  3CCE Q;  3G71 Q;  1YJN Q;  3OW2 P;  1Q86 R;  1NJI R;  1Q7Y R;  1Q82 R;  1VQN Q;  3CCM Q;  3I55 Q;  2QEX Q;  3CXC P;  1YIT Q;  1KQS P;  1VQK Q;  1VQ6 Q;  3CME Q;  1VQM Q;  1K9M R;  1YIJ Q;  2OTJ Q;  1Q81 R;  3CMA Q;  3CCL Q;  3CPW P;  1K73 R;  1N8R R;  3G6E Q;  1S72 Q;  1VQL Q;  3I56 Q;  1VQ4 Q;  3CCS Q;  1YJ9 Q;  3CCJ Q;  1VQ5 Q;  1KD1 R;  1VQO Q;  2OTL Q;  3CC2 Q;  1K8A R;  3CCV Q;  3CCQ Q;  1VQ7 Q;  1KC8 R;  1YI2 Q;  1W2B P;  3G4S Q;  3CC4 Q;  3CCR Q;  1YJW Q;  3CC7 Q;  1QVF P;  1VQ8 Q;  1VQ9 Q;  1YHQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...