3G6EV

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3g6eV00
1S72V 2OTLV 1M90W 3G4SV 4WFAV 3OW2U 1Q82W 3CCMV 1VQMV 4WCEV 1VQ4V 1M1KW 1R73A 1YI2V 1VQ8V 3CC4V 1YHQV 1K9MW 1QVFU 1VQOV 3I55V 1K73W 1KQSU 3CC2V 1VQNV 3CCUV 1NJIW 1YJNV 4WF9V 1JJ2U 1YITV 4WFBV 3CD6V 1YJWV 3CCVV 3CCJV 1K8AW 3CMAV 3CC7V 2QEXV 3CCSV 3CCQV 3CCRV 1YJ9V 1KD1W 1VQ9V 1VQLV 3CPWU 1VQ6V 3CMEV 1VQ5V 1N8RW 1VQ7V 2D3OW 3G6EV 2QA4V 1VQPV 3CCLV 3G71V 3I56V 1YIJV 5DM6V 1KC8W 1W2BU 1Q86W 1Q81W 3CCEV 1QVGU 1VQKV 1Q7YW 3CXCU 2OTJV
chains in the Genus database with same CATH superfamily
1R6KA 4O4IA 1V54C 4IL6Z 2Q7GA 4LNUA 1V55B 2JGDB 1BMFG 2ZIOA 1YZBA 4AQYB 1I08A 1OCRC 1H2NA 4O4HB 3K06A 1SRYA 4X1KB 2YIAA 1WN7A 2CGOA 4AHCA 1R1BA 3B2EE 4OX9O 1URFA 5KAIZ 4X1IB 4DR1B 4BWAA 1G8MA 1M90W 1K7DA 2GTAA 3G4SV 1GM9A 5H6RA 2ZCEA 4UXNA 2PF4E 3GB7C 1Y74A 4UCUA 1MZFA 4WFGA 3W7XA 4AQYO 2P22C 3DXRA 1FFTB 4MVZA 4D7TA 3ZHVA 1JX9A 1AJQA 5ITZA 5JJJB 4LF9B 1GN2A 5BR8B 2X6CA 3SJAC 1WJZA 3E22B 4DYLA 5DECA 1MA1A 4DR1O 3P3NA 1NH2D 1ZX3A 3T1YB 4ZHQA 2VWKA 4B7EA 3CJHA 1K9MW 2IJIA 1IX9A 2R70A 4UCSA 4UVAA 1FXKB 5BR8O 1CPYA 1Y66A 1ZL8B 2WAMA 1KUQA 3T1YO 3SJQC 3H1JH 1KKCA 1E1RG 2K1EA 1I94O 3W7WA 4ZKIA 1U97A 3E8HA 2CTPA 1V54B 4IIJB 3QO5A 1F4NA 4XDLA 3CCRV 5L3CA 5KHKA 2IJJA 1VQPV 1TVKA 1RFYA 3E8GA 1EBOA 1COWG 1S72V 3ZRWA 1QR8A 4LF5B 3WB2A 2VQFB 4JI6B 2YXHA 5B1AC 4O4IB 4C7UA 2QR4A 1HNZB 4Q6GA 4LNUB 2PYJA 4CC5A 1SF9A 1WPBA 3VQXA 2FKXA 4J9ZB 2IJKA 5KUMA 5EC1C 4XBFA 2ZM6B 4FMTA 2VQFO 3BVOA 3JARA 4JI6O 5EIBD 1F23A 3TXSA 3RBZA 1HNZO 4MVRA 4JI0B 5KAFZ 5CBFA 3FKSG 1G1XB 3DXRB 3BA8A 3AEIA 3KCYA 3WG7C 1Y4MA 2ZM6O 5ITZB 1XMOO 2A0LA 3BAAA 1OCZC 2GV9A 3ASOB 1Q82W 3ZEDA 3RVYA 1QVFU 2IH1C 3RW0A 1WB7A 5JQGA 3K59A 1PV0A 3KKYA 1AI7A 4ICGA 5IJ9A 1Z5WA 4TQFA 2NN4A 4NTYA 3FB7C 1MSDA 3CWBH 5L3EA 4PHZA 5EIBC 3M99B 2XAJA 3IAYA 4UVBA 2QGNA 1JVMA 3OMAB 3OR6C 4JGSA 3IJ4A 4PDLA 1KP2A 4FLXA 1I5YA 1EN5A 1QNMA 1NR7A 4J11A 3JASA 4U3JA 1WP8A 1P84F 1AI6A 2EIJC 5B1AB 4IT5A 4NXNB 3K5MA 1AI5A 3K08A 4KP4A 1VIBA 1IBLB 3K5OA 3LDEA 3ZRWB 4MTOA 3RT3C 1DK1A 3DGEA 4TT3G 1R3JC 5GTHZ 2QKCA 4NXNO 4RQFA 4LBEC 1BHAA 3JD1A 1SQPH 2WLMA 2V7QG 4GT1A 2MK3A 2ITCC 3WB0A 3BY6A 4G27B 2X0LA 4NTWA 2CH7B 2OCHA 5CA0A 4W4LA 1IBLO 4E2LA 3WG7B 2WPDG 4CS3A 1OCZB 3I5DA 4O4LA 3JARB 2WA3A 4LH7A 1X59A 1ZAUA 3GVMA 2RCVA 3RYFA 4DW1A 3G6BA 2H3OA 2QKSA 3CB2A 2UUCO 3JD2A 3GWKC 2ZE5A 3ZRVA 1YJWV 3CRCA 3BRCA 3K04A 5A2QN 1KYOF 1S5HC 4PDRA 1SQVH 2FL4A 5JQGB 1NT2B 2QM4A 3WB1A 2KKWA 5L3BA 1Q81W 3CCEV 5J9PC 5B1OA 1ZWIC 5CN0A 3U10A 2QM8A 3CC4V 1S5JA 3QVNA 4DR2B 3VQYA 2A7WA 2P67A 5L3FA 1XI1A 5FNVB 3JAKA 2Q7EA 5IDJA 4LH6A 4U3JB 3ZMTA 4B3MB 4F6RA 5KHIA 2VS0A 2ZXWB 1SKVA 2AW9A 5GONA 2R72A 2V1DA 5CB4A 3K9AA 1WP7A 3JD3A 4X66B 2LJ2A 5EZYB 2ARHA 3X2QB 1VQ9V 4PV1B 3VQWA 1YDXA 3H1LH 1X4TA 1NI8A 4B3MO 2JGUA 3E35A 2Q69A 4NB5A 5EYPA 4NXMB 1FXHA 1TAEA 3AG4C 2JJ2G 2XAFA 2OWOA 2EIKC 1R3IC 4F4LA 4R50A 3ML0A 3K5NA 3OT7A 4X66O 4QIWF 2KG7A 4CH5A 1B3QA 3K58A 2QEXV 1VMGA 2ODMA 1ORQC 4HAMA 1HWYA 1FPOA 4O4LB 3HKCB 4NXMO 4K0KB 3F7YC 1MNGA 3HB3B 3K79A 2XUMA 1IBMB 2YS8A 3UT5A 4R8CA 3BHPA 4G28B 4HZ3A 3VQVA 1YTFD 4OPHA 2X6AA 3LDCA 3B77A 4DW0A 1BGYH 2H94A 4F6EA 2Q6AA 4PA6A 3JCUZ 4WBNA 4Z1MG 4K0KO 3A0HZ 3F5TA 4J41A 1NU1H 4FM0A 1MMMA 4MT8A 4HNAB 2ETNA 1P7GA 5IYCO 1IBMO 3E8BA 1PL4A 5LGUA 3OTOO 3K5LA 4Z2WA 2ZR2A 1AVMA 2BTOA 2RJZA 1QLEC 2PI5A 3HKEA 3D36A 5LP6A 4JI1O 4EB6A 1WA8B 4DV5O 3JAKB 4JASA 4J7JA 4N23A 2GUZB 3BCCH 4GX2A 4RAIA 1Y67A 1GH6A 3SYQA 1P49A 2UUBB 3SYAA 1FYJA 3FB8C 5IYZB 1K34A 4CH3A 3K0GA 1Z2GA 5L3DA 2EIKB 4DK0A 5EK0A 3D36C 5LP6C 4EEQA 3QF7A 1VQ5V 2EIMC 4JI5B 3UM7A 5IYBO 2UXCB 1M5IA 3I56V 1S77D 5BZBA 2Q0AA 2UUBO 3ZX6A 5BXZA 5B1BB 3HKDA 4MVSA 3L72H 4PI0A 5EYPB 1BL8A 4IGGA 4LCUC 2Q7HA 4LWSB 1SQBH 4WFFA 4H33A 1JFFA 1PNMA 1WPXA 1KMIZ 2WLHA 4XDKA 3ZHSA 4G2KA 2Z5UA 2KG7B 1XREA 2QA4V 4TOIA 3QO7A 1GK9A 1HNXB 3ZHUA 4XDJA 1PL0A 4RQEA 2GHYA 3STLC 5K1XA 1I5XA 1YHQV 1Y6XA 4L8JA 1QHTA 4U7OA 4WFBV 5B3SC 1B6QA 3CC7V 2VWJA 3AK3A 1L0NH 3MHSC 2ZKOA 3UT5B 3CMEV 3CS5A 5IJ0A 1GRJA 2WLKA 4PDMA 5CBGA 4GCZA 2CAZC 1HNXO 4I50B 4DUYB 5JH7A 4DV6B 2BSKB 4WBNB 2CDYA 2Q67A 1H8HG 2IM9A 4CC6A 1SA0A 1NJIW 1YITV 4ASUG 3CMAV 2H8PC 4I9WA 1HNWB 5EBLC 3A2FA 1HP8A 3H01A 2XTAA 4CS2A 2YXLA 2XASA 3TCUA 5LHIA 5LHGA 3LNNA 1N0NA 2CUGA 1VQKV 4JI7B 2QDOA 1MZEA 5LP6B 1SQFA 4JV5B 4DV6O 1AR5A 5KHGA 4FLVA 4FM1A 4D6TH 5H9CA 1PNKA 1SQXH 2O57A 4YIOA 3FYEB 3APOA 3ZS8C 2JS3A 3CP1A 1Q5OA 4DXWA 1Y76A 2LFSA 4LR3A 1HNWO 4MVUA 2QWNB 1R3KC 1DTOA 4JI7O 4JV5O 2ZINA 3F5WC 4J42A 3MAQA 3O65A 1N33B 1M57C 2A9HA 3L9DA 1MOFA 4LF6B 3HKDB 4ZOLA 3J7AU 1D2DA 1HDJA 5LYJA 4JI2B 4HBNA 4DR6B 5B3SB 2KB1A 3BEHA 1W2BU 4KXRA 1GN4A 2JIZG 2EJRA 2R9IA 1DF4A 3H1IH 4EFBA 2EZOA 3SPHA 3OE7G 4TQDA 3S3XA 3SGIA 5KMGA 1N33O 2UXBB 1SC5B 1K73W 2WSSG 3EXAA 4J9YB 5LXTB 1S76D 1YEWA 4LF6O 2GTSA 3HKBA 4JI2O 3CHXA 3E83A 4I5SA 2QM7A 2CTQA 4DR6O 1EM1A 2P4KA 1NTMH 4TV9A 4P30A 3ASNC 2UXBO 4DRXA 1D5AA 2XNDG 3TK1A 2A3QA 3CRRA 4ZI7A 3N2GA 1I94B 2PYLA 2F93B 1TGOA 1VEWA 4JI3O 5TISZ 1WNSA 4FPPA 1A32A 1VQ7V 3ZN0A 1GM7A 4AI8A 1AR4A 3CRMA 3FAVB 4O4JB 1JCHA 2Z3YA 2BCCH 3ZBHA 1YVWA 4PELA 2E74B 2HLDG 4IHJA 1QCEA 1VF7A 2QKAA 5D5QA 1M57B 1Y76B 3CCLV 1KC8W 2XAGA 4MW8A 1FKAO 1OCRB 4ZBMA 3ZMVA 2Q8VA 5D5PA 2RMKB 4K35A 4P9PA 2UXXA 1FD9A 4UV9A 1XHXA 3UQ8A 3OR7C 3PJSK 1WB8A 2Z0AA 2P90A 2LGWA 5EBWC 1H38A 1XMOB 2JK5C 5LGNA 5LMUB 1H2GA 3D8CA 1YXBA 2Q68A 4JAAA 3ZHRA 3CCVV 1N34B 5KMGB 3ASNB 2JEXA 3JSLA 1KECA 2DYSC 1Y74B 2F95B 1OJHA 1K97A 1ZUQA 4I7ZB 1YIJV 1T5EA 5DM6V 1BS3A 3STZC 1Q90D 1Q8IA 2X7RB 1G4YB 2YIBD 5LMUO 4BAYA 3K03A 4TV9B 1RSOA 1N34O 1AILA 4ZHQB 3CJHB 3SR2C 1VQLV 1NTKH 4ZI7B 3P30A 1YCIA 1ZSPA 3FD9A 2RDCA 2YIBA 4H37A 1Q86W 2EILC 3B09A 4CBCA 4I9QA 3O9OA 1MABG 4GX0A 3RN4A 1RPRA 1XL4A 1ZLZA 1NH2B 1WAZA 1AB3A 3L74H 2F4VB 2DW4A 5FLXN 4NKGB 3W7UA 4B3RB 2QTOA 1KU9A 3IFXA 1K5SA 4QPJA 4CS4A 1TUBA 1F7YA 1XL6A 2WLNA 5JVDA 1TVKB 3AG1C 2F4VO 4GX1A 2P06A 4QJFB 3CYOA 3JATA 4PA3A 1IVSA 4B3SO 1L1FA 1BE3H 2Y48A 5H5NA 3FYIB 4D7SA 3OUSA 1L0LH 1FJGB 3DTUB 4GYCB 2Q5ZA 1XOUA 4B3RO 3G6EV 2ILMA 3P32A 1L8DA 4O2BA 2DYSB 2UUCB 1GO3F 1R73A 1KKDA 4DV1B 2Q9LA 2FB5A 1Q3EA 2F1MA 3NXSA 4LF4B 1FJGO 2KSDA 3W7SA 3T1HB 4FLYA 5KHJA 2P5OA 4DR4B 3JALA 1XEQA 4UCTA 4CH4A 1CEZA 4LFBB 2Q73A 3RYCA 4NR1A 4DV1O 4MVOA 1P4RA 2EILB 5B5EZ 4LF4O 1ENVA 4EKWA 1S5LZ 1TUEB 3T1HO 1K4CC 2N74A 4TSFG 2HVKC 4ZIBA 4WFEA 3JAWA 4DR4O 1G6UA 4E4EA 2XHBA 5IJ9B 4X89A 4LFBO 2XAHA 2EIJB 3DC5A 4YJ2A 4MTXA 4I55A 1LUWA 4LFAB 5CA1A 4PD4F 3OGCC 1RPOA 3U0ZA 1XHZA 1Q6UA 3RYHA 2ITDC 1H2MA 1J5EB 5CA3A 3TETA 1N0JA 3G67A 1F51A 3CX5F 1FAFA 1M93A 3AG2C 2G38A 4QE9A 3JASB 1YF2A 1BQZA 2AXTZ 1M1KW 4LFAO 5GTIZ 4TWKA 1TUBB 3MHHC 2HJDA 1J5EO 4JF3A 1K8AW 4UVCA 1VP7A 2NNUA 5JVDB 2XAQA 1PP9H 5IT9N 4KFMA 3OAAG 2Y4TA 4J7ZA 3BFRA 4I4TA 3HPLC 4K8XA 2P4VA 1AJNA 4O2BB 2YEVA 2YDEA 2CTWA 5DN6G 1W0JG 5CA0B 4HYOA 4B3TB 2UXNA 3LSQA 2DQ3A 1IXMA 3ABKC 1QVGU 4X65B 3QNEA 3QG5A 2QWOB 4QGPA 3TGUH 5J2UA 1AP6A 3JALB 3RYFB 1M9NA 3OTOB 1FFXA 2ZIMA 3CCUV 4DUZB 5LOVA 3RYCB 3SDLA 5B66Z 1GM8A 2W6IG 2HP8A 1CP9A 3N27A 4B3TO 2Y69C 1OZ0A 4JI1B 1BSMA 4JYCA 4JTAB 2HHHB 4I0XA 4R7CA 4DV5B 2QWPB 1JPXA 3SJBC 4X65O 3JD4A 4FZ0A 1GN6A 2B1IA 3AG2B 5J2TA 1P7BA 3ABMC 3FB6C 4GKJB 3IC9A 4DUZO 2P7TC 1U96A 4LFCB 4YJ2B 4BIUA 3B40A 1BCCH 5E1AC 1N36B 4U7NA 2BOBC 3JCZA 3OUFA 1KP3A 1B04A 1JMKC 2HHHO 3RYHB 4K3AA 2OT5A 3EHBB 5KA5A 4L87A 2IBZH 5LMNB 4GLXA 2BE3A 3FFQA 4F6RB 1PNLA 2B9ZA 2B5UA 4GKJO 4LFCO 3H1KH 4PJ0Z 3AG4B 5GONB 4GKKB 2W6JG 1N36O 2CGNA 5CB4B 1H2KA 3B8NA 1AP5A 1IZ3A 1US6A 3OGIB 2QJ1A 5LMNO 1QQCA 2DOSA 3OMIB 4JAUA 3ABTA 4OGQB 1DGSA 2LGQA 1YJNV 4GKKO 3ZHQA 5DEDA 4FLWA 2Y0IA 4B7KA 1W0KG 3CRQA 2FMLA 1LR1A 2BOCC 2YEVB 1I0HA 4QNHB 4UCRA 2YSUB 3BABA 2QWQB 1QLNA 2Y69B 4JPRA 2YXYA 4X20A 4JYBA 2DN9A 4KHPO 2N05A 1XDCA 1ZTEA 2BTQA 1ROPA 4DV7B 1SQGA 3RGBA 3U11A 4X1IA 3MD0A 3M7MX 1DLBA 4RO2A 1XQ8A 3ABMB 1FFXB 4MTGA 3BA9A 1GKFA 4J7KA 3AG3C 3ZRXA 1V55C 3H9VA 3ZMZA 2OTLV 1QLEB 4X88A 4I0XB 4GX5A 4JI8B 2QTSA 3KG2A 4DV7O 3GWOA 3JYCA 1F4MA 2JJ1G 2B1GA 5JCOA 1YTFB 5J2TB 5IY5C 3K9SA 2PGGA 1KBHA 3UO3A 1AJPA 2GBOA 1HR0B 2M6YA 2R9RB 1NZ6A 1SZTA 3HKEB 4EB6B 5F2VO 2ZNIA 2EIMB 3SJCC 3UKMA 4FFKA 3SPGA 4JI8O 1FXKA 3QO8A 1E79G 4YJ3A 4DV4B 2PI4A 5JCOC 2JS5A 3DC6A 3CCSV 3RYIA 1LNQA 3LDDA 5IWAO 2YI9A 1BQ0A 2WLLA 1NS1A 2RNBA 4JZ2A 1HR0O 2NLJC 2LP7A 3PN1A 1OCCC 4FLTA 1AI4A 3E89A 4OPAA 1XNRO 2DE0X 4KL1A 3THOA 1FXKC 4J80A 4DV4O 4P2ZA 1XNQB 3L71H 5FL7G 4UCVA 1PM9A 4H44B 4J10A 2JVDA 5C8YA 4YY3B 1FXVA 3APQA 1IXBA 1JFFB 1SERA 5BY1A 2YICA 5H2FZ 4DR3B 4MW3A 3AG3B 1VQ8V 5KLVH 1JJ2U 1XNQO 4X20B 4JI3B 4FVMA 3CEIA 2BTQB 2QWRB 4YY3O 4PI2A 3SPCA 1FS0G 2ADPA 1EZVH 4MVQA 5IY5B 2ZT9B 4H0LB 3RFRA 5IJ0B 4DR3O 3T4DA 4UUJC 2DWDC 5JH7B 3OTFA 3MDSA 2E3CA 2MW2B 2F66C 1SA0B 2WLJA 2OYQA 1J95A 3G71V 4X1YA 2KQXA 4GZRB 3K57A 3ICXA 2Y4UA 3RVZA 2RN9A 4K8ZA 3T1CA 3H1HH 2W0XA 2JRIA 2HFEC 4JTDB 1OCCB 1S0VA 1MSWD 1YJ9V 1EZJA 4LF9O 2YI8A 3ETDA 4MSWC 3ASOC 3CPWU 1N4CA 4YJ3B 4JAVA 2E76B 4JZGA 1W59A 5A9GA 1N32B 1OCOC 2V4DA 2DJVA 3RYIB 1IURA 1Q7YW 3P3PA 5K1PA 4AILC 1UFIA 2WLLB 3OMNB 4LC1A 1SESA 3OFNG 2RQ6A 5KHHA 2HR3A 2UUAB 2UXDB 2LW7A 1M4UA 2N04A 4FK5C 4OXSA 1GN3A 4UB6Z 3ZMUA 1KD1W 1THZA 3ZJZA 3ABLC 4MS2A 2L35A 5EBMC 2LW1A 4O2AA 1N32O 4ZOLB 1RM1C 5IYDO 2YC0A 4FLZA 5LYJB 1LUVA 1SS3A 5C8YB 2DYRC 1EN6A 4CZZA 3D3QA 2UXDO 2UUAO 1KQSU 3FX7A 2QSAA 2FYUH 4LF8B 4TV8A 1DF5A 1I7FA 1K33A 4BW5A 4YXWG 3OEEG 2CH7A 1UPGA 2Q0OC 5E79Z 2VQEB 4LF5O 3HKBB 1SETA 3A8TA 2OIEA 2PTMA 3TJTA 4B08A 3I55V 4UB8Z 4LF8O 1PKXA 5LA6A 4Z1VA 4DRXB 2A06H 4R6ZA 3N2GB 2WA4A 1MG1A 3K0DA 4IYIA 2VQEO 2ZR3A 4PDVA 1Q6IA 2Q4PA 3J81N 1O9HA 1NTZH 4X1YB 4H13B 1OCOB 1R3LC 2EINC 2A79B 1PPJH 3OEHG 4JI0O 2XOKG 4B3SB 1WLEA 4NTXA 3K3WA 4U3FH 3Q4HA 3JD0A 2ZNJA 3IGAC 4IHJB 4X64B 2ZE8A 4Q20A 5C93A 3DSQA 3CE2A 3OD4A 3LSUA 4X62B 3ABLB 3LSSA 2GSMB 3B8MA 2F43G 5FNVA 2YUAA 3CSXA 4LP8A 3ZIAG 5KUKA 1RM1B 1E1QG 3EFFK 1O9GA 4DV2B 4LF7B 1H2SB 1PD3A 2DYRB 2PY5A 4X64O 1VF6A 1BT8A 4X62O 5CBHA 3SYCA 3IC7A 3UO2A 2AGAA 3CCMV 5EZYA 1K4DC 3LUTB 4O2AB 5KX5A 4DV3B 2IU3A 4DV2O 4LF7O 2P6JA 2LQTA 1Q6HA 2ZXWC 4PA4A 2E5LB 1VF6C 4TV8B 3AK1A 1KB9F 1BHBA 3T2MA 1RP3B 3WU2Z 4NYKA 3X2QC 3ABUA 4RUFA 2Y0PA 3AG7A 4DV3O 3E8FA 3LNMB 3HKCA 4FZ1A 2E5LO 1XILA 2D2CB 2EINB 2ZE6A 1RSOB 3R66A 5LA6B 3ETGA 1SZXA 3J80N 2IU0A 4MVMA 1GMGA 4BIZA 1OV9A 3AK2A 2HKOA 3E2EA 1M56C 1VF5B 2AHYA 1OHHG 5EC2C 1HW7A 3JAMN 3A0RA 4W4KA 4HNAA 2EJ7A 2WWWA 3AG1B 3ETQA 2YIDA 5GW7A 2DQ0A 2F23A 3Q4HB 3VOUA 2HJFC 4WCEV 2NR5A 2ATKC 3R65A 1WA8A 2JDIG 2L6LA 3E86A 4DV0B 2GUZA 1TA8A 1CXZB 1VQ6V 1AR1B 5H6QA 3JATB 3L70H 2AZ2A 2CE4A 2D3OW 4JTCB 2HG5C 2CK3G 1H8EG 5IYZA 4JI4B 2GDSA 2EBOA 1V9PA 1K5QA 3NR7A 3CXHF 4DR2O 4WF9V 1XUQA 4BR6A 4DV0O 4PA7A 1NVPD 5KX5B 4PA9A 4P9OA 1EFRG 1N8RW 4TUYA 1IBKB 3L73H 3QTCA 4DK1A 4JI4O 4FIPC 3N2KA 4UCOA 3F7VC 4LWSA 1YI2V 1VQOV 3UCSC 1NBMG 1SQQH 3A0BZ 4YIPA 2R9AA 2XT9A 5CMUA 1D5NA 3CRAA 5B1BC 1M56B 1IBKO 4JYYA 2ADQB 4A5UB 2PUSA 1NKDA 1R6TA 2ZD9A 2CTRA 2EZPA 2LO1A 3JAWB 5LBQA 2IW5A 2PZSA 3KCXA 3ZN1A 4NVPA 3CC2V 1XBLA 3VBBA 3B4SA 4I50A 4I55B 5CA1B 2BSKA 2OCCC 4BIOA 1Z5VA 3SYOA 2K9PA 2VRZA 4ABMA 2OTJV 3OW2U 4WFAV 1S3JA 3EVKA 2X6BA 2IH3C 4DR7B 3CD6V 3D3IA 3C3SA 2HVJC 3G80A 3SPJA 3CCJV 2C2AA 3WFVA 2JEUA 2E75B 4X8AA 3ZCCA 2ZQMA 2WLIA 5BMVA 3CXCU 1QR9A 1K3EA 3C90A 2HEPA 5JJNB 1Q43A 4DR5B 1VQ4V 1JOYA 3ABKB 4FJCC 2QE7G 2EX3A 4I4TB 2ZDIA 5AG2A 4KHPB 4DR7O 4MTFA 1QBZA 3BPZA 3CCQV 4FFBA 4IYHA 5FPOA 1BZKA 4CH6A 3OM3B 1QU7A 2IJHA 4FLUA 3T4ZA 2JGDA 4TUYB 4DR5O 1VQMV 3L75H 1R6NA 1K92A 3SYPA 4O4HA 2ZE7A 2AZ0A 4JYAB 4X1KA 2ZDIC 3N2KB 2UU9B 1VQNV 4QE7A 5J2UB 1AROP 1NVPB 4JI5O 2UXCO 4EFEA 1H2LA 5LOVB 2M7WA 3JSNA 1YSCA 5HFMA 5LXTA 5LGTA 1NQTA 4KUMA 5L3GA 4X9QA 2OCCB 1JJOA 4JYAO 1EN4A 5B1NA 2UU9O 4RUEA 4QPKA 4YHHB 1GTOA 4RWUA 3W7TA 2W0FC 3E22A 1GAXA 3M8AA 1JQ0A 1NR1A 3FB5C 2OIGA 5IWAB 3HR0A 4FM2A 3C3TA 3ZMSA 5HFLA 3KZIZ 1XNRB 4WFHA 4YHHO 5JJEB 2DMXA 2EULA 3RWRD 3S3WA 4BW9A 1UJWB 1IDSA 1ZL8A 4O4JA 1JA8A 3FAVA 2DWEC 5LHHA 1XMQB 5JWPA 3ETEA 4DUYO 5LL6Y 4UFZA 4IIJA 4GUNA 5KA6A 2WLIB 4DO2A 3ZRSA 2AHZA 5BMVB 1VARA 3ZHTA 3SPIA 4N21A 1B06A 2LFRA 4UV8A 3TXQA 1JR9A 1XMQO 5FPRA 4OX9B 2FTKA 4FFBB 5IE9A
chains in the Genus database with same CATH topology
3SYQA 1SETA 1R6KA 2XAHA 2EIJB 1V54C 3SYAA 4MTXA 3FB8C 3I55V 1K34A 3OGCC 3K0GA 1RPOA 1V55B 1BMFG 1PKXA 5L3DA 2ITDC 2EIKB 1OCRC 5CA3A 3TETA 3K06A 5EK0A 1SRYA 1F51A 1VQ5V 2EIMC 4R6ZA 3UM7A 3AG2C 5IYBO 1MG1A 3K0DA 3I56V 1S77D 4QE9A 5BZBA 2ZR3A 4PDVA 1G8MA 1M90W 1K7DA 3G4SV 1GM9A 5B1BB 5H6RA 4MVSA 1M1KW 4UXNA 1OCOB 3GB7C 1BL8A 4TWKA 1R3LC 2EINC 2A79B 4LCUC 3MHHC 4WFGA 3OEHG 3W7XA 2XOKG 1FFTB 4JF3A 1WLEA 4MVZA 4WFFA 4UVCA 1K8AW 4H33A 1JX9A 1PNMA 1WPXA 1AJQA 2NNUA 3K3WA 2WLHA 2XAQA 4XDKA 3JD0A 4KFMA 3OAAG 4G2KA 3IGAC 2Z5UA 2X6CA 4Q20A 2QA4V 5C93A 3QO7A 1GK9A 3ABLB 3LSSA 2GSMB 3B8MA 3HPLC 1NH2D 2F43G 4XDJA 1PL0A 4RQEA 2GHYA 4LP8A 3STLC 3ZIAG 1I5XA 1YHQV 1K9MW 1AJNA 5KUKA 1RM1B 1E1QG 3EFFK 4U7OA 2IJIA 2YEVA 4WFBV 5B3SC 1PD3A 2DYRB 1B6QA 3CC7V 5DN6G 1W0JG 3MHSC 4UVAA 3CMEV 4HYOA 1FXKB 2UXNA 2WLKA 3LSQA 4PDMA 5CBGA 2DQ3A 1IXMA 3ABKC 1CPYA 1Y66A 4GCZA 1QVGU 5CBHA 3SYCA 3IC7A 2WAMA 3QNEA 3CCMV 3SJQC 1K4DC 3LUTB 2Q67A 1M9NA 1E1RG 1H8HG 2K1EA 2IU3A 3W7WA 4ZKIA 3CCUV 1NJIW 3E8HA 1YITV 2P6JA 1V54B 4ASUG 2ZXWC 1F4NA 3QO5A 1GM8A 2H8PC 4PA4A 4I9WA 3CMAV 4XDLA 2W6IG 3CCRV 5EBLC 5L3CA 1CP9A 2Y69C 1OZ0A 3H01A 4JTAB 4JYCA 2IJJA 2XASA 3TCUA 5LHIA 4R7CA 5LHGA 1VQPV 1BHBA 1JPXA 3E8GA 1EBOA 1COWG 1VQKV 1S72V 3T2MA 3JD4A 3ZRWA 1QR8A 3X2QC 3ABUA 2B1IA 3AG2B 5H9CA 1PNKA 4RUFA 1P7BA 3ABMC 5B1AC 3FYEB 3FB6C 3E8FA 2P7TC 3LNMB 3CP1A 4DXWA 4BIUA 2LFSA 5E1AC 4U7NA 2BOBC 3JCZA 3OUFA 1KP3A 2EINB 4MVUA 1R3KC 1DTOA 2OT5A 3EHBB 4J9ZB 2IJKA 3ETGA 5KUMA 5EC1C 5KA5A 4XBFA 2IU0A 4FMTA 4L87A 4MVMA 3F5WC 1GMGA 4BIZA 2HKOA 3E2EA 1M56C 1PNLA 2AHYA 1M57C 2B5UA 1OHHG 2A9HA 5EC2C 1MOFA 1F23A 3AG4B 3RBZA 4MVRA 3A0RA 2W6JG 3B8NA 2WWWA 3AG1B 5CBFA 3FKSG 5GW7A 2DQ0A 5B3SB 2KB1A 3AEIA 3BEHA 1W2BU 3WG7C 1Y4MA 2JIZG 2A0LA 2EJRA 2R9IA 1DF4A 3VOUA 1OCZC 2EZOA 3ASOB 2HJFC 3SPHA 1Q82W 3OE7G 3OMIB 4WCEV 4JAUA 2ATKC 3ABTA 3R65A 3RVYA 1QVFU 2IH1C 1K73W 2WSSG 3RW0A 2JDIG 4J9YB 1YJNV 1S76D 3E86A 1AI7A 1W0KG 1VQ6V 1AR1B 2BOCC 3E83A 3FB7C 2YEVB 5H6QA 4I5SA 2QM7A 4QNHB 2YSUB 2D3OW 4JTCB 2HG5C 2CK3G 1H8EG 5L3EA 2EBOA 3M99B 2XAJA 1QLNA 4P30A 2Y69B 1K5QA 4JPRA 4UVBA 1JVMA 3OMAB 3OR6C 4JGSA 4JYBA 4PDLA 3ASNC 1KP2A 2XNDG 3TK1A 1I5YA 4WF9V 1NR7A 1ROPA 4PA7A 1NVPD 3MD0A 4PA9A 4P9OA 1AI6A 1DLBA 2EIJC 4RO2A 3ABMB 4FPPA 1EFRG 4MTGA 5B1AB 1N8RW 1GKFA 1VQ7V 3ZN0A 1GM7A 3AG3C 1AI5A 3ZRXA 1V55C 3K08A 4FIPC 3ZMZA 2OTLV 1QLEB 1JCHA 2Z3YA 3F7VC 4X88A 4KP4A 1YI2V 4GX5A 1VQOV 4PELA 3LDEA 3ZRWB 2HLDG 1NBMG 4MTOA 3KG2A 1QCEA 3DGEA 1F4MA 3GWOA 3JYCA 2JJ1G 2B1GA 1YTFB 5CMUA 5IY5C 4TT3G 5B1BC 1M56B 1R3JC 1M57B 4RQFA 1AJPA 4LBEC 3CCLV 1KC8W 2XAGA 2R9RB 2WLMA 3JD1A 2V7QG 1OCRB 4GT1A 4MW8A 1BHAA 2MK3A 4ZBMA 2ITCC 1NKDA 1SZTA 2ZD9A 3ZMVA 2EZPA 3BY6A 2EIMB 4G27B 2X0LA 3UKMA 3SPGA 5LBQA 2IW5A 4P9PA 4E2LA 3WG7B 3ZN1A 2UXXA 3CC2V 1FXKA 2WPDG 3QO8A 1E79G 3VBBA 2PI4A 1OCZB 4UV9A 3CCSV 3OR7C 1LNQA 3LDDA 3PJSK 2P90A 2WLLA 2OCCC 2NLJC 2LP7A 3SYOA 5EBWC 1OCCC 2QKSA 1H38A 2OTJV 1AI4A 3JD2A 2JK5C 3E89A 1S3JA 4WFAV 3OW2U 2X6BA 5LGNA 1H2GA 1FXKC 2IH3C 2Q68A 3ZRVA 4P2ZA 3CD6V 3D3IA 3CCVV 1YJWV 2HVJC 5FL7G 3SPJA 3CCJV 3K04A 4PDRA 1S5HC 2C2AA 3ASNB 2JEXA 3WFVA 1KECA 2DYSC 2JEUA 4X8AA 3ZCCA 2ZQMA 1K97A 1YIJV 5DM6V 1FXVA 5L3BA 2WLIA 1Q81W 3CCEV 5J9PC 1SERA 5B1OA 3STZC 1QR9A 2X7RB 3CXCU 1K3EA 1ZWIC 1G4YB 5CN0A 1VQ4V 4MW3A 4BAYA 2QM8A 3ABKB 3AG3B 1VQ8V 4FJCC 3K03A 2QE7G 3CC4V 1JOYA 2ZDIA 5L3FA 2P67A 1JJ2U 4MTFA 1QBZA 3CCQV 5IDJA 1VQLV 3P30A 3OM3B 3ZMTA 4H37A 3SPCA 1Q86W 2ZXWB 2IJHA 1FS0G 2EILC 4MVQA 3T4ZA 5IY5B 4CBCA 1MABG 4GX0A 1VQMV 1R6NA 1K92A 2V1DA 1RPRA 3SYPA 1XL4A 3T4DA 1NH2B 4UUJC 3K9AA 2ZDIC 2DWDC 2DW4A 1VQNV 3JD3A 4QE7A 3X2QB 1AROP 1NVPB 1VQ9V 3W7UA 2WLJA 2QTOA 1J95A 3G71V 3IFXA 2M7WA 3E35A 2Q69A 1K5SA 1YSCA 1FXHA 4QPJA 5HFMA 5LGTA 3AG4C 1NQTA 4KUMA 2JJ2G 2XAFA 3RVZA 5L3GA 2EIKC 2OCCB 1XL6A 3T1CA 1R3IC 4F4LA 4R50A 2WLNA 5B1NA 3AG1C 3ML0A 4GX1A 2HFEC 4JTDB 1OCCB 4RUEA 4QPKA 3CYOA 4QJFB 4PA3A 1GTOA 1L1FA 1S0VA 1MSWD 2Y48A 4QIWF 3FYIB 3W7TA 3OUSA 3DTUB 2QEXV 2W0FC 1YJ9V 1EZJA 3ETDA 4MSWC 3ASOC 3CPWU 1ORQC 4HAMA 4JAVA 1JQ0A 1NR1A 3FB5C 1HWYA 3G6EV 1OCOC 1Q7YW 3F7YC 3P32A 3ZMSA 2DYSB 3OMNB 2WLLB 1GO3F 3HB3B 3K79A 1SESA 4LC1A 5HFLA 3OFNG 1R73A 1KKDA 2HR3A 4WFHA 4R8CA 4G28B 4HZ3A 4FK5C 3NXSA 4OXSA 1YTFD 2X6AA 3LDCA 3B77A 3ZMUA 3W7SA 1KD1W 1THZA 3ZJZA 3ABLC 1UJWB 4MS2A 2DWEC 5LHHA 2H94A 2Q6AA 4PA6A 3ETEA 5EBMC 4Z1MG 1RM1C 5IYDO 4MT8A 1CEZA 2DYRC 4CZZA 5IYCO 5KA6A 2WLIB 3E8BA 4MVOA 4DO2A 3ZRSA 2AHZA 5LGUA 1KQSU 1P4RA 2EILB 2ZR2A 1ENVA 4N21A 3SPIA 4EKWA 1TUEB 2LFRA 1QLEC 4UV8A 1DF5A 1K4CC 2PI5A 3D36A 1K33A 4BW5A 4TSFG 2HVKC 4YXWG 4WFEA 3OEEG 4JASA 4N23A 4GX2A 2FTKA 4RAIA 4X89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 V;  2OTL V;  1M90 W;  3G4S V;  4WFA V;  3OW2 U;  1Q82 W;  3CCM V;  1VQM V;  4WCE V;  1VQ4 V;  1M1K W;  1R73 A;  1YI2 V;  1VQ8 V;  3CC4 V;  1YHQ V;  1K9M W;  1QVF U;  1VQO V;  3I55 V;  1K73 W;  1KQS U;  3CC2 V;  1VQN V;  3CCU V;  1NJI W;  1YJN V;  4WF9 V;  1JJ2 U;  1YIT V;  4WFB V;  3CD6 V;  1YJW V;  3CCV V;  3CCJ V;  1K8A W;  3CMA V;  3CC7 V;  2QEX V;  3CCS V;  3CCQ V;  3CCR V;  1YJ9 V;  1KD1 W;  1VQ9 V;  1VQL V;  3CPW U;  1VQ6 V;  3CME V;  1VQ5 V;  1N8R W;  1VQ7 V;  2D3O W;  3G6E V;  2QA4 V;  1VQP V;  3CCL V;  3G71 V;  3I56 V;  1YIJ V;  5DM6 V;  1KC8 W;  1W2B U;  1Q86 W;  1Q81 W;  3CCE V;  1QVG U;  1VQK V;  1Q7Y W;  3CXC U;  2OTJ V; 
#chains in the Genus database with same CATH topology
 1R6K A;  4O4I A;  1V54 C;  4IL6 Z;  2Q7G A;  4LNU A;  1V55 B;  2JGD B;  1BMF G;  2ZIO A;  1YZB A;  4AQY B;  1I08 A;  1OCR C;  1H2N A;  4O4H B;  3K06 A;  1SRY A;  4X1K B;  2YIA A;  1WN7 A;  2CGO A;  4AHC A;  1R1B A;  3B2E E;  4OX9 O;  1URF A;  5KAI Z;  4X1I B;  4DR1 B;  4BWA A;  1G8M A;  1M90 W;  1K7D A;  2GTA A;  3G4S V;  1GM9 A;  5H6R A;  2ZCE A;  4UXN A;  2PF4 E;  3GB7 C;  1Y74 A;  4UCU A;  1MZF A;  4WFG A;  3W7X A;  4AQY O;  2P22 C;  3DXR A;  1FFT B;  4MVZ A;  4D7T A;  3ZHV A;  1JX9 A;  1AJQ A;  5ITZ A;  5JJJ B;  4LF9 B;  1GN2 A;  5BR8 B;  2X6C A;  3SJA C;  1WJZ A;  3E22 B;  4DYL A;  5DEC A;  1MA1 A;  4DR1 O;  3P3N A;  1NH2 D;  1ZX3 A;  3T1Y B;  4ZHQ A;  2VWK A;  4B7E A;  3CJH A;  1K9M W;  2IJI A;  1IX9 A;  2R70 A;  4UCS A;  4UVA A;  1FXK B;  5BR8 O;  1CPY A;  1Y66 A;  1ZL8 B;  2WAM A;  1KUQ A;  3T1Y O;  3SJQ C;  3H1J H;  1KKC A;  1E1R G;  2K1E A;  1I94 O;  3W7W A;  4ZKI A;  1U97 A;  3E8H A;  2CTP A;  1V54 B;  4IIJ B;  3QO5 A;  1F4N A;  4XDL A;  3CCR V;  5L3C A;  5KHK A;  2IJJ A;  1VQP V;  1TVK A;  1RFY A;  3E8G A;  1EBO A;  1COW G;  1S72 V;  3ZRW A;  1QR8 A;  4LF5 B;  3WB2 A;  2VQF B;  4JI6 B;  2YXH A;  5B1A C;  4O4I B;  4C7U A;  2QR4 A;  1HNZ B;  4Q6G A;  4LNU B;  2PYJ A;  4CC5 A;  1SF9 A;  1WPB A;  3VQX A;  2FKX A;  4J9Z B;  2IJK A;  5KUM A;  5EC1 C;  4XBF A;  2ZM6 B;  4FMT A;  2VQF O;  3BVO A;  3JAR A;  4JI6 O;  5EIB D;  1F23 A;  3TXS A;  3RBZ A;  1HNZ O;  4MVR A;  4JI0 B;  5KAF Z;  5CBF A;  3FKS G;  1G1X B;  3DXR B;  3BA8 A;  3AEI A;  3KCY A;  3WG7 C;  1Y4M A;  2ZM6 O;  5ITZ B;  1XMO O;  2A0L A;  3BAA A;  1OCZ C;  2GV9 A;  3ASO B;  1Q82 W;  3ZED A;  3RVY A;  1QVF U;  2IH1 C;  3RW0 A;  1WB7 A;  5JQG A;  3K59 A;  1PV0 A;  3KKY A;  1AI7 A;  4ICG A;  5IJ9 A;  1Z5W A;  4TQF A;  2NN4 A;  4NTY A;  3FB7 C;  1MSD A;  3CWB H;  5L3E A;  4PHZ A;  5EIB C;  3M99 B;  2XAJ A;  3IAY A;  4UVB A;  2QGN A;  1JVM A;  3OMA B;  3OR6 C;  4JGS A;  3IJ4 A;  4PDL A;  1KP2 A;  4FLX A;  1I5Y A;  1EN5 A;  1QNM A;  1NR7 A;  4J11 A;  3JAS A;  4U3J A;  1WP8 A;  1P84 F;  1AI6 A;  2EIJ C;  5B1A B;  4IT5 A;  4NXN B;  3K5M A;  1AI5 A;  3K08 A;  4KP4 A;  1VIB A;  1IBL B;  3K5O A;  3LDE A;  3ZRW B;  4MTO A;  3RT3 C;  1DK1 A;  3DGE A;  4TT3 G;  1R3J C;  5GTH Z;  2QKC A;  4NXN O;  4RQF A;  4LBE C;  1BHA A;  3JD1 A;  1SQP H;  2WLM A;  2V7Q G;  4GT1 A;  2MK3 A;  2ITC C;  3WB0 A;  3BY6 A;  4G27 B;  2X0L A;  4NTW A;  2CH7 B;  2OCH A;  5CA0 A;  4W4L A;  1IBL O;  4E2L A;  3WG7 B;  2WPD G;  4CS3 A;  1OCZ B;  3I5D A;  4O4L A;  3JAR B;  2WA3 A;  4LH7 A;  1X59 A;  1ZAU A;  3GVM A;  2RCV A;  3RYF A;  4DW1 A;  3G6B A;  2H3O A;  2QKS A;  3CB2 A;  2UUC O;  3JD2 A;  3GWK C;  2ZE5 A;  3ZRV A;  1YJW V;  3CRC A;  3BRC A;  3K04 A;  5A2Q N;  1KYO F;  1S5H C;  4PDR A;  1SQV H;  2FL4 A;  5JQG B;  1NT2 B;  2QM4 A;  3WB1 A;  2KKW A;  5L3B A;  1Q81 W;  3CCE V;  5J9P C;  5B1O A;  1ZWI C;  5CN0 A;  3U10 A;  2QM8 A;  3CC4 V;  1S5J A;  3QVN A;  4DR2 B;  3VQY A;  2A7W A;  2P67 A;  5L3F A;  1XI1 A;  5FNV B;  3JAK A;  2Q7E A;  5IDJ A;  4LH6 A;  4U3J B;  3ZMT A;  4B3M B;  4F6R A;  5KHI A;  2VS0 A;  2ZXW B;  1SKV A;  2AW9 A;  5GON A;  2R72 A;  2V1D A;  5CB4 A;  3K9A A;  1WP7 A;  3JD3 A;  4X66 B;  2LJ2 A;  5EZY B;  2ARH A;  3X2Q B;  1VQ9 V;  4PV1 B;  3VQW A;  1YDX A;  3H1L H;  1X4T A;  1NI8 A;  4B3M O;  2JGU A;  3E35 A;  2Q69 A;  4NB5 A;  5EYP A;  4NXM B;  1FXH A;  1TAE A;  3AG4 C;  2JJ2 G;  2XAF A;  2OWO A;  2EIK C;  1R3I C;  4F4L A;  4R50 A;  3ML0 A;  3K5N A;  3OT7 A;  4X66 O;  4QIW F;  2KG7 A;  4CH5 A;  1B3Q A;  3K58 A;  2QEX V;  1VMG A;  2ODM A;  1ORQ C;  4HAM A;  1HWY A;  1FPO A;  4O4L B;  3HKC B;  4NXM O;  4K0K B;  3F7Y C;  1MNG A;  3HB3 B;  3K79 A;  2XUM A;  1IBM B;  2YS8 A;  3UT5 A;  4R8C A;  3BHP A;  4G28 B;  4HZ3 A;  3VQV A;  1YTF D;  4OPH A;  2X6A A;  3LDC A;  3B77 A;  4DW0 A;  1BGY H;  2H94 A;  4F6E A;  2Q6A A;  4PA6 A;  3JCU Z;  4WBN A;  4Z1M G;  4K0K O;  3A0H Z;  3F5T A;  4J41 A;  1NU1 H;  4FM0 A;  1MMM A;  4MT8 A;  4HNA B;  2ETN A;  1P7G A;  5IYC O;  1IBM O;  3E8B A;  1PL4 A;  5LGU A;  3OTO O;  3K5L A;  4Z2W A;  2ZR2 A;  1AVM A;  2BTO A;  2RJZ A;  1QLE C;  2PI5 A;  3HKE A;  3D36 A;  5LP6 A;  4JI1 O;  4EB6 A;  1WA8 B;  4DV5 O;  3JAK B;  4JAS A;  4J7J A;  4N23 A;  2GUZ B;  3BCC H;  4GX2 A;  4RAI A;  1Y67 A;  1GH6 A;  3SYQ A;  1P49 A;  2UUB B;  3SYA A;  1FYJ A;  3FB8 C;  5IYZ B;  1K34 A;  4CH3 A;  3K0G A;  1Z2G A;  5L3D A;  2EIK B;  4DK0 A;  5EK0 A;  3D36 C;  5LP6 C;  4EEQ A;  3QF7 A;  1VQ5 V;  2EIM C;  4JI5 B;  3UM7 A;  5IYB O;  2UXC B;  1M5I A;  3I56 V;  1S77 D;  5BZB A;  2Q0A A;  2UUB O;  3ZX6 A;  5BXZ A;  5B1B B;  3HKD A;  4MVS A;  3L72 H;  4PI0 A;  5EYP B;  1BL8 A;  4IGG A;  4LCU C;  2Q7H A;  4LWS B;  1SQB H;  4WFF A;  4H33 A;  1JFF A;  1PNM A;  1WPX A;  1KMI Z;  2WLH A;  4XDK A;  3ZHS A;  4G2K A;  2Z5U A;  2KG7 B;  1XRE A;  2QA4 V;  4TOI A;  3QO7 A;  1GK9 A;  1HNX B;  3ZHU A;  4XDJ A;  1PL0 A;  4RQE A;  2GHY A;  3STL C;  5K1X A;  1I5X A;  1YHQ V;  1Y6X A;  4L8J A;  1QHT A;  4U7O A;  4WFB V;  5B3S C;  1B6Q A;  3CC7 V;  2VWJ A;  3AK3 A;  1L0N H;  3MHS C;  2ZKO A;  3UT5 B;  3CME V;  3CS5 A;  5IJ0 A;  1GRJ A;  2WLK A;  4PDM A;  5CBG A;  4GCZ A;  2CAZ C;  1HNX O;  4I50 B;  4DUY B;  5JH7 A;  4DV6 B;  2BSK B;  4WBN B;  2CDY A;  2Q67 A;  1H8H G;  2IM9 A;  4CC6 A;  1SA0 A;  1NJI W;  1YIT V;  4ASU G;  3CMA V;  2H8P C;  4I9W A;  1HNW B;  5EBL C;  3A2F A;  1HP8 A;  3H01 A;  2XTA A;  4CS2 A;  2YXL A;  2XAS A;  3TCU A;  5LHI A;  5LHG A;  3LNN A;  1N0N A;  2CUG A;  1VQK V;  4JI7 B;  2QDO A;  1MZE A;  5LP6 B;  1SQF A;  4JV5 B;  4DV6 O;  1AR5 A;  5KHG A;  4FLV A;  4FM1 A;  4D6T H;  5H9C A;  1PNK A;  1SQX H;  2O57 A;  4YIO A;  3FYE B;  3APO A;  3ZS8 C;  2JS3 A;  3CP1 A;  1Q5O A;  4DXW A;  1Y76 A;  2LFS A;  4LR3 A;  1HNW O;  4MVU A;  2QWN B;  1R3K C;  1DTO A;  4JI7 O;  4JV5 O;  2ZIN A;  3F5W C;  4J42 A;  3MAQ A;  3O65 A;  1N33 B;  1M57 C;  2A9H A;  3L9D A;  1MOF A;  4LF6 B;  3HKD B;  4ZOL A;  3J7A U;  1D2D A;  1HDJ A;  5LYJ A;  4JI2 B;  4HBN A;  4DR6 B;  5B3S B;  2KB1 A;  3BEH A;  1W2B U;  4KXR A;  1GN4 A;  2JIZ G;  2EJR A;  2R9I A;  1DF4 A;  3H1I H;  4EFB A;  2EZO A;  3SPH A;  3OE7 G;  4TQD A;  3S3X A;  3SGI A;  5KMG A;  1N33 O;  2UXB B;  1SC5 B;  1K73 W;  2WSS G;  3EXA A;  4J9Y B;  5LXT B;  1S76 D;  1YEW A;  4LF6 O;  2GTS A;  3HKB A;  4JI2 O;  3CHX A;  3E83 A;  4I5S A;  2QM7 A;  2CTQ A;  4DR6 O;  1EM1 A;  2P4K A;  1NTM H;  4TV9 A;  4P30 A;  3ASN C;  2UXB O;  4DRX A;  1D5A A;  2XND G;  3TK1 A;  2A3Q A;  3CRR A;  4ZI7 A;  3N2G A;  1I94 B;  2PYL A;  2F93 B;  1TGO A;  1VEW A;  4JI3 O;  5TIS Z;  1WNS A;  4FPP A;  1A32 A;  1VQ7 V;  3ZN0 A;  1GM7 A;  4AI8 A;  1AR4 A;  3CRM A;  3FAV B;  4O4J B;  1JCH A;  2Z3Y A;  2BCC H;  3ZBH A;  1YVW A;  4PEL A;  2E74 B;  2HLD G;  4IHJ A;  1QCE A;  1VF7 A;  2QKA A;  5D5Q A;  1M57 B;  1Y76 B;  3CCL V;  1KC8 W;  2XAG A;  4MW8 A;  1FKA O;  1OCR B;  4ZBM A;  3ZMV A;  2Q8V A;  5D5P A;  2RMK B;  4K35 A;  4P9P A;  2UXX A;  1FD9 A;  4UV9 A;  1XHX A;  3UQ8 A;  3OR7 C;  3PJS K;  1WB8 A;  2Z0A A;  2P90 A;  2LGW A;  5EBW C;  1H38 A;  1XMO B;  2JK5 C;  5LGN A;  5LMU B;  1H2G A;  3D8C A;  1YXB A;  2Q68 A;  4JAA A;  3ZHR A;  3CCV V;  1N34 B;  5KMG B;  3ASN B;  2JEX A;  3JSL A;  1KEC A;  2DYS C;  1Y74 B;  2F95 B;  1OJH A;  1K97 A;  1ZUQ A;  4I7Z B;  1YIJ V;  1T5E A;  5DM6 V;  1BS3 A;  3STZ C;  1Q90 D;  1Q8I A;  2X7R B;  1G4Y B;  2YIB D;  5LMU O;  4BAY A;  3K03 A;  4TV9 B;  1RSO A;  1N34 O;  1AIL A;  4ZHQ B;  3CJH B;  3SR2 C;  1VQL V;  1NTK H;  4ZI7 B;  3P30 A;  1YCI A;  1ZSP A;  3FD9 A;  2RDC A;  2YIB A;  4H37 A;  1Q86 W;  2EIL C;  3B09 A;  4CBC A;  4I9Q A;  3O9O A;  1MAB G;  4GX0 A;  3RN4 A;  1RPR A;  1XL4 A;  1ZLZ A;  1NH2 B;  1WAZ A;  1AB3 A;  3L74 H;  2F4V B;  2DW4 A;  5FLX N;  4NKG B;  3W7U A;  4B3R B;  2QTO A;  1KU9 A;  3IFX A;  1K5S A;  4QPJ A;  4CS4 A;  1TUB A;  1F7Y A;  1XL6 A;  2WLN A;  5JVD A;  1TVK B;  3AG1 C;  2F4V O;  4GX1 A;  2P06 A;  4QJF B;  3CYO A;  3JAT A;  4PA3 A;  1IVS A;  4B3S O;  1L1F A;  1BE3 H;  2Y48 A;  5H5N A;  3FYI B;  4D7S A;  3OUS A;  1L0L H;  1FJG B;  3DTU B;  4GYC B;  2Q5Z A;  1XOU A;  4B3R O;  3G6E V;  2ILM A;  3P32 A;  1L8D A;  4O2B A;  2DYS B;  2UUC B;  1GO3 F;  1R73 A;  1KKD A;  4DV1 B;  2Q9L A;  2FB5 A;  1Q3E A;  2F1M A;  3NXS A;  4LF4 B;  1FJG O;  2KSD A;  3W7S A;  3T1H B;  4FLY A;  5KHJ A;  2P5O A;  4DR4 B;  3JAL A;  1XEQ A;  4UCT A;  4CH4 A;  1CEZ A;  4LFB B;  2Q73 A;  3RYC A;  4NR1 A;  4DV1 O;  4MVO A;  1P4R A;  2EIL B;  5B5E Z;  4LF4 O;  1ENV A;  4EKW A;  1S5L Z;  1TUE B;  3T1H O;  1K4C C;  2N74 A;  4TSF G;  2HVK C;  4ZIB A;  4WFE A;  3JAW A;  4DR4 O;  1G6U A;  4E4E A;  2XHB A;  5IJ9 B;  4X89 A;  4LFB O;  2XAH A;  2EIJ B;  3DC5 A;  4YJ2 A;  4MTX A;  4I55 A;  1LUW A;  4LFA B;  5CA1 A;  4PD4 F;  3OGC C;  1RPO A;  3U0Z A;  1XHZ A;  1Q6U A;  3RYH A;  2ITD C;  1H2M A;  1J5E B;  5CA3 A;  3TET A;  1N0J A;  3G67 A;  1F51 A;  3CX5 F;  1FAF A;  1M93 A;  3AG2 C;  2G38 A;  4QE9 A;  3JAS B;  1YF2 A;  1BQZ A;  2AXT Z;  1M1K W;  4LFA O;  5GTI Z;  4TWK A;  1TUB B;  3MHH C;  2HJD A;  1J5E O;  4JF3 A;  1K8A W;  4UVC A;  1VP7 A;  2NNU A;  5JVD B;  2XAQ A;  1PP9 H;  5IT9 N;  4KFM A;  3OAA G;  2Y4T A;  4J7Z A;  3BFR A;  4I4T A;  3HPL C;  4K8X A;  2P4V A;  1AJN A;  4O2B B;  2YEV A;  2YDE A;  2CTW A;  5DN6 G;  1W0J G;  5CA0 B;  4HYO A;  4B3T B;  2UXN A;  3LSQ A;  2DQ3 A;  1IXM A;  3ABK C;  1QVG U;  4X65 B;  3QNE A;  3QG5 A;  2QWO B;  4QGP A;  3TGU H;  5J2U A;  1AP6 A;  3JAL B;  3RYF B;  1M9N A;  3OTO B;  1FFX A;  2ZIM A;  3CCU V;  4DUZ B;  5LOV A;  3RYC B;  3SDL A;  5B66 Z;  1GM8 A;  2W6I G;  2HP8 A;  1CP9 A;  3N27 A;  4B3T O;  2Y69 C;  1OZ0 A;  4JI1 B;  1BSM A;  4JYC A;  4JTA B;  2HHH B;  4I0X A;  4R7C A;  4DV5 B;  2QWP B;  1JPX A;  3SJB C;  4X65 O;  3JD4 A;  4FZ0 A;  1GN6 A;  2B1I A;  3AG2 B;  5J2T A;  1P7B A;  3ABM C;  3FB6 C;  4GKJ B;  3IC9 A;  4DUZ O;  2P7T C;  1U96 A;  4LFC B;  4YJ2 B;  4BIU A;  3B40 A;  1BCC H;  5E1A C;  1N36 B;  4U7N A;  2BOB C;  3JCZ A;  3OUF A;  1KP3 A;  1B04 A;  1JMK C;  2HHH O;  3RYH B;  4K3A A;  2OT5 A;  3EHB B;  5KA5 A;  4L87 A;  2IBZ H;  5LMN B;  4GLX A;  2BE3 A;  3FFQ A;  4F6R B;  1PNL A;  2B9Z A;  2B5U A;  4GKJ O;  4LFC O;  3H1K H;  4PJ0 Z;  3AG4 B;  5GON B;  4GKK B;  2W6J G;  1N36 O;  2CGN A;  5CB4 B;  1H2K A;  3B8N A;  1AP5 A;  1IZ3 A;  1US6 A;  3OGI B;  2QJ1 A;  5LMN O;  1QQC A;  2DOS A;  3OMI B;  4JAU A;  3ABT A;  4OGQ B;  1DGS A;  2LGQ A;  1YJN V;  4GKK O;  3ZHQ A;  5DED A;  4FLW A;  2Y0I A;  4B7K A;  1W0K G;  3CRQ A;  2FML A;  1LR1 A;  2BOC C;  2YEV B;  1I0H A;  4QNH B;  4UCR A;  2YSU B;  3BAB A;  2QWQ B;  1QLN A;  2Y69 B;  4JPR A;  2YXY A;  4X20 A;  4JYB A;  2DN9 A;  4KHP O;  2N05 A;  1XDC A;  1ZTE A;  2BTQ A;  1ROP A;  4DV7 B;  1SQG A;  3RGB A;  3U11 A;  4X1I A;  3MD0 A;  3M7M X;  1DLB A;  4RO2 A;  1XQ8 A;  3ABM B;  1FFX B;  4MTG A;  3BA9 A;  1GKF A;  4J7K A;  3AG3 C;  3ZRX A;  1V55 C;  3H9V A;  3ZMZ A;  2OTL V;  1QLE B;  4X88 A;  4I0X B;  4GX5 A;  4JI8 B;  2QTS A;  3KG2 A;  4DV7 O;  3GWO A;  3JYC A;  1F4M A;  2JJ1 G;  2B1G A;  5JCO A;  1YTF B;  5J2T B;  5IY5 C;  3K9S A;  2PGG A;  1KBH A;  3UO3 A;  1AJP A;  2GBO A;  1HR0 B;  2M6Y A;  2R9R B;  1NZ6 A;  1SZT A;  3HKE B;  4EB6 B;  5F2V O;  2ZNI A;  2EIM B;  3SJC C;  3UKM A;  4FFK A;  3SPG A;  4JI8 O;  1FXK A;  3QO8 A;  1E79 G;  4YJ3 A;  4DV4 B;  2PI4 A;  5JCO C;  2JS5 A;  3DC6 A;  3CCS V;  3RYI A;  1LNQ A;  3LDD A;  5IWA O;  2YI9 A;  1BQ0 A;  2WLL A;  1NS1 A;  2RNB A;  4JZ2 A;  1HR0 O;  2NLJ C;  2LP7 A;  3PN1 A;  1OCC C;  4FLT A;  1AI4 A;  3E89 A;  4OPA A;  1XNR O;  2DE0 X;  4KL1 A;  3THO A;  1FXK C;  4J80 A;  4DV4 O;  4P2Z A;  1XNQ B;  3L71 H;  5FL7 G;  4UCV A;  1PM9 A;  4H44 B;  4J10 A;  2JVD A;  5C8Y A;  4YY3 B;  1FXV A;  3APQ A;  1IXB A;  1JFF B;  1SER A;  5BY1 A;  2YIC A;  5H2F Z;  4DR3 B;  4MW3 A;  3AG3 B;  1VQ8 V;  5KLV H;  1JJ2 U;  1XNQ O;  4X20 B;  4JI3 B;  4FVM A;  3CEI A;  2BTQ B;  2QWR B;  4YY3 O;  4PI2 A;  3SPC A;  1FS0 G;  2ADP A;  1EZV H;  4MVQ A;  5IY5 B;  2ZT9 B;  4H0L B;  3RFR A;  5IJ0 B;  4DR3 O;  3T4D A;  4UUJ C;  2DWD C;  5JH7 B;  3OTF A;  3MDS A;  2E3C A;  2MW2 B;  2F66 C;  1SA0 B;  2WLJ A;  2OYQ A;  1J95 A;  3G71 V;  4X1Y A;  2KQX A;  4GZR B;  3K57 A;  3ICX A;  2Y4U A;  3RVZ A;  2RN9 A;  4K8Z A;  3T1C A;  3H1H H;  2W0X A;  2JRI A;  2HFE C;  4JTD B;  1OCC B;  1S0V A;  1MSW D;  1YJ9 V;  1EZJ A;  4LF9 O;  2YI8 A;  3ETD A;  4MSW C;  3ASO C;  3CPW U;  1N4C A;  4YJ3 B;  4JAV A;  2E76 B;  4JZG A;  1W59 A;  5A9G A;  1N32 B;  1OCO C;  2V4D A;  2DJV A;  3RYI B;  1IUR A;  1Q7Y W;  3P3P A;  5K1P A;  4AIL C;  1UFI A;  2WLL B;  3OMN B;  4LC1 A;  1SES A;  3OFN G;  2RQ6 A;  5KHH A;  2HR3 A;  2UUA B;  2UXD B;  2LW7 A;  1M4U A;  2N04 A;  4FK5 C;  4OXS A;  1GN3 A;  4UB6 Z;  3ZMU A;  1KD1 W;  1THZ A;  3ZJZ A;  3ABL C;  4MS2 A;  2L35 A;  5EBM C;  2LW1 A;  4O2A A;  1N32 O;  4ZOL B;  1RM1 C;  5IYD O;  2YC0 A;  4FLZ A;  5LYJ B;  1LUV A;  1SS3 A;  5C8Y B;  2DYR C;  1EN6 A;  4CZZ A;  3D3Q A;  2UXD O;  2UUA O;  1KQS U;  3FX7 A;  2QSA A;  2FYU H;  4LF8 B;  4TV8 A;  1DF5 A;  1I7F A;  1K33 A;  4BW5 A;  4YXW G;  3OEE G;  2CH7 A;  1UPG A;  2Q0O C;  5E79 Z;  2VQE B;  4LF5 O;  3HKB B;  1SET A;  3A8T A;  2OIE A;  2PTM A;  3TJT A;  4B08 A;  3I55 V;  4UB8 Z;  4LF8 O;  1PKX A;  5LA6 A;  4Z1V A;  4DRX B;  2A06 H;  4R6Z A;  3N2G B;  2WA4 A;  1MG1 A;  3K0D A;  4IYI A;  2VQE O;  2ZR3 A;  4PDV A;  1Q6I A;  2Q4P A;  3J81 N;  1O9H A;  1NTZ H;  4X1Y B;  4H13 B;  1OCO B;  1R3L C;  2EIN C;  2A79 B;  1PPJ H;  3OEH G;  4JI0 O;  2XOK G;  4B3S B;  1WLE A;  4NTX A;  3K3W A;  4U3F H;  3Q4H A;  3JD0 A;  2ZNJ A;  3IGA C;  4IHJ B;  4X64 B;  2ZE8 A;  4Q20 A;  5C93 A;  3DSQ A;  3CE2 A;  3OD4 A;  3LSU A;  4X62 B;  3ABL B;  3LSS A;  2GSM B;  3B8M A;  2F43 G;  5FNV A;  2YUA A;  3CSX A;  4LP8 A;  3ZIA G;  5KUK A;  1RM1 B;  1E1Q G;  3EFF K;  1O9G A;  4DV2 B;  4LF7 B;  1H2S B;  1PD3 A;  2DYR B;  2PY5 A;  4X64 O;  1VF6 A;  1BT8 A;  4X62 O;  5CBH A;  3SYC A;  3IC7 A;  3UO2 A;  2AGA A;  3CCM V;  5EZY A;  1K4D C;  3LUT B;  4O2A B;  5KX5 A;  4DV3 B;  2IU3 A;  4DV2 O;  4LF7 O;  2P6J A;  2LQT A;  1Q6H A;  2ZXW C;  4PA4 A;  2E5L B;  1VF6 C;  4TV8 B;  3AK1 A;  1KB9 F;  1BHB A;  3T2M A;  1RP3 B;  3WU2 Z;  4NYK A;  3X2Q C;  3ABU A;  4RUF A;  2Y0P A;  3AG7 A;  4DV3 O;  3E8F A;  3LNM B;  3HKC A;  4FZ1 A;  2E5L O;  1XIL A;  2D2C B;  2EIN B;  2ZE6 A;  1RSO B;  3R66 A;  5LA6 B;  3ETG A;  1SZX A;  3J80 N;  2IU0 A;  4MVM A;  1GMG A;  4BIZ A;  1OV9 A;  3AK2 A;  2HKO A;  3E2E A;  1M56 C;  1VF5 B;  2AHY A;  1OHH G;  5EC2 C;  1HW7 A;  3JAM N;  3A0R A;  4W4K A;  4HNA A;  2EJ7 A;  2WWW A;  3AG1 B;  3ETQ A;  2YID A;  5GW7 A;  2DQ0 A;  2F23 A;  3Q4H B;  3VOU A;  2HJF C;  4WCE V;  2NR5 A;  2ATK C;  3R65 A;  1WA8 A;  2JDI G;  2L6L A;  3E86 A;  4DV0 B;  2GUZ A;  1TA8 A;  1CXZ B;  1VQ6 V;  1AR1 B;  5H6Q A;  3JAT B;  3L70 H;  2AZ2 A;  2CE4 A;  2D3O W;  4JTC B;  2HG5 C;  2CK3 G;  1H8E G;  5IYZ A;  4JI4 B;  2GDS A;  2EBO A;  1V9P A;  1K5Q A;  3NR7 A;  3CXH F;  4DR2 O;  4WF9 V;  1XUQ A;  4BR6 A;  4DV0 O;  4PA7 A;  1NVP D;  5KX5 B;  4PA9 A;  4P9O A;  1EFR G;  1N8R W;  4TUY A;  1IBK B;  3L73 H;  3QTC A;  4DK1 A;  4JI4 O;  4FIP C;  3N2K A;  4UCO A;  3F7V C;  4LWS A;  1YI2 V;  1VQO V;  3UCS C;  1NBM G;  1SQQ H;  3A0B Z;  4YIP A;  2R9A A;  2XT9 A;  5CMU A;  1D5N A;  3CRA A;  5B1B C;  1M56 B;  1IBK O;  4JYY A;  2ADQ B;  4A5U B;  2PUS A;  1NKD A;  1R6T A;  2ZD9 A;  2CTR A;  2EZP A;  2LO1 A;  3JAW B;  5LBQ A;  2IW5 A;  2PZS A;  3KCX A;  3ZN1 A;  4NVP A;  3CC2 V;  1XBL A;  3VBB A;  3B4S A;  4I50 A;  4I55 B;  5CA1 B;  2BSK A;  2OCC C;  4BIO A;  1Z5V A;  3SYO A;  2K9P A;  2VRZ A;  4ABM A;  2OTJ V;  3OW2 U;  4WFA V;  1S3J A;  3EVK A;  2X6B A;  2IH3 C;  4DR7 B;  3CD6 V;  3D3I A;  3C3S A;  2HVJ C;  3G80 A;  3SPJ A;  3CCJ V;  2C2A A;  3WFV A;  2JEU A;  2E75 B;  4X8A A;  3ZCC A;  2ZQM A;  2WLI A;  5BMV A;  3CXC U;  1QR9 A;  1K3E A;  3C90 A;  2HEP A;  5JJN B;  1Q43 A;  4DR5 B;  1VQ4 V;  1JOY A;  3ABK B;  4FJC C;  2QE7 G;  2EX3 A;  4I4T B;  2ZDI A;  5AG2 A;  4KHP B;  4DR7 O;  4MTF A;  1QBZ A;  3BPZ A;  3CCQ V;  4FFB A;  4IYH A;  5FPO A;  1BZK A;  4CH6 A;  3OM3 B;  1QU7 A;  2IJH A;  4FLU A;  3T4Z A;  2JGD A;  4TUY B;  4DR5 O;  1VQM V;  3L75 H;  1R6N A;  1K92 A;  3SYP A;  4O4H A;  2ZE7 A;  2AZ0 A;  4JYA B;  4X1K A;  2ZDI C;  3N2K B;  2UU9 B;  1VQN V;  4QE7 A;  5J2U B;  1ARO P;  1NVP B;  4JI5 O;  2UXC O;  4EFE A;  1H2L A;  5LOV B;  2M7W A;  3JSN A;  1YSC A;  5HFM A;  5LXT A;  5LGT A;  1NQT A;  4KUM A;  5L3G A;  4X9Q A;  2OCC B;  1JJO A;  4JYA O;  1EN4 A;  5B1N A;  2UU9 O;  4RUE A;  4QPK A;  4YHH B;  1GTO A;  4RWU A;  3W7T A;  2W0F C;  3E22 A;  1GAX A;  3M8A A;  1JQ0 A;  1NR1 A;  3FB5 C;  2OIG A;  5IWA B;  3HR0 A;  4FM2 A;  3C3T A;  3ZMS A;  5HFL A;  3KZI Z;  1XNR B;  4WFH A;  4YHH O;  5JJE B;  2DMX A;  2EUL A;  3RWR D;  3S3W A;  4BW9 A;  1UJW B;  1IDS A;  1ZL8 A;  4O4J A;  1JA8 A;  3FAV A;  2DWE C;  5LHH A;  1XMQ B;  5JWP A;  3ETE A;  4DUY O;  5LL6 Y;  4UFZ A;  4IIJ A;  4GUN A;  5KA6 A;  2WLI B;  4DO2 A;  3ZRS A;  2AHZ A;  5BMV B;  1VAR A;  3ZHT A;  3SPI A;  4N21 A;  1B06 A;  2LFR A;  4UV8 A;  3TXQ A;  1JR9 A;  1XMQ O;  5FPR A;  4OX9 B;  2FTK A;  4FFB B;  5IE9 A; 
#chains in the Genus database with same CATH homology
 3SYQ A;  1SET A;  1R6K A;  2XAH A;  2EIJ B;  1V54 C;  3SYA A;  4MTX A;  3FB8 C;  3I55 V;  1K34 A;  3OGC C;  3K0G A;  1RPO A;  1V55 B;  1BMF G;  1PKX A;  5L3D A;  2ITD C;  2EIK B;  1OCR C;  5CA3 A;  3TET A;  3K06 A;  5EK0 A;  1SRY A;  1F51 A;  1VQ5 V;  2EIM C;  4R6Z A;  3UM7 A;  3AG2 C;  5IYB O;  1MG1 A;  3K0D A;  3I56 V;  1S77 D;  4QE9 A;  5BZB A;  2ZR3 A;  4PDV A;  1G8M A;  1M90 W;  1K7D A;  3G4S V;  1GM9 A;  5B1B B;  5H6R A;  4MVS A;  1M1K W;  4UXN A;  1OCO B;  3GB7 C;  1BL8 A;  4TWK A;  1R3L C;  2EIN C;  2A79 B;  4LCU C;  3MHH C;  4WFG A;  3OEH G;  3W7X A;  2XOK G;  1FFT B;  4JF3 A;  1WLE A;  4MVZ A;  4WFF A;  4UVC A;  1K8A W;  4H33 A;  1JX9 A;  1PNM A;  1WPX A;  1AJQ A;  2NNU A;  3K3W A;  2WLH A;  2XAQ A;  4XDK A;  3JD0 A;  4KFM A;  3OAA G;  4G2K A;  3IGA C;  2Z5U A;  2X6C A;  4Q20 A;  2QA4 V;  5C93 A;  3QO7 A;  1GK9 A;  3ABL B;  3LSS A;  2GSM B;  3B8M A;  3HPL C;  1NH2 D;  2F43 G;  4XDJ A;  1PL0 A;  4RQE A;  2GHY A;  4LP8 A;  3STL C;  3ZIA G;  1I5X A;  1YHQ V;  1K9M W;  1AJN A;  5KUK A;  1RM1 B;  1E1Q G;  3EFF K;  4U7O A;  2IJI A;  2YEV A;  4WFB V;  5B3S C;  1PD3 A;  2DYR B;  1B6Q A;  3CC7 V;  5DN6 G;  1W0J G;  3MHS C;  4UVA A;  3CME V;  4HYO A;  1FXK B;  2UXN A;  2WLK A;  3LSQ A;  4PDM A;  5CBG A;  2DQ3 A;  1IXM A;  3ABK C;  1CPY A;  1Y66 A;  4GCZ A;  1QVG U;  5CBH A;  3SYC A;  3IC7 A;  2WAM A;  3QNE A;  3CCM V;  3SJQ C;  1K4D C;  3LUT B;  2Q67 A;  1M9N A;  1E1R G;  1H8H G;  2K1E A;  2IU3 A;  3W7W A;  4ZKI A;  3CCU V;  1NJI W;  3E8H A;  1YIT V;  2P6J A;  1V54 B;  4ASU G;  2ZXW C;  1F4N A;  3QO5 A;  1GM8 A;  2H8P C;  4PA4 A;  4I9W A;  3CMA V;  4XDL A;  2W6I G;  3CCR V;  5EBL C;  5L3C A;  1CP9 A;  2Y69 C;  1OZ0 A;  3H01 A;  4JTA B;  4JYC A;  2IJJ A;  2XAS A;  3TCU A;  5LHI A;  4R7C A;  5LHG A;  1VQP V;  1BHB A;  1JPX A;  3E8G A;  1EBO A;  1COW G;  1VQK V;  1S72 V;  3T2M A;  3JD4 A;  3ZRW A;  1QR8 A;  3X2Q C;  3ABU A;  2B1I A;  3AG2 B;  5H9C A;  1PNK A;  4RUF A;  1P7B A;  3ABM C;  5B1A C;  3FYE B;  3FB6 C;  3E8F A;  2P7T C;  3LNM B;  3CP1 A;  4DXW A;  4BIU A;  2LFS A;  5E1A C;  4U7N A;  2BOB C;  3JCZ A;  3OUF A;  1KP3 A;  2EIN B;  4MVU A;  1R3K C;  1DTO A;  2OT5 A;  3EHB B;  4J9Z B;  2IJK A;  3ETG A;  5KUM A;  5EC1 C;  5KA5 A;  4XBF A;  2IU0 A;  4FMT A;  4L87 A;  4MVM A;  3F5W C;  1GMG A;  4BIZ A;  2HKO A;  3E2E A;  1M56 C;  1PNL A;  2AHY A;  1M57 C;  2B5U A;  1OHH G;  2A9H A;  5EC2 C;  1MOF A;  1F23 A;  3AG4 B;  3RBZ A;  4MVR A;  3A0R A;  2W6J G;  3B8N A;  2WWW A;  3AG1 B;  5CBF A;  3FKS G;  5GW7 A;  2DQ0 A;  5B3S B;  2KB1 A;  3AEI A;  3BEH A;  1W2B U;  3WG7 C;  1Y4M A;  2JIZ G;  2A0L A;  2EJR A;  2R9I A;  1DF4 A;  3VOU A;  1OCZ C;  2EZO A;  3ASO B;  2HJF C;  3SPH A;  1Q82 W;  3OE7 G;  3OMI B;  4WCE V;  4JAU A;  2ATK C;  3ABT A;  3R65 A;  3RVY A;  1QVF U;  2IH1 C;  1K73 W;  2WSS G;  3RW0 A;  2JDI G;  4J9Y B;  1YJN V;  1S76 D;  3E86 A;  1AI7 A;  1W0K G;  1VQ6 V;  1AR1 B;  2BOC C;  3E83 A;  3FB7 C;  2YEV B;  5H6Q A;  4I5S A;  2QM7 A;  4QNH B;  2YSU B;  2D3O W;  4JTC B;  2HG5 C;  2CK3 G;  1H8E G;  5L3E A;  2EBO A;  3M99 B;  2XAJ A;  1QLN A;  4P30 A;  2Y69 B;  1K5Q A;  4JPR A;  4UVB A;  1JVM A;  3OMA B;  3OR6 C;  4JGS A;  4JYB A;  4PDL A;  3ASN C;  1KP2 A;  2XND G;  3TK1 A;  1I5Y A;  4WF9 V;  1NR7 A;  1ROP A;  4PA7 A;  1NVP D;  3MD0 A;  4PA9 A;  4P9O A;  1AI6 A;  1DLB A;  2EIJ C;  4RO2 A;  3ABM B;  4FPP A;  1EFR G;  4MTG A;  5B1A B;  1N8R W;  1GKF A;  1VQ7 V;  3ZN0 A;  1GM7 A;  3AG3 C;  1AI5 A;  3ZRX A;  1V55 C;  3K08 A;  4FIP C;  3ZMZ A;  2OTL V;  1QLE B;  1JCH A;  2Z3Y A;  3F7V C;  4X88 A;  4KP4 A;  1YI2 V;  4GX5 A;  1VQO V;  4PEL A;  3LDE A;  3ZRW B;  2HLD G;  1NBM G;  4MTO A;  3KG2 A;  1QCE A;  3DGE A;  1F4M A;  3GWO A;  3JYC A;  2JJ1 G;  2B1G A;  1YTF B;  5CMU A;  5IY5 C;  4TT3 G;  5B1B C;  1M56 B;  1R3J C;  1M57 B;  4RQF A;  1AJP A;  4LBE C;  3CCL V;  1KC8 W;  2XAG A;  2R9R B;  2WLM A;  3JD1 A;  2V7Q G;  1OCR B;  4GT1 A;  4MW8 A;  1BHA A;  2MK3 A;  4ZBM A;  2ITC C;  1NKD A;  1SZT A;  2ZD9 A;  3ZMV A;  2EZP A;  3BY6 A;  2EIM B;  4G27 B;  2X0L A;  3UKM A;  3SPG A;  5LBQ A;  2IW5 A;  4P9P A;  4E2L A;  3WG7 B;  3ZN1 A;  2UXX A;  3CC2 V;  1FXK A;  2WPD G;  3QO8 A;  1E79 G;  3VBB A;  2PI4 A;  1OCZ B;  4UV9 A;  3CCS V;  3OR7 C;  1LNQ A;  3LDD A;  3PJS K;  2P90 A;  2WLL A;  2OCC C;  2NLJ C;  2LP7 A;  3SYO A;  5EBW C;  1OCC C;  2QKS A;  1H38 A;  2OTJ V;  1AI4 A;  3JD2 A;  2JK5 C;  3E89 A;  1S3J A;  4WFA V;  3OW2 U;  2X6B A;  5LGN A;  1H2G A;  1FXK C;  2IH3 C;  2Q68 A;  3ZRV A;  4P2Z A;  3CD6 V;  3D3I A;  3CCV V;  1YJW V;  2HVJ C;  5FL7 G;  3SPJ A;  3CCJ V;  3K04 A;  4PDR A;  1S5H C;  2C2A A;  3ASN B;  2JEX A;  3WFV A;  1KEC A;  2DYS C;  2JEU A;  4X8A A;  3ZCC A;  2ZQM A;  1K97 A;  1YIJ V;  5DM6 V;  1FXV A;  5L3B A;  2WLI A;  1Q81 W;  3CCE V;  5J9P C;  1SER A;  5B1O A;  3STZ C;  1QR9 A;  2X7R B;  3CXC U;  1K3E A;  1ZWI C;  1G4Y B;  5CN0 A;  1VQ4 V;  4MW3 A;  4BAY A;  2QM8 A;  3ABK B;  3AG3 B;  1VQ8 V;  4FJC C;  3K03 A;  2QE7 G;  3CC4 V;  1JOY A;  2ZDI A;  5L3F A;  2P67 A;  1JJ2 U;  4MTF A;  1QBZ A;  3CCQ V;  5IDJ A;  1VQL V;  3P30 A;  3OM3 B;  3ZMT A;  4H37 A;  3SPC A;  1Q86 W;  2ZXW B;  2IJH A;  1FS0 G;  2EIL C;  4MVQ A;  3T4Z A;  5IY5 B;  4CBC A;  1MAB G;  4GX0 A;  1VQM V;  1R6N A;  1K92 A;  2V1D A;  1RPR A;  3SYP A;  1XL4 A;  3T4D A;  1NH2 B;  4UUJ C;  3K9A A;  2ZDI C;  2DWD C;  2DW4 A;  1VQN V;  3JD3 A;  4QE7 A;  3X2Q B;  1ARO P;  1NVP B;  1VQ9 V;  3W7U A;  2WLJ A;  2QTO A;  1J95 A;  3G71 V;  3IFX A;  2M7W A;  3E35 A;  2Q69 A;  1K5S A;  1YSC A;  1FXH A;  4QPJ A;  5HFM A;  5LGT A;  3AG4 C;  1NQT A;  4KUM A;  2JJ2 G;  2XAF A;  3RVZ A;  5L3G A;  2EIK C;  2OCC B;  1XL6 A;  3T1C A;  1R3I C;  4F4L A;  4R50 A;  2WLN A;  5B1N A;  3AG1 C;  3ML0 A;  4GX1 A;  2HFE C;  4JTD B;  1OCC B;  4RUE A;  4QPK A;  3CYO A;  4QJF B;  4PA3 A;  1GTO A;  1L1F A;  1S0V A;  1MSW D;  2Y48 A;  4QIW F;  3FYI B;  3W7T A;  3OUS A;  3DTU B;  2QEX V;  2W0F C;  1YJ9 V;  1EZJ A;  3ETD A;  4MSW C;  3ASO C;  3CPW U;  1ORQ C;  4HAM A;  4JAV A;  1JQ0 A;  1NR1 A;  3FB5 C;  1HWY A;  3G6E V;  1OCO C;  1Q7Y W;  3F7Y C;  3P32 A;  3ZMS A;  2DYS B;  3OMN B;  2WLL B;  1GO3 F;  3HB3 B;  3K79 A;  1SES A;  4LC1 A;  5HFL A;  3OFN G;  1R73 A;  1KKD A;  2HR3 A;  4WFH A;  4R8C A;  4G28 B;  4HZ3 A;  4FK5 C;  3NXS A;  4OXS A;  1YTF D;  2X6A A;  3LDC A;  3B77 A;  3ZMU A;  3W7S A;  1KD1 W;  1THZ A;  3ZJZ A;  3ABL C;  1UJW B;  4MS2 A;  2DWE C;  5LHH A;  2H94 A;  2Q6A A;  4PA6 A;  3ETE A;  5EBM C;  4Z1M G;  1RM1 C;  5IYD O;  4MT8 A;  1CEZ A;  2DYR C;  4CZZ A;  5IYC O;  5KA6 A;  2WLI B;  3E8B A;  4MVO A;  4DO2 A;  3ZRS A;  2AHZ A;  5LGU A;  1KQS U;  1P4R A;  2EIL B;  2ZR2 A;  1ENV A;  4N21 A;  3SPI A;  4EKW A;  1TUE B;  2LFR A;  1QLE C;  4UV8 A;  1DF5 A;  1K4C C;  2PI5 A;  3D36 A;  1K33 A;  4BW5 A;  4TSF G;  2HVK C;  4YXW G;  4WFE A;  3OEE G;  4JAS A;  4N23 A;  4GX2 A;  2FTK A;  4RAI A;  4X89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...