3G6EV

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3g6eV00
3CCMV 3I55V 3CCVV 1S72V 1KD1W 1VQ8V 1VQ4V 1QVFU 3CCEV 1VQKV 3CCRV 1YJNV 3CCQV 1K73W 1KC8W 1K8AW 1K9MW 1VQOV 1VQNV 1QVGU 1Q81W 2QEXV 3G4SV 1N8RW 3CCJV 3CCLV 1Q86W 1Q7YW 1YJ9V 1YIJV 3CCSV 4WCEV 1VQ5V 1VQPV 3CXCU 1YJWV 3CC4V 3G71V 1VQ6V 1YITV 5DM6V 2OTLV 3CPWU 3CCUV 4WFAV 1NJIW 1R73A 3OW2U 1VQ7V 1M90W 1W2BU 4WF9V 3G6EV 2QA4V 1VQLV 3CC7V 4WFBV 1JJ2U 1KQSU 3CC2V 1VQMV 1YHQV 3CD6V 2D3OW 2OTJV 3CMEV 1M1KW 1Q82W 1YI2V 3I56V 1VQ9V 3CMAV
chains in the Genus database with same CATH superfamily
1N34O 1ZUQA 1L0LH 3MD0A 3ZMUA 1RSOB 3MHSC 5J2TA 1Y76B 3F7VC 4JI2O 2WSSG 1GTOA 2AHYA 4DUZO 3OEEG 3G80A 5JJNB 5L3CA 3LSUA 3LDDA 1JOYA 2DN9A 4UVCA 5B66Z 5BR8B 4JASA 4J7ZA 3K08A 2E75B 3UT5B 1NQTA 4DUYB 4LFCO 4O4JB 3E8FA 1SA0B 3FB8C 4LNUB 5ITZA 1VQPV 1KP2A 4CBCA 2AZ0A 4TUYB 5GONB 2NR5A 3JYCA 4DK0A 3FFQA 4DV2O 1TVKB 3AK2A 2R9RB 4X1YA 1AR4A 1H2MA 4FIPC 4R8CA 4UFZA 1R6NA 1MZEA 1DK1A 3WU2Z 2ZDIC 4I4TB 2UXCB 1R6KA 3CXHF 4J11A 1GM7A 2QGNA 2A7WA 2ZINA 4FLWA 2IW5A 3FX7A 3SPIA 2QTSA 1VQ9V 2WA4A 3HR0A 2KG7A 4AQYB 5JCOC 2HG5C 1SQFA 5LP6A 5B3SB 3SPGA 2F23A 1FFTB 3G67A 5H9CA 3RYIB 4ZI7A 4PA4A 1OJHA 2PYJA 2WPDG 3EXAA 4N23A 3JALA 1ZWIC 2OWOA 2CGOA 1XMQB 1YI2V 2CDYA 1VARA 5C8YA 3FAVA 1K8AW 3LNNA 4MVMA 1N32B 2KSDA 1V9PA 2EBOA 4Z1MG 2QKAA 2QJ1A 4UCSA 2X6AA 1R73A 1K3EA 2B5UA 3BABA 2CK3G 1ORQC 2DOSA 4MVSA 5KHKA 1XHXA 4QJFB 2E5LO 3E35A 3RBZA 4GX5A 3CRAA 2RMKB 5B1BB 2QR4A 3BA9A 2H94A 2FL4A 3OMNB 2DMXA 3IC9A 2PGGA 4DR1O 3J80N 4AI8A 1OCZB 3SJCC 2QA4V 1JMKC 1JX9A 2K1EA 4DV5O 1JR9A 5CA1B 3L72H 4J42A 1FXKB 4HZ3A 4Z1VA 2IJJA 1X4TA 5GW7A 1JCHA 1FS0G 3K5LA 3T4DA 4X1YB 5EK0A 1NKDA 3E22B 2ITCC 2RJZA 4UCRA 2XTAA 4TV9A 1SERA 2Y0PA 2XT9A 1Y6XA 2LO1A 3U0ZA 1GN4A 3STLC 5IYBO 5LL6Y 4FLYA 3C90A 3I56V 2OCHA 4FLVA 2OYQA 2LGQA 4HBNA 1BL8A 2GSMB 1NZ6A 4YHHB 3ZRVA 5CB4B 4NXMB 5EZYB 2QKSA 3JD4A 1IBKO 2YC0A 3OAAG 3AG3B 1NI8A 5L3GA 1IBLO 3CRMA 1I94O 4KHPO 3RYCA 3ETQA 5LA6B 4O2BA 2UUCB 4CS4A 4E2LA 1NT2B 1N4CA 4JTAB 2WLMA 4ZOLA 5LYJA 4DXWA 1ZL8A 1EN4A 2Z3YA 4PJ0Z 1I08A 4JI5O 4DR4O 4NXMO 3W7TA 3HPLC 1Z5VA 5IDJA 3HKEA 4B3SB 4NB5A 4D6TH 1JJ2U 2ZM6B 1IDSA 2ZR3A 4DV4O 1V55B 4X1KA 4QNHB 2HJFC 4LF9O 1I5XA 3M99B 3THOA 4KL1A 3D36A 2QEXV 1IXBA 2G38A 3CCJV 4QPKA 4JAVA 5L3BA 4FPPA 4X65B 3F5WC 3K04A 1XNRB 1SF9A 1YCIA 5JJJB 3IC7A 4J9YB 4FK5C 1W0JG 1V55C 2QWNB 5DN6G 1CXZB 1NTZH 1PL0A 3CS5A 4OX9O 4IIJB 3JD2A 1F51A 2R70A 3L71H 5LHHA 3ETDA 4WFHA 4JI6B 3ZMTA 2EIKB 5C93A 3C3SA 4LH7A 4XDLA 1DGSA 2AGAA 3ZRXA 1PD3A 1VIBA 2BCCH 4IIJA 2PY5A 2Y4TA 3IAYA 4MTFA 2E5LB 5BR8O 1N0NA 1PP9H 2JRIA 4BW5A 4LF4B 3SJBC 2Q8VA 1Q82W 2JIZG 1K7DA 4H13B 1GAXA 1PNKA 2Q4PA 4JZ2A 1HNWO 1NS1A 4P30A 4TV9B 4LWSA 4TWKA 4O2BB 3G6BA 3P3PA 1OHHG 2EINB 1VEWA 4GUNA 4R50A 1FXKC 3ZHRA 2ZE5A 5EBMC 1HNXO 1BQZA 4XDKA 3H1JH 2XAQA 2QM8A 2JS3A 1IZ3A 2N04A 2YXHA 1L1FA 3I5DA 1H8EG 1IBKB 2Q0OC 2GDSA 2Q68A 3G6EV 1QCEA 4LR3A 3ZHTA 1P49A 4TT3G 2HP8A 4AILC 5HFMA 2YIBA 3PJSK 3ZMVA 2JGDB 3ICXA 2EILB 1SZXA 2LW1A 3IGAC 1N8RW 1QU7A 4O4IA 4YJ2B 3HKBA 4ZBMA 1NBMG 3QNEA 1COWG 1FFXB 1Y66A 1KECA 3HKCB 3VBBA 2F4VO 1F23A 2YICA 1G8MA 4N21A 3P30A 1F4NA 3RYHB 1US6A 3GWOA 2QTOA 3AG1B 1OCCC 1RPOA 3QG5A 1BHAA 1L8DA 3K5NA 5C8YB 2YEVB 3OGIB 3RYIA 1U96A 3BAAA 1P4RA 1BHBA 3AG4C 1SQXH 5IWAB 1XEQA 4BR6A 5CBFA 1QLEC 2UXBB 2ZE7A 1MA1A 1A32A 1YSCA 2DW4A 4LWSB 1WPBA 2P22C 2P7TC 3DXRA 2WLLB 4I55B 1FAFA 5LOVA 3OE7G 2IH3C 2IJIA 3OR7C 4L87A 5KHJA 4CS2A 4LF7B 2F93B 3B09A 2N74A 1LR1A 3RVZA 1D5AA 1Z2GA 1S5HC 4DR5B 1FXKA 2JS5A 5BZBA 4JAUA 5D5QA 2R9AA 3JATA 4DO2A 1W0KG 4RQFA 4B7EA 4YIOA 4QPJA 4X62O 4OGQB 4PDMA 1URFA 2EZPA 3BCCH 4I50A 2JJ1G 1E79G 2IM9A 2M6YA 3OEHG 4L8JA 3E2EA 3QO5A 4LF6B 2D3OW 2OTJV 2ZQMA 1CEZA 2N05A 4I0XB 4DR4B 3ABTA 4EEQA 2NNUA 5FL7G 3FYIB 3W7WA 2DWEC 1FJGO 3SYAA 4ZIBA 3J81N 5IT9N 1Y4MA 4O2AB 4QE9A 3SR2C 3T1HB 2F1MA 1LUWA 2EZOA 1TVKA 1VF5B 4HNAA 1SETA 1O9HA 1FXVA 2IJKA 1SESA 5EZYA 1K92A 2ZIMA 4RQEA 2R9IA 3K0DA 3ABLC 4UV9A 1AJPA 4EB6A 5LP6B 3HKBB 1TUEB 4HNAB 4LP8A 1IURA 1M5IA 1NJIW 5KX5B 2ZT9B 1XL4A 1Q3EA 4I55A 4ABMA 1CP9A 3ABUA 4PA6A 1E1RG 3RYHA 4GLXA 4J80A 4FLTA 1QVFU 1BGYH 4MVOA 4LF7O 1Q6IA 2YDEA 3RYFA 1FKAO 2YSUB 3CYOA 4WFAV 4BIUA 1JFFA 2ATKC 2QWOB 1JJOA 4B3RB 4NTYA 4MVUA 3BHPA 1EZJA 5CA0A 4DV6O 1B06A 2DQ3A 2FTKA 3CCEV 4CZZA 3AK1A 1EZVH 4H0LB 4TUYA 2E76B 4FM2A 1YTFD 1V54B 1AI7A 1S0VA 1Q86W 4JI1O 2Q7HA 4FM1A 1OV9A 4D7SA 3R66A 3MDSA 3TETA 1GRJA 2WLIB 4DR7O 4LF5B 1OCZC 4JI4B 4I4TA 2VQFO 5LGTA 1I0HA 5LBQA 3OMIB 4PD4F 3M8AA 3LUTB 2QWQB 1J5EB 2UUAO 2BTQB 3L70H 1LUVA 2OCCB 1NH2B 1K5QA 1WPXA 3ZN0A 3JAMN 1HDJA 3L9DA 2XAGA 5DM6V 1MMMA 2W6IG 3T1CA 4TOIA 3JD3A 1OCOB 5LMUO 2HJDA 2ZD9A 4GX1A 3A0HZ 1HNZO 3DGEA 2F66C 4H44B 4HYOA 4LFAO 1SQVH 4WBNA 1GKFA 5IY5C 4A5UB 3ASNC 1B3QA 1AJNA 3F5TA 2B1IA 1K97A 4CH3A 3CMEV 3SPCA 2Y4UA 3ABKB 4DV5B 5FNVA 1S77D 2LFRA 1OZ0A 4MSWC 2UXCO 4UXNA 1HW7A 3SJQC 4DUYO 2UXNA 1EFRG 1OCRC 4PDRA 1ROPA 4JI3O 5JH7B 1BT8A 2F95B 3D3IA 5KHGA 4DR2B 5LOVB 4EKWA 2CE4A 4XBFA 4FLUA 3B8NA 1P7BA 1R3LC 1S76D 3OM3B 4YXWG 1GN2A 2A0LA 2GBOA 3UM7A 1EN6A 1THZA 4DR1B 3L75H 1L0NH 1YXBA 2EIKC 3AG2C 5ITZB 5CA1A 4GZRB 4I9QA 4YY3O 3UCSC 4G2KA 2RDCA 2A9HA 3ABKC 3SYPA 1DF4A 3A0RA 3ZHQA 1GK9A 4DR2O 3CCMV 4MVZA 1KP3A 2C2AA 3FKSG 5IJ9B 1YJNV 3KG2A 3SDLA 4PDVA 4MS2A 1SZTA 2JDIG 2HFEC 1O9GA 1SQGA 5JVDB 1W2BU 4F6RA 1Y74B 1BS3A 1I7FA 5L3DA 2BTOA 1J95A 2GUZA 4GYCB 1SRYA 4ZOLB 4O4IB 4J7JA 1IX9A 2DYSB 3APQA 2UU9B 1XREA 2Y0IA 3K0GA 2WA3A 4OXSA 1VQLV 4PHZA 4W4KA 4DR3B 5CBGA 2HKOA 4CH4A 1FD9A 4YJ3B 3K57A 1K73W 3CCRV 3E8HA 3H1LH 3RYFB 3JSNA 1PNMA 1R3KC 1S3JA 4B7KA 5B1NA 3DSQA 1WP7A 4FZ0A 3ZHUA 4P2ZA 2JVDA 4QIWF 2Q7GA 1KQSU 1H2SB 1YHQV 3VQWA 5JH7A 1Z5WA 5K1XA 1AR5A 3HKEB 3ZJZA 4JGSA 2E74B 5CMUA 1D5NA 4NR1A 2F43G 2IBZH 3ML0A 1AI4A 1N33B 1OCCB 1K33A 4YHHO 2ZNIA 4JV5O 4W4LA 2YXLA 4MW3A 2VRZA 3F7YC 1NVPB 4WF9V 3UQ8A 2GTSA 3L74H 4J9ZB 5GTIZ 4BWAA 4NYKA 2P06A 4P9PA 1KU9A 4JI7B 2P67A 1GN6A 3JD0A 2IJHA 2JGUA 1RSOA 4DV3B 4DUZB 5EYPA 1W59A 2JJ2G 5KUMA 2CTQA 3CC4V 1YEWA 3MAQA 4QGPA 3G71V 2GUZB 1NVPD 2H3OA 3JCZA 1QBZA 1CPYA 2QM7A 4IYHA 2EIJB 2H8PC 1HR0B 4MW8A 4JI0O 4B3RO 1Q90D 4UV8A 3JARA 2Q7EA 3GVMA 3G4SV 1G1XB 2WLLA 1XNQB 4NTWA 5IYDO 1UPGA 3CCSV 3AG4B 3A8TA 3LSQA 2ETNA 3E8BA 1BQ0A 2CGNA 1MSDA 2P6JA 5KMGA 2A79B 2M7WA 4RAIA 2RQ6A 3SPHA 4J41A 3U11A 4NXNB 4IYIA 1DTOA 3AG1C 1F4MA 1U97A 3FB7C 4FLXA 4LFBB 4B3SO 2NLJC 4DV7B 2Q9LA 5LP6C 1J5EO 4X62B 4K8ZA 3ZMSA 4LCUC 4JYBA 5K1PA 3K9AA 4JI4O 4RO2A 4O2AA 3EHBB 4JF3A 1IBMO 3BA8A 4TSFG 1AR1B 3GB7C 2W6JG 5LMNB 1VQ4V 3TK1A 2B1GA 2HVJC 1AP5A 2DYSC 3EFFK 4G27B 2DYRC 2XASA 4JI1B 1H8HG 3ABMB 3CXCU 2GHYA 2JGDA 3B4SA 4X9QA 4TV8A 3UKMA 2UUAB 2X6BA 2PUSA 1RM1B 4EFEA 5CA0B 2VWKA 1I5YA 1ENVA 3JAKA 4YY3B 2HHHO 1Q8IA 3I55V 2NN4A 1SQPH 4FFBA 5EC1C 3SPJA 4X1IB 2XAJA 5A2QN 1VQOV 3K58A 4X66O 4ICGA 1MSWD 2GV9A 4FMTA 3OUFA 4X20A 2DYRB 1BE3H 2R72A 4JI2B 3E89A 2JEUA 3OW2U 2PI5A 1K34A 1GN3A 3OR6C 4ZHQA 3PN1A 4LNUA 2UXXA 1UFIA 1Q6UA 1XMOB 2ZCEA 3NXSA 1Q81W 3QVNA 1KKDA 2MK3A 1YIJV 3M7MX 3WFVA 4GT1A 1PNLA 3ZRSA 3BEHA 3K03A 5D5PA 4LF8O 1QHTA 4K0KO 3JASA 1HNZB 1N34B 1TA8A 2CH7B 2BOCC 4MTXA 2F4VB 3U10A 4ZKIA 3C3TA 3E8GA 3ETGA 3WG7B 4U7NA 5TISZ 3JASB 2Z5UA 2IH1C 2JK5C 2HR3A 5LMUB 4UCOA 4R6ZA 2ZXWB 5B1BC 4UUJC 1K4CC 4PA9A 1Y67A 2YI9A 3W7XA 1WNSA 1JA8A 3K79A 4P9OA 4JZGA 3ZHSA 1FXHA 1HNWB 3B40A 4JPRA 1XL6A 2VQEB 3RT3C 3WB2A 4DW1A 4DRXB 3ZHVA 3CMAV 2BSKB 4YJ2A 1AP6A 3BVOA 2WAMA 4UVAA 5JWPA 2QWRB 4O4HB 3ZS8C 3CCLV 3DXRB 3K06A 1VQ6V 3TJTA 4UVBA 2Q5ZA 4NKGB 3JCUZ 1RFYA 3ZRWB 1NTMH 2PZSA 2L35A 1PM9A 1BCCH 1DF5A 4X89A 4GX0A 4G28B 5IYCO 2XNDG 1K9MW 3FD9A 4I9WA 4IL6Z 3O9OA 2DQ0A 3H9VA 2LGWA 2EX3A 1E1QG 4ASUG 4H37A 3OTOB 2OIGA 3LNMB 2ILMA 3FYEB 1PV0A 5DECA 3H01A 5EYPB 1SC5B 1N0JA 2WLHA 3DTUB 4FM0A 2ZDIA 2HHHB 3FAVB 3CC2V 2IU3A 4U3JB 4PI0A 5DEDA 4CC6A 4CS3A 5J9PC 4Z2WA 1N36B 1YITV 3RFRA 2WLIA 3K3WA 1P7GA 4UCTA 3AG7A 4BAYA 2DE0X 1M1KW 2UXBO 3KZIZ 1XI1A 3TXQA 1S72V 2P90A 3BY6A 3CB2A 2EJRA 3ABLB 1QNMA 3H1HH 3E22A 4MVQA 1M57B 5EBWC 3ZN1A 1S5LZ 3SGIA 3RWRD 4EB6B 3OMAB 3N2KB 1RPRA 2V4DA 4JYAO 2XAHA 1P84F 2QE7G 1R3IC 2YS8A 1RP3B 3S3XA 1M9NA 4WFFA 4XDJA 5LXTA 4GKJB 1X59A 5LXTB 1EBOA 2AZ2A 1FYJA 3JAWB 5FPOA 1XNQO 3RN4A 5KX5A 1AJQA 1Q6HA 3KKYA 2MW2B 2FYUH 4H33A 2VQFB 2HLDG 5LGNA 3R65A 4NTXA 4CH6A 1LNQA 4DR7B 3STZC 3CWBH 4WFEA 4J10A 3JAWA 1GM8A 1IXMA 1SKVA 3CHXA 1S5JA 3ZX6A 5CA3A 4FFKA 3OD4A 3ZEDA 3RYCB 4PA7A 4LF6O 1GO3F 1MG1A 2BSKA 4JYYA 2ITDC 1MZFA 1YDXA 1M56B 1T5EA 3OTOO 1VQKV 1WN7A 2CTPA 4PELA 4X1IA 3LDCA 4JTDB 4DR5O 1R3JC 3X2QB 4C7UA 4K3AA 5J2TB 4DV1O 3AEIA 1HR0O 5IJ0B 4B3TB 5E1AC 1OCOC 3K59A 1PKXA 4B3MB 1KD1W 3RVYA 2XHBA 1Q43A 3K9SA 5B5EZ 1AVMA 2PYLA 3GWKC 5JVDA 1GMGA 2QM4A 2IU0A 3VOUA 1VQ7V 5IJ0A 4NVPA 3AG3C 4DV0B 2LP7A 3LSSA 4I7ZB 4Q20A 1GH6A 3JD1A 1XBLA 3BRCA 5L3FA 4DV6B 1AILA 1QR8A 2BTQA 3CCQV 2E3CA 5EIBC 2Y69C 5CB4A 3WG7C 1KB9F 2RNBA 2A06H 1WB8A 4RWUA 3IJ4A 4MT8A 1QR9A 4DV4B 2KG7B 2QKCA 4X64O 1IBLB 2YIDA 1QQCA 2UUBO 3JATB 2UUCO 2EIJC 2GTAA 1KC8W 1VMGA 2PI4A 5LA6A 2EILC 3ZRWA 2YIAA 3B77A 1YJWV 3T1YO 2A3QA 3JALB 1M57C 2FMLA 4FZ1A 2KB1A 3JSLA 1HNXB 2W0XA 4ZI7B 3ZMZA 4O4LB 3TGUH 2CTRA 5H6RA 5FNVB 4JYAB 1FJGB 4X88A 5B1AC 5LYJB 1YVWA 3SYQA 4EFBA 1NTKH 1K4DC 1MABG 4E4EA 2P4VA 4GKJO 3HKCA 2VS0A 3L73H 5IE9A 1JFFB 1WB7A 1KYOF 3B8MA 4TV8B 2X7RB 2QWPB 1XMOO 4X20B 4X8AA 1XOUA 4JTCB 1N36O 5KLVH 2OCCC 4JI3B 3ZBHA 3FB6C 4IT5A 3ASOB 4JI6O 4UB8Z 3QF7A 2AXTZ 4KUMA 5LGUA 1VQ5V 4LFCB 1AI6A 1PL4A 2OTLV 2XAFA 4OX9B 4MVRA 3WB1A 4JI7O 5FPRA 4DYLA 3CX5F 4B3MO 4PDLA 2Q73A 1H2LA 3WB0A 2ODMA 5JCOA 2CH7A 2WLKA 3ASNB 3ASOC 4X66B 1WLEA 2Q0AA 4QE7A 1XQ8A 1V54C 4F6EA 2ZM6O 1Y74A 4F6RB 4ZHQB 1M93A 5E79Z 1D2DA 3ZCCA 3VQXA 2EIMC 2WWWA 5JJEB 3T1YB 5IWAO 1DLBA 4UCVA 1KBHA 3TCUA 1YJ9V 4U7OA 5JQGA 5JQGB 1RM1C 5LHGA 1JPXA 2HVKC 3T4ZA 3HKDB 1VF6A 2YI8A 4OPAA 4LBEC 3BPZA 3CRRA 3H1IH 2BOBC 1I94B 4KHPB 1SQBH 2CUGA 3OFNG 1NH2D 5BXZA 1VP7A 3H1KH 5KAFZ 2UU9O 2ZR2A 1M4UA 4O4LA 5H6QA 3A2FA 1FPOA 4F4LA 2Y69B 5KA5A 3FB5C 2EINC 4FVMA 5J2UB 3A0BZ 2DWDC 2ZE8A 2UUBB 2YIBD 4UB6Z 4X64B 1XUQA 1QLEB 1KUQA 1YZBA 3CCVV 3KCYA 4DRXA 5BMVA 2XOKG 5EC2C 4DV2B 3N2GA 3P3NA 5H5NA 4YIPA 4WFGA 5LHIA 1OCRB 1SQQH 3MHHC 1VF6C 3CC7V 5AG2A 5CBHA 2OT5A 4BW9A 4DV3O 4LF8B 4K0KB 1BSMA 4IHJB 4JYCA 4LF4O 1BMFG 4WBNB 4LF5O 4DV0O 1F7YA 4JV5B 3UT5A 2Z0AA 4FLZA 1YF2A 3QO7A 3W7UA 4K8XA 4BIZA 2ZNJA 1N33O 2BE3A 2YUAA 1AI5A 1TUBA 4R7CA 4GCZA 2ZKOA 4D7TA 1WP8A 1GM9A 1NR1A 4RUFA 1ZTEA 5B1OA 2UXDB 5GTHZ 4OPHA 1VF7A 4PV1B 3B2EE 1YTFB 2Q67A 4O4JA 2LJ2A 2K9PA 3UO3A 1R6TA 1H2GA 4X65O 5KA6A 3VQVA 1XNRO 5B1AB 1ZLZA 3P32A 4GKKO 4CC5A 2ZE6A 5KMGB 3CJHB 2X0LA 3ABMC 2P5OA 5L3EA 4B3TO 1G4YB 2ZXWC 3DC6A 4LF9B 5EIBD 4DV1B 4LC1A 3EVKA 3APOA 2PTMA 2VQEO 5IYZB 4DR3O 4DR6B 2RCVA 5KAIZ 1QVGU 4UCUA 2V1DA 2L6LA 1EN5A 5LMNO 1XILA 3CEIA 2JEXA 3CSXA 1HP8A 2FKXA 3D36C 1JVMA 5GONA 2ADPA 4LFBO 1PPJH 3JAKB 1TGOA 2Q69A 1TAEA 3UO2A 1B6QA 1QLNA 5BMVB 4MTOA 2EJ7A 4JI8B 4DK1A 3LDEA 4GKKB 1SS3A 4NXNO 1WAZA 1IBMB 3D3QA 1UJWB 3NR7A 1VQNV 2Q6AA 4KP4A 4TQDA 3T1HO 4CH5A 2QSAA 3BFRA 1ZX3A 3S3WA 2CAZC 2UXDO 1WA8B 3SJAC 4J7KA 2CTWA 5H2FZ 2EULA 5BY1A 2OIEA 2FB5A 3OTFA 1AB3A 2ZIOA 4PA3A 1VQMV 2EIMB 4TQFA 1XDCA 1JQ0A 1HWYA 1BZKA 3K5MA 5A9GA 2YEVA 1Q7YW 1MOFA 4WCEV 5HFLA 3SYOA 3CE2A 4K35A 1IVSA 2D2CB 2LFSA 2O57A 3AG2B 3KCXA 3W7SA 5CN0A 2AHZA 3CRCA 3QO8A 3CJHA 1Q5OA 2YXYA 4WFBV 3N27A 1TUBB 3Q4HB 3Q4HA 4LFAB 3VQYA 4U3FH 1H38A 1H2NA 4GX2A 4U3JA 5IYZA 1ZAUA 1N32O 4Q6GA 4FJCC 1NR7A 1XMQO 3ZIAG 3E86A 3JARB 4JI8O 1SA0A 5B3SC 5IJ9A 3RGBA 1VQ8V 2Y48A 1KKCA 1R1BA 4KFMA 2P4KA 3N2KA 5J2UA 3T2MA 3HKDA 3CRQA 4DW0A 4JI5B 3SYCA 3E83A 3QTCA 3D8CA 4HAMA 4YJ3A 3X2QC 4RUEA 4I0XA 3OGCC 3CCUV 3OUSA 2ARHA 2V7QG 5IY5B 2RN9A 1MNGA 2X6CA 4I50B 1G6UA 1H2KA 2LQTA 1WA8A 1M56C 2ADQB 3N2GB 2VWJA 4AHCA 3ETEA 1FFXA 4DR6O 3CP1A 3RW0A 4AQYO 1AROP 1K5SA 5KHIA 2KQXA 2DJVA 4IHJA 1NU1H 3IFXA 1XHZA 5F2VO 2XUMA 5EBLC 1ZL8B 4JI0B 1WJZA 1KMIZ 3HB3B 4PI2A 4MTGA 4DV7O 3CD6V 2WLNA 3DC5A 3J7AU 2QDOA 3O65A 2KKWA 2WLJA 5KHHA 4BIOA 2HEPA 1B04A 2PF4E 4X1KB 3AK3A 4B08A 5KUKA 3CPWU 1Y76A 4KXRA 2B9ZA 3K5OA 1M90W 3OT7A 4O4HA 2W0FC 4IGGA 4LH6A 4JAAA 4I5SA 1ZSPA 1EM1A 2AW9A 4FFBB 2LW7A 3TXSA 5FLXN
chains in the Genus database with same CATH topology
1S5HC 2NLJC 1FXKA 4X88A 5B1AC 3MD0A 5BZBA 3ZMUA 3MHSC 3SYQA 3F7VC 2WSSG 4JAUA 1GTOA 2AHYA 1K4DC 1MABG 3OEEG 3ZMSA 4LCUC 4DO2A 1W0KG 4RQFA 4JYBA 5L3CA 3K9AA 4QPJA 4PDMA 3LDDA 2EZPA 4RO2A 1JOYA 2JJ1G 1E79G 3OEHG 3E2EA 3B8MA 3QO5A 2X7RB 4UVCA 2D3OW 3EHBB 2ZQMA 4JF3A 2OTJV 1CEZA 4TSFG 4X8AA 4JASA 3GB7C 1AR1B 3K08A 4JTCB 2W6JG 1VQ4V 3TK1A 1NQTA 2OCCC 2B1GA 3ABTA 2HVJC 2DYSC 2NNUA 3EFFK 5FL7G 3FYIB 3E8FA 3FB6C 4G27B 2DYRC 3ASOB 3W7WA 2DWEC 2XASA 4KUMA 1H8HG 3ABMB 3FB8C 3SYAA 5LGUA 3CXCU 1VQPV 1VQ5V 2GHYA 1AI6A 1KP2A 3UKMA 2OTLV 2XAFA 4CBCA 1Y4MA 2X6BA 4QE9A 3JYCA 4MVRA 2EZOA 1RM1B 2R9RB 1I5YA 1ENVA 1SETA 4PDLA 1FXVA 4FIPC 3I55V 4R8CA 2IJKA 1SESA 5EC1C 3SPJA 1R6NA 2XAJA 1VQOV 1K92A 4RQEA 2R9IA 3K0DA 2ZDIC 3ABLC 4UV9A 2WLKA 4FMTA 3OUFA 1MSWD 3ASNB 1AJPA 2DYRB 3ASOC 1WLEA 3E89A 1TUEB 4LP8A 1R6KA 2JEUA 4QE7A 1NJIW 1V54C 3OW2U 2PI5A 1K34A 1GM7A 1XL4A 3OR6C 2IW5A 1CP9A 3ABUA 4PA6A 3SPIA 1E1RG 2UXXA 1VQ9V 3ZCCA 1QVFU 2EIMC 2HG5C 3NXSA 5B3SB 2WWWA 3SPGA 1Q81W 4MVOA 1FFTB 5H9CA 1KKDA 1DLBA 2MK3A 3TCUA 1YIJV 1YJ9V 4U7OA 3WFVA 4GT1A 2YSUB 1PNLA 3CYOA 3ZRSA 1RM1C 3BEHA 4PA4A 4WFAV 4BIUA 5LHGA 2ATKC 3K03A 1JPXA 2HVKC 4MVUA 1EZJA 2BOCC 2WPDG 4N23A 3T4ZA 4MTXA 4LBEC 1ZWIC 2DQ3A 1YI2V 2FTKA 2BOBC 3CCEV 3OFNG 4CZZA 4ZKIA 1NH2D 1K8AW 3E8GA 4MVMA 3ETGA 3WG7B 2EBOA 2ZR2A 4U7NA 4Z1MG 5H6QA 4F4LA 2Y69B 5KA5A 3FB5C 2Z5UA 2EINC 2IH1C 2X6AA 1R73A 1K3EA 2DWDC 2JK5C 2B5UA 2HR3A 2CK3G 1YTFD 1ORQC 4R6ZA 2ZXWB 4MVSA 1V54B 4QJFB 5B1BC 1AI7A 1S0VA 4UUJC 3E35A 3RBZA 1Q86W 1K4CC 1QLEB 4GX5A 4PA9A 3CCVV 2XOKG 5B1BB 3W7XA 5EC2C 3K79A 2H94A 4P9OA 3TETA 3OMNB 4WFGA 5LHIA 1FXHA 1OCRB 3MHHC 2WLIB 1OCZB 4JPRA 2QA4V 1JX9A 2K1EA 3CC7V 1XL6A 5CBHA 1OCZC 2OT5A 1FXKB 4HZ3A 4JYCA 2IJJA 1BMFG 3CMAV 5GW7A 5LGTA 5LBQA 3OMIB 4UVAA 2WAMA 1JCHA 1FS0G 3LUTB 3QO7A 4BIZA 3W7UA 1AI5A 3T4DA 4R7CA 3CCLV 5EK0A 1NKDA 2ITCC 2OCCB 1NH2B 1K5QA 1WPXA 3ZN0A 1SERA 4GCZA 3K06A 1VQ6V 2XAGA 5DM6V 1GM9A 1NR1A 4RUFA 4UVBA 5B1OA 2W6IG 3T1CA 3ZRWB 3JD3A 1OCOB 3STLC 5IYBO 1DF5A 2ZD9A 4X89A 3I56V 1YTFB 2Q67A 4GX0A 4GX1A 4G28B 5IYCO 2XNDG 3DGEA 1BL8A 2GSMB 1K9MW 4I9WA 3ZRVA 1H2GA 2QKSA 4HYOA 5KA6A 2DQ0A 5B1AB 3JD4A 3P32A 1E1QG 4ASUG 3OAAG 4H37A 1GKFA 3AG3B 3LNMB 5IY5C 3FYEB 2X0LA 3ABMC 5L3EA 5L3GA 3ASNC 1AJNA 3H01A 1G4YB 2ZXWC 2WLHA 3DTUB 2ZDIA 2B1IA 3CC2V 1K97A 4LC1A 2IU3A 3CMEV 3SPCA 4E2LA 3ABKB 4JTAB 1S77D 2LFRA 2WLMA 1OZ0A 4DXWA 4MSWC 1QVGU 2V1DA 5J9PC 4UXNA 2Z3YA 3SJQC 2UXNA 1EFRG 1OCRC 4PDRA 1ROPA 1YITV 2JEXA 2WLIA 3W7TA 3HPLC 3K3WA 5IDJA 3D3IA 4EKWA 1JJ2U 4BAYA 4XBFA 1JVMA 1P7BA 2ZR3A 1R3LC 3B8NA 3OM3B 1M1KW 1S76D 1V55B 4YXWG 4QNHB 2HJFC 2A0LA 1S72V 3UM7A 1I5XA 3M99B 2P90A 3BY6A 2EJRA 3ABLB 3D36A 2QEXV 2Q69A 3CCJV 1B6QA 1QLNA 1THZA 4MVQA 1M57B 4QPKA 5EBWC 4JAVA 3ZN1A 5L3BA 2EIKC 4FPPA 3AG2C 3F5WC 3K04A 4MTOA 3LDEA 4G2KA 3IC7A 3OMAB 4FK5C 2A9HA 1W0JG 1V55C 4J9YB 1RPRA 3ABKC 5DN6G 3SYPA 1DF4A 3A0RA 1PL0A 1UJWB 3JD2A 1F51A 1GK9A 2XAHA 3CCMV 4MVZA 1KP3A 2C2AA 2QE7G 3ETDA 1R3IC 3FKSG 5LHHA 1YJNV 1M9NA 1VQNV 2Q6AA 3KG2A 4KP4A 4WFFA 4WFHA 4XDJA 3ZMTA 2EIKB 5C93A 4PDVA 1EBOA 4MS2A 4XDLA 1SZTA 2JDIG 2HFEC 1AJQA 3ZRXA 1PD3A 1W2BU 4H33A 4MTFA 4BW5A 4PA3A 2HLDG 5L3DA 1VQMV 2EIMB 5LGNA 1J95A 3R65A 1Q82W 1LNQA 1SRYA 2JIZG 3STZC 4WFEA 1JQ0A 1K7DA 1PNKA 1HWYA 1GM8A 1IXMA 2DYSB 2YEVA 5CA3A 1Q7YW 1MOFA 4WCEV 5HFLA 4P30A 4TWKA 3K0GA 3SYOA 4OXSA 4PA7A 2LFSA 1GO3F 1OHHG 2EINB 4R50A 1VQLV 3AG2B 3W7SA 1FXKC 5CN0A 2AHZA 1MG1A 3QO8A 5CBGA 2HKOA 2ITDC 4WFBV 1M56B 1VQKV 5EBMC 3CCRV 3E8HA 1K73W 4XDKA 1PNMA 1R3KC 2XAQA 4PELA 1H38A 4GX2A 2QM8A 3LDCA 4JTDB 1S3JA 5B1NA 1R3JC 1L1FA 1H8EG 3X2QB 4P2ZA 4FJCC 4QIWF 2Q68A 3G6EV 1QCEA 3AEIA 1NR7A 4TT3G 1KQSU 3ZIAG 1YHQV 5HFMA 3PJSK 3E86A 5E1AC 1OCOC 3ZMVA 1PKXA 5B3SC 1KD1W 1VQ8V 2Y48A 2EILB 3RVYA 3ZJZA 4JGSA 5CMUA 2F43G 3IGAC 4KFMA 3ML0A 1N8RW 3T2MA 1AI4A 1OCCB 1K33A 3SYCA 3E83A 4HAMA 3X2QC 4RUEA 3OGCC 1GMGA 1NBMG 1COWG 3QNEA 1Y66A 4ZBMA 2IU0A 3CCUV 4MW3A 3OUSA 1KECA 3VOUA 1VQ7V 3F7YC 1NVPB 4WF9V 2V7QG 3VBBA 3AG3C 4J9ZB 5IY5B 2X6CA 2LP7A 1F23A 3LSSA 1G8MA 4Q20A 4N21A 3P30A 1F4NA 3JD1A 1M56C 4P9PA 2P67A 3GWOA 3JD0A 2IJHA 2QTOA 5L3FA 3AG1B 1OCCC 1QR8A 3CCQV 1RPOA 3ETEA 1BHAA 2JJ2G 2YEVB 5KUMA 2Y69C 3CP1A 3RW0A 3WG7C 3CC4V 1NVPD 3G71V 1AROP 1K5SA 1P4RA 1BHBA 3AG4C 3JCZA 3IFXA 1QBZA 4MT8A 5EBLC 5CBFA 1CPYA 1QR9A 1QLEC 2QM7A 3HB3B 4MTGA 1YSCA 2WLNA 3CD6V 2DW4A 2EIJB 2H8PC 4MW8A 2EIJC 4UV8A 1KC8W 2P7TC 2PI4A 2WLLB 2WLJA 3G4SV 2WLLA 2EILC 3ZRWA 5IYDO 3CCSV 3OE7G 2IH3C 3AG4B 2IJIA 3B77A 3OR7C 3LSQA 4L87A 1YJWV 3E8BA 3CPWU 1M57C 5KUKA 2P6JA 1M90W 2A79B 2W0FC 2M7WA 2KB1A 3RVZA 4RAIA 3SPHA 4I5SA 1DTOA 3AG1C 3ZMZA 1F4MA 3FB7C 5H6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM V;  3I55 V;  3CCV V;  1S72 V;  1KD1 W;  1VQ8 V;  1VQ4 V;  1QVF U;  3CCE V;  1VQK V;  3CCR V;  1YJN V;  3CCQ V;  1K73 W;  1KC8 W;  1K8A W;  1K9M W;  1VQO V;  1VQN V;  1QVG U;  1Q81 W;  2QEX V;  3G4S V;  1N8R W;  3CCJ V;  3CCL V;  1Q86 W;  1Q7Y W;  1YJ9 V;  1YIJ V;  3CCS V;  4WCE V;  1VQ5 V;  1VQP V;  3CXC U;  1YJW V;  3CC4 V;  3G71 V;  1VQ6 V;  1YIT V;  5DM6 V;  2OTL V;  3CPW U;  3CCU V;  4WFA V;  1NJI W;  1R73 A;  3OW2 U;  1VQ7 V;  1M90 W;  1W2B U;  4WF9 V;  3G6E V;  2QA4 V;  1VQL V;  3CC7 V;  4WFB V;  1JJ2 U;  1KQS U;  3CC2 V;  1VQM V;  1YHQ V;  3CD6 V;  2D3O W;  2OTJ V;  3CME V;  1M1K W;  1Q82 W;  1YI2 V;  3I56 V;  1VQ9 V;  3CMA V; 
#chains in the Genus database with same CATH topology
 1N34 O;  1ZUQ A;  1L0L H;  3MD0 A;  3ZMU A;  1RSO B;  3MHS C;  5J2T A;  1Y76 B;  3F7V C;  4JI2 O;  2WSS G;  1GTO A;  2AHY A;  4DUZ O;  3OEE G;  3G80 A;  5JJN B;  5L3C A;  3LSU A;  3LDD A;  1JOY A;  2DN9 A;  4UVC A;  5B66 Z;  5BR8 B;  4JAS A;  4J7Z A;  3K08 A;  2E75 B;  3UT5 B;  1NQT A;  4DUY B;  4LFC O;  4O4J B;  3E8F A;  1SA0 B;  3FB8 C;  4LNU B;  5ITZ A;  1VQP V;  1KP2 A;  4CBC A;  2AZ0 A;  4TUY B;  5GON B;  2NR5 A;  3JYC A;  4DK0 A;  3FFQ A;  4DV2 O;  1TVK B;  3AK2 A;  2R9R B;  4X1Y A;  1AR4 A;  1H2M A;  4FIP C;  4R8C A;  4UFZ A;  1R6N A;  1MZE A;  1DK1 A;  3WU2 Z;  2ZDI C;  4I4T B;  2UXC B;  1R6K A;  3CXH F;  4J11 A;  1GM7 A;  2QGN A;  2A7W A;  2ZIN A;  4FLW A;  2IW5 A;  3FX7 A;  3SPI A;  2QTS A;  1VQ9 V;  2WA4 A;  3HR0 A;  2KG7 A;  4AQY B;  5JCO C;  2HG5 C;  1SQF A;  5LP6 A;  5B3S B;  3SPG A;  2F23 A;  1FFT B;  3G67 A;  5H9C A;  3RYI B;  4ZI7 A;  4PA4 A;  1OJH A;  2PYJ A;  2WPD G;  3EXA A;  4N23 A;  3JAL A;  1ZWI C;  2OWO A;  2CGO A;  1XMQ B;  1YI2 V;  2CDY A;  1VAR A;  5C8Y A;  3FAV A;  1K8A W;  3LNN A;  4MVM A;  1N32 B;  2KSD A;  1V9P A;  2EBO A;  4Z1M G;  2QKA A;  2QJ1 A;  4UCS A;  2X6A A;  1R73 A;  1K3E A;  2B5U A;  3BAB A;  2CK3 G;  1ORQ C;  2DOS A;  4MVS A;  5KHK A;  1XHX A;  4QJF B;  2E5L O;  3E35 A;  3RBZ A;  4GX5 A;  3CRA A;  2RMK B;  5B1B B;  2QR4 A;  3BA9 A;  2H94 A;  2FL4 A;  3OMN B;  2DMX A;  3IC9 A;  2PGG A;  4DR1 O;  3J80 N;  4AI8 A;  1OCZ B;  3SJC C;  2QA4 V;  1JMK C;  1JX9 A;  2K1E A;  4DV5 O;  1JR9 A;  5CA1 B;  3L72 H;  4J42 A;  1FXK B;  4HZ3 A;  4Z1V A;  2IJJ A;  1X4T A;  5GW7 A;  1JCH A;  1FS0 G;  3K5L A;  3T4D A;  4X1Y B;  5EK0 A;  1NKD A;  3E22 B;  2ITC C;  2RJZ A;  4UCR A;  2XTA A;  4TV9 A;  1SER A;  2Y0P A;  2XT9 A;  1Y6X A;  2LO1 A;  3U0Z A;  1GN4 A;  3STL C;  5IYB O;  5LL6 Y;  4FLY A;  3C90 A;  3I56 V;  2OCH A;  4FLV A;  2OYQ A;  2LGQ A;  4HBN A;  1BL8 A;  2GSM B;  1NZ6 A;  4YHH B;  3ZRV A;  5CB4 B;  4NXM B;  5EZY B;  2QKS A;  3JD4 A;  1IBK O;  2YC0 A;  3OAA G;  3AG3 B;  1NI8 A;  5L3G A;  1IBL O;  3CRM A;  1I94 O;  4KHP O;  3RYC A;  3ETQ A;  5LA6 B;  4O2B A;  2UUC B;  4CS4 A;  4E2L A;  1NT2 B;  1N4C A;  4JTA B;  2WLM A;  4ZOL A;  5LYJ A;  4DXW A;  1ZL8 A;  1EN4 A;  2Z3Y A;  4PJ0 Z;  1I08 A;  4JI5 O;  4DR4 O;  4NXM O;  3W7T A;  3HPL C;  1Z5V A;  5IDJ A;  3HKE A;  4B3S B;  4NB5 A;  4D6T H;  1JJ2 U;  2ZM6 B;  1IDS A;  2ZR3 A;  4DV4 O;  1V55 B;  4X1K A;  4QNH B;  2HJF C;  4LF9 O;  1I5X A;  3M99 B;  3THO A;  4KL1 A;  3D36 A;  2QEX V;  1IXB A;  2G38 A;  3CCJ V;  4QPK A;  4JAV A;  5L3B A;  4FPP A;  4X65 B;  3F5W C;  3K04 A;  1XNR B;  1SF9 A;  1YCI A;  5JJJ B;  3IC7 A;  4J9Y B;  4FK5 C;  1W0J G;  1V55 C;  2QWN B;  5DN6 G;  1CXZ B;  1NTZ H;  1PL0 A;  3CS5 A;  4OX9 O;  4IIJ B;  3JD2 A;  1F51 A;  2R70 A;  3L71 H;  5LHH A;  3ETD A;  4WFH A;  4JI6 B;  3ZMT A;  2EIK B;  5C93 A;  3C3S A;  4LH7 A;  4XDL A;  1DGS A;  2AGA A;  3ZRX A;  1PD3 A;  1VIB A;  2BCC H;  4IIJ A;  2PY5 A;  2Y4T A;  3IAY A;  4MTF A;  2E5L B;  5BR8 O;  1N0N A;  1PP9 H;  2JRI A;  4BW5 A;  4LF4 B;  3SJB C;  2Q8V A;  1Q82 W;  2JIZ G;  1K7D A;  4H13 B;  1GAX A;  1PNK A;  2Q4P A;  4JZ2 A;  1HNW O;  1NS1 A;  4P30 A;  4TV9 B;  4LWS A;  4TWK A;  4O2B B;  3G6B A;  3P3P A;  1OHH G;  2EIN B;  1VEW A;  4GUN A;  4R50 A;  1FXK C;  3ZHR A;  2ZE5 A;  5EBM C;  1HNX O;  1BQZ A;  4XDK A;  3H1J H;  2XAQ A;  2QM8 A;  2JS3 A;  1IZ3 A;  2N04 A;  2YXH A;  1L1F A;  3I5D A;  1H8E G;  1IBK B;  2Q0O C;  2GDS A;  2Q68 A;  3G6E V;  1QCE A;  4LR3 A;  3ZHT A;  1P49 A;  4TT3 G;  2HP8 A;  4AIL C;  5HFM A;  2YIB A;  3PJS K;  3ZMV A;  2JGD B;  3ICX A;  2EIL B;  1SZX A;  2LW1 A;  3IGA C;  1N8R W;  1QU7 A;  4O4I A;  4YJ2 B;  3HKB A;  4ZBM A;  1NBM G;  3QNE A;  1COW G;  1FFX B;  1Y66 A;  1KEC A;  3HKC B;  3VBB A;  2F4V O;  1F23 A;  2YIC A;  1G8M A;  4N21 A;  3P30 A;  1F4N A;  3RYH B;  1US6 A;  3GWO A;  2QTO A;  3AG1 B;  1OCC C;  1RPO A;  3QG5 A;  1BHA A;  1L8D A;  3K5N A;  5C8Y B;  2YEV B;  3OGI B;  3RYI A;  1U96 A;  3BAA A;  1P4R A;  1BHB A;  3AG4 C;  1SQX H;  5IWA B;  1XEQ A;  4BR6 A;  5CBF A;  1QLE C;  2UXB B;  2ZE7 A;  1MA1 A;  1A32 A;  1YSC A;  2DW4 A;  4LWS B;  1WPB A;  2P22 C;  2P7T C;  3DXR A;  2WLL B;  4I55 B;  1FAF A;  5LOV A;  3OE7 G;  2IH3 C;  2IJI A;  3OR7 C;  4L87 A;  5KHJ A;  4CS2 A;  4LF7 B;  2F93 B;  3B09 A;  2N74 A;  1LR1 A;  3RVZ A;  1D5A A;  1Z2G A;  1S5H C;  4DR5 B;  1FXK A;  2JS5 A;  5BZB A;  4JAU A;  5D5Q A;  2R9A A;  3JAT A;  4DO2 A;  1W0K G;  4RQF A;  4B7E A;  4YIO A;  4QPJ A;  4X62 O;  4OGQ B;  4PDM A;  1URF A;  2EZP A;  3BCC H;  4I50 A;  2JJ1 G;  1E79 G;  2IM9 A;  2M6Y A;  3OEH G;  4L8J A;  3E2E A;  3QO5 A;  4LF6 B;  2D3O W;  2OTJ V;  2ZQM A;  1CEZ A;  2N05 A;  4I0X B;  4DR4 B;  3ABT A;  4EEQ A;  2NNU A;  5FL7 G;  3FYI B;  3W7W A;  2DWE C;  1FJG O;  3SYA A;  4ZIB A;  3J81 N;  5IT9 N;  1Y4M A;  4O2A B;  4QE9 A;  3SR2 C;  3T1H B;  2F1M A;  1LUW A;  2EZO A;  1TVK A;  1VF5 B;  4HNA A;  1SET A;  1O9H A;  1FXV A;  2IJK A;  1SES A;  5EZY A;  1K92 A;  2ZIM A;  4RQE A;  2R9I A;  3K0D A;  3ABL C;  4UV9 A;  1AJP A;  4EB6 A;  5LP6 B;  3HKB B;  1TUE B;  4HNA B;  4LP8 A;  1IUR A;  1M5I A;  1NJI W;  5KX5 B;  2ZT9 B;  1XL4 A;  1Q3E A;  4I55 A;  4ABM A;  1CP9 A;  3ABU A;  4PA6 A;  1E1R G;  3RYH A;  4GLX A;  4J80 A;  4FLT A;  1QVF U;  1BGY H;  4MVO A;  4LF7 O;  1Q6I A;  2YDE A;  3RYF A;  1FKA O;  2YSU B;  3CYO A;  4WFA V;  4BIU A;  1JFF A;  2ATK C;  2QWO B;  1JJO A;  4B3R B;  4NTY A;  4MVU A;  3BHP A;  1EZJ A;  5CA0 A;  4DV6 O;  1B06 A;  2DQ3 A;  2FTK A;  3CCE V;  4CZZ A;  3AK1 A;  1EZV H;  4H0L B;  4TUY A;  2E76 B;  4FM2 A;  1YTF D;  1V54 B;  1AI7 A;  1S0V A;  1Q86 W;  4JI1 O;  2Q7H A;  4FM1 A;  1OV9 A;  4D7S A;  3R66 A;  3MDS A;  3TET A;  1GRJ A;  2WLI B;  4DR7 O;  4LF5 B;  1OCZ C;  4JI4 B;  4I4T A;  2VQF O;  5LGT A;  1I0H A;  5LBQ A;  3OMI B;  4PD4 F;  3M8A A;  3LUT B;  2QWQ B;  1J5E B;  2UUA O;  2BTQ B;  3L70 H;  1LUV A;  2OCC B;  1NH2 B;  1K5Q A;  1WPX A;  3ZN0 A;  3JAM N;  1HDJ A;  3L9D A;  2XAG A;  5DM6 V;  1MMM A;  2W6I G;  3T1C A;  4TOI A;  3JD3 A;  1OCO B;  5LMU O;  2HJD A;  2ZD9 A;  4GX1 A;  3A0H Z;  1HNZ O;  3DGE A;  2F66 C;  4H44 B;  4HYO A;  4LFA O;  1SQV H;  4WBN A;  1GKF A;  5IY5 C;  4A5U B;  3ASN C;  1B3Q A;  1AJN A;  3F5T A;  2B1I A;  1K97 A;  4CH3 A;  3CME V;  3SPC A;  2Y4U A;  3ABK B;  4DV5 B;  5FNV A;  1S77 D;  2LFR A;  1OZ0 A;  4MSW C;  2UXC O;  4UXN A;  1HW7 A;  3SJQ C;  4DUY O;  2UXN A;  1EFR G;  1OCR C;  4PDR A;  1ROP A;  4JI3 O;  5JH7 B;  1BT8 A;  2F95 B;  3D3I A;  5KHG A;  4DR2 B;  5LOV B;  4EKW A;  2CE4 A;  4XBF A;  4FLU A;  3B8N A;  1P7B A;  1R3L C;  1S76 D;  3OM3 B;  4YXW G;  1GN2 A;  2A0L A;  2GBO A;  3UM7 A;  1EN6 A;  1THZ A;  4DR1 B;  3L75 H;  1L0N H;  1YXB A;  2EIK C;  3AG2 C;  5ITZ B;  5CA1 A;  4GZR B;  4I9Q A;  4YY3 O;  3UCS C;  4G2K A;  2RDC A;  2A9H A;  3ABK C;  3SYP A;  1DF4 A;  3A0R A;  3ZHQ A;  1GK9 A;  4DR2 O;  3CCM V;  4MVZ A;  1KP3 A;  2C2A A;  3FKS G;  5IJ9 B;  1YJN V;  3KG2 A;  3SDL A;  4PDV A;  4MS2 A;  1SZT A;  2JDI G;  2HFE C;  1O9G A;  1SQG A;  5JVD B;  1W2B U;  4F6R A;  1Y74 B;  1BS3 A;  1I7F A;  5L3D A;  2BTO A;  1J95 A;  2GUZ A;  4GYC B;  1SRY A;  4ZOL B;  4O4I B;  4J7J A;  1IX9 A;  2DYS B;  3APQ A;  2UU9 B;  1XRE A;  2Y0I A;  3K0G A;  2WA3 A;  4OXS A;  1VQL V;  4PHZ A;  4W4K A;  4DR3 B;  5CBG A;  2HKO A;  4CH4 A;  1FD9 A;  4YJ3 B;  3K57 A;  1K73 W;  3CCR V;  3E8H A;  3H1L H;  3RYF B;  3JSN A;  1PNM A;  1R3K C;  1S3J A;  4B7K A;  5B1N A;  3DSQ A;  1WP7 A;  4FZ0 A;  3ZHU A;  4P2Z A;  2JVD A;  4QIW F;  2Q7G A;  1KQS U;  1H2S B;  1YHQ V;  3VQW A;  5JH7 A;  1Z5W A;  5K1X A;  1AR5 A;  3HKE B;  3ZJZ A;  4JGS A;  2E74 B;  5CMU A;  1D5N A;  4NR1 A;  2F43 G;  2IBZ H;  3ML0 A;  1AI4 A;  1N33 B;  1OCC B;  1K33 A;  4YHH O;  2ZNI A;  4JV5 O;  4W4L A;  2YXL A;  4MW3 A;  2VRZ A;  3F7Y C;  1NVP B;  4WF9 V;  3UQ8 A;  2GTS A;  3L74 H;  4J9Z B;  5GTI Z;  4BWA A;  4NYK A;  2P06 A;  4P9P A;  1KU9 A;  4JI7 B;  2P67 A;  1GN6 A;  3JD0 A;  2IJH A;  2JGU A;  1RSO A;  4DV3 B;  4DUZ B;  5EYP A;  1W59 A;  2JJ2 G;  5KUM A;  2CTQ A;  3CC4 V;  1YEW A;  3MAQ A;  4QGP A;  3G71 V;  2GUZ B;  1NVP D;  2H3O A;  3JCZ A;  1QBZ A;  1CPY A;  2QM7 A;  4IYH A;  2EIJ B;  2H8P C;  1HR0 B;  4MW8 A;  4JI0 O;  4B3R O;  1Q90 D;  4UV8 A;  3JAR A;  2Q7E A;  3GVM A;  3G4S V;  1G1X B;  2WLL A;  1XNQ B;  4NTW A;  5IYD O;  1UPG A;  3CCS V;  3AG4 B;  3A8T A;  3LSQ A;  2ETN A;  3E8B A;  1BQ0 A;  2CGN A;  1MSD A;  2P6J A;  5KMG A;  2A79 B;  2M7W A;  4RAI A;  2RQ6 A;  3SPH A;  4J41 A;  3U11 A;  4NXN B;  4IYI A;  1DTO A;  3AG1 C;  1F4M A;  1U97 A;  3FB7 C;  4FLX A;  4LFB B;  4B3S O;  2NLJ C;  4DV7 B;  2Q9L A;  5LP6 C;  1J5E O;  4X62 B;  4K8Z A;  3ZMS A;  4LCU C;  4JYB A;  5K1P A;  3K9A A;  4JI4 O;  4RO2 A;  4O2A A;  3EHB B;  4JF3 A;  1IBM O;  3BA8 A;  4TSF G;  1AR1 B;  3GB7 C;  2W6J G;  5LMN B;  1VQ4 V;  3TK1 A;  2B1G A;  2HVJ C;  1AP5 A;  2DYS C;  3EFF K;  4G27 B;  2DYR C;  2XAS A;  4JI1 B;  1H8H G;  3ABM B;  3CXC U;  2GHY A;  2JGD A;  3B4S A;  4X9Q A;  4TV8 A;  3UKM A;  2UUA B;  2X6B A;  2PUS A;  1RM1 B;  4EFE A;  5CA0 B;  2VWK A;  1I5Y A;  1ENV A;  3JAK A;  4YY3 B;  2HHH O;  1Q8I A;  3I55 V;  2NN4 A;  1SQP H;  4FFB A;  5EC1 C;  3SPJ A;  4X1I B;  2XAJ A;  5A2Q N;  1VQO V;  3K58 A;  4X66 O;  4ICG A;  1MSW D;  2GV9 A;  4FMT A;  3OUF A;  4X20 A;  2DYR B;  1BE3 H;  2R72 A;  4JI2 B;  3E89 A;  2JEU A;  3OW2 U;  2PI5 A;  1K34 A;  1GN3 A;  3OR6 C;  4ZHQ A;  3PN1 A;  4LNU A;  2UXX A;  1UFI A;  1Q6U A;  1XMO B;  2ZCE A;  3NXS A;  1Q81 W;  3QVN A;  1KKD A;  2MK3 A;  1YIJ V;  3M7M X;  3WFV A;  4GT1 A;  1PNL A;  3ZRS A;  3BEH A;  3K03 A;  5D5P A;  4LF8 O;  1QHT A;  4K0K O;  3JAS A;  1HNZ B;  1N34 B;  1TA8 A;  2CH7 B;  2BOC C;  4MTX A;  2F4V B;  3U10 A;  4ZKI A;  3C3T A;  3E8G A;  3ETG A;  3WG7 B;  4U7N A;  5TIS Z;  3JAS B;  2Z5U A;  2IH1 C;  2JK5 C;  2HR3 A;  5LMU B;  4UCO A;  4R6Z A;  2ZXW B;  5B1B C;  4UUJ C;  1K4C C;  4PA9 A;  1Y67 A;  2YI9 A;  3W7X A;  1WNS A;  1JA8 A;  3K79 A;  4P9O A;  4JZG A;  3ZHS A;  1FXH A;  1HNW B;  3B40 A;  4JPR A;  1XL6 A;  2VQE B;  3RT3 C;  3WB2 A;  4DW1 A;  4DRX B;  3ZHV A;  3CMA V;  2BSK B;  4YJ2 A;  1AP6 A;  3BVO A;  2WAM A;  4UVA A;  5JWP A;  2QWR B;  4O4H B;  3ZS8 C;  3CCL V;  3DXR B;  3K06 A;  1VQ6 V;  3TJT A;  4UVB A;  2Q5Z A;  4NKG B;  3JCU Z;  1RFY A;  3ZRW B;  1NTM H;  2PZS A;  2L35 A;  1PM9 A;  1BCC H;  1DF5 A;  4X89 A;  4GX0 A;  4G28 B;  5IYC O;  2XND G;  1K9M W;  3FD9 A;  4I9W A;  4IL6 Z;  3O9O A;  2DQ0 A;  3H9V A;  2LGW A;  2EX3 A;  1E1Q G;  4ASU G;  4H37 A;  3OTO B;  2OIG A;  3LNM B;  2ILM A;  3FYE B;  1PV0 A;  5DEC A;  3H01 A;  5EYP B;  1SC5 B;  1N0J A;  2WLH A;  3DTU B;  4FM0 A;  2ZDI A;  2HHH B;  3FAV B;  3CC2 V;  2IU3 A;  4U3J B;  4PI0 A;  5DED A;  4CC6 A;  4CS3 A;  5J9P C;  4Z2W A;  1N36 B;  1YIT V;  3RFR A;  2WLI A;  3K3W A;  1P7G A;  4UCT A;  3AG7 A;  4BAY A;  2DE0 X;  1M1K W;  2UXB O;  3KZI Z;  1XI1 A;  3TXQ A;  1S72 V;  2P90 A;  3BY6 A;  3CB2 A;  2EJR A;  3ABL B;  1QNM A;  3H1H H;  3E22 A;  4MVQ A;  1M57 B;  5EBW C;  3ZN1 A;  1S5L Z;  3SGI A;  3RWR D;  4EB6 B;  3OMA B;  3N2K B;  1RPR A;  2V4D A;  4JYA O;  2XAH A;  1P84 F;  2QE7 G;  1R3I C;  2YS8 A;  1RP3 B;  3S3X A;  1M9N A;  4WFF A;  4XDJ A;  5LXT A;  4GKJ B;  1X59 A;  5LXT B;  1EBO A;  2AZ2 A;  1FYJ A;  3JAW B;  5FPO A;  1XNQ O;  3RN4 A;  5KX5 A;  1AJQ A;  1Q6H A;  3KKY A;  2MW2 B;  2FYU H;  4H33 A;  2VQF B;  2HLD G;  5LGN A;  3R65 A;  4NTX A;  4CH6 A;  1LNQ A;  4DR7 B;  3STZ C;  3CWB H;  4WFE A;  4J10 A;  3JAW A;  1GM8 A;  1IXM A;  1SKV A;  3CHX A;  1S5J A;  3ZX6 A;  5CA3 A;  4FFK A;  3OD4 A;  3ZED A;  3RYC B;  4PA7 A;  4LF6 O;  1GO3 F;  1MG1 A;  2BSK A;  4JYY A;  2ITD C;  1MZF A;  1YDX A;  1M56 B;  1T5E A;  3OTO O;  1VQK V;  1WN7 A;  2CTP A;  4PEL A;  4X1I A;  3LDC A;  4JTD B;  4DR5 O;  1R3J C;  3X2Q B;  4C7U A;  4K3A A;  5J2T B;  4DV1 O;  3AEI A;  1HR0 O;  5IJ0 B;  4B3T B;  5E1A C;  1OCO C;  3K59 A;  1PKX A;  4B3M B;  1KD1 W;  3RVY A;  2XHB A;  1Q43 A;  3K9S A;  5B5E Z;  1AVM A;  2PYL A;  3GWK C;  5JVD A;  1GMG A;  2QM4 A;  2IU0 A;  3VOU A;  1VQ7 V;  5IJ0 A;  4NVP A;  3AG3 C;  4DV0 B;  2LP7 A;  3LSS A;  4I7Z B;  4Q20 A;  1GH6 A;  3JD1 A;  1XBL A;  3BRC A;  5L3F A;  4DV6 B;  1AIL A;  1QR8 A;  2BTQ A;  3CCQ V;  2E3C A;  5EIB C;  2Y69 C;  5CB4 A;  3WG7 C;  1KB9 F;  2RNB A;  2A06 H;  1WB8 A;  4RWU A;  3IJ4 A;  4MT8 A;  1QR9 A;  4DV4 B;  2KG7 B;  2QKC A;  4X64 O;  1IBL B;  2YID A;  1QQC A;  2UUB O;  3JAT B;  2UUC O;  2EIJ C;  2GTA A;  1KC8 W;  1VMG A;  2PI4 A;  5LA6 A;  2EIL C;  3ZRW A;  2YIA A;  3B77 A;  1YJW V;  3T1Y O;  2A3Q A;  3JAL B;  1M57 C;  2FML A;  4FZ1 A;  2KB1 A;  3JSL A;  1HNX B;  2W0X A;  4ZI7 B;  3ZMZ A;  4O4L B;  3TGU H;  2CTR A;  5H6R A;  5FNV B;  4JYA B;  1FJG B;  4X88 A;  5B1A C;  5LYJ B;  1YVW A;  3SYQ A;  4EFB A;  1NTK H;  1K4D C;  1MAB G;  4E4E A;  2P4V A;  4GKJ O;  3HKC A;  2VS0 A;  3L73 H;  5IE9 A;  1JFF B;  1WB7 A;  1KYO F;  3B8M A;  4TV8 B;  2X7R B;  2QWP B;  1XMO O;  4X20 B;  4X8A A;  1XOU A;  4JTC B;  1N36 O;  5KLV H;  2OCC C;  4JI3 B;  3ZBH A;  3FB6 C;  4IT5 A;  3ASO B;  4JI6 O;  4UB8 Z;  3QF7 A;  2AXT Z;  4KUM A;  5LGU A;  1VQ5 V;  4LFC B;  1AI6 A;  1PL4 A;  2OTL V;  2XAF A;  4OX9 B;  4MVR A;  3WB1 A;  4JI7 O;  5FPR A;  4DYL A;  3CX5 F;  4B3M O;  4PDL A;  2Q73 A;  1H2L A;  3WB0 A;  2ODM A;  5JCO A;  2CH7 A;  2WLK A;  3ASN B;  3ASO C;  4X66 B;  1WLE A;  2Q0A A;  4QE7 A;  1XQ8 A;  1V54 C;  4F6E A;  2ZM6 O;  1Y74 A;  4F6R B;  4ZHQ B;  1M93 A;  5E79 Z;  1D2D A;  3ZCC A;  3VQX A;  2EIM C;  2WWW A;  5JJE B;  3T1Y B;  5IWA O;  1DLB A;  4UCV A;  1KBH A;  3TCU A;  1YJ9 V;  4U7O A;  5JQG A;  5JQG B;  1RM1 C;  5LHG A;  1JPX A;  2HVK C;  3T4Z A;  3HKD B;  1VF6 A;  2YI8 A;  4OPA A;  4LBE C;  3BPZ A;  3CRR A;  3H1I H;  2BOB C;  1I94 B;  4KHP B;  1SQB H;  2CUG A;  3OFN G;  1NH2 D;  5BXZ A;  1VP7 A;  3H1K H;  5KAF Z;  2UU9 O;  2ZR2 A;  1M4U A;  4O4L A;  5H6Q A;  3A2F A;  1FPO A;  4F4L A;  2Y69 B;  5KA5 A;  3FB5 C;  2EIN C;  4FVM A;  5J2U B;  3A0B Z;  2DWD C;  2ZE8 A;  2UUB B;  2YIB D;  4UB6 Z;  4X64 B;  1XUQ A;  1QLE B;  1KUQ A;  1YZB A;  3CCV V;  3KCY A;  4DRX A;  5BMV A;  2XOK G;  5EC2 C;  4DV2 B;  3N2G A;  3P3N A;  5H5N A;  4YIP A;  4WFG A;  5LHI A;  1OCR B;  1SQQ H;  3MHH C;  1VF6 C;  3CC7 V;  5AG2 A;  5CBH A;  2OT5 A;  4BW9 A;  4DV3 O;  4LF8 B;  4K0K B;  1BSM A;  4IHJ B;  4JYC A;  4LF4 O;  1BMF G;  4WBN B;  4LF5 O;  4DV0 O;  1F7Y A;  4JV5 B;  3UT5 A;  2Z0A A;  4FLZ A;  1YF2 A;  3QO7 A;  3W7U A;  4K8X A;  4BIZ A;  2ZNJ A;  1N33 O;  2BE3 A;  2YUA A;  1AI5 A;  1TUB A;  4R7C A;  4GCZ A;  2ZKO A;  4D7T A;  1WP8 A;  1GM9 A;  1NR1 A;  4RUF A;  1ZTE A;  5B1O A;  2UXD B;  5GTH Z;  4OPH A;  1VF7 A;  4PV1 B;  3B2E E;  1YTF B;  2Q67 A;  4O4J A;  2LJ2 A;  2K9P A;  3UO3 A;  1R6T A;  1H2G A;  4X65 O;  5KA6 A;  3VQV A;  1XNR O;  5B1A B;  1ZLZ A;  3P32 A;  4GKK O;  4CC5 A;  2ZE6 A;  5KMG B;  3CJH B;  2X0L A;  3ABM C;  2P5O A;  5L3E A;  4B3T O;  1G4Y B;  2ZXW C;  3DC6 A;  4LF9 B;  5EIB D;  4DV1 B;  4LC1 A;  3EVK A;  3APO A;  2PTM A;  2VQE O;  5IYZ B;  4DR3 O;  4DR6 B;  2RCV A;  5KAI Z;  1QVG U;  4UCU A;  2V1D A;  2L6L A;  1EN5 A;  5LMN O;  1XIL A;  3CEI A;  2JEX A;  3CSX A;  1HP8 A;  2FKX A;  3D36 C;  1JVM A;  5GON A;  2ADP A;  4LFB O;  1PPJ H;  3JAK B;  1TGO A;  2Q69 A;  1TAE A;  3UO2 A;  1B6Q A;  1QLN A;  5BMV B;  4MTO A;  2EJ7 A;  4JI8 B;  4DK1 A;  3LDE A;  4GKK B;  1SS3 A;  4NXN O;  1WAZ A;  1IBM B;  3D3Q A;  1UJW B;  3NR7 A;  1VQN V;  2Q6A A;  4KP4 A;  4TQD A;  3T1H O;  4CH5 A;  2QSA A;  3BFR A;  1ZX3 A;  3S3W A;  2CAZ C;  2UXD O;  1WA8 B;  3SJA C;  4J7K A;  2CTW A;  5H2F Z;  2EUL A;  5BY1 A;  2OIE A;  2FB5 A;  3OTF A;  1AB3 A;  2ZIO A;  4PA3 A;  1VQM V;  2EIM B;  4TQF A;  1XDC A;  1JQ0 A;  1HWY A;  1BZK A;  3K5M A;  5A9G A;  2YEV A;  1Q7Y W;  1MOF A;  4WCE V;  5HFL A;  3SYO A;  3CE2 A;  4K35 A;  1IVS A;  2D2C B;  2LFS A;  2O57 A;  3AG2 B;  3KCX A;  3W7S A;  5CN0 A;  2AHZ A;  3CRC A;  3QO8 A;  3CJH A;  1Q5O A;  2YXY A;  4WFB V;  3N27 A;  1TUB B;  3Q4H B;  3Q4H A;  4LFA B;  3VQY A;  4U3F H;  1H38 A;  1H2N A;  4GX2 A;  4U3J A;  5IYZ A;  1ZAU A;  1N32 O;  4Q6G A;  4FJC C;  1NR7 A;  1XMQ O;  3ZIA G;  3E86 A;  3JAR B;  4JI8 O;  1SA0 A;  5B3S C;  5IJ9 A;  3RGB A;  1VQ8 V;  2Y48 A;  1KKC A;  1R1B A;  4KFM A;  2P4K A;  3N2K A;  5J2U A;  3T2M A;  3HKD A;  3CRQ A;  4DW0 A;  4JI5 B;  3SYC A;  3E83 A;  3QTC A;  3D8C A;  4HAM A;  4YJ3 A;  3X2Q C;  4RUE A;  4I0X A;  3OGC C;  3CCU V;  3OUS A;  2ARH A;  2V7Q G;  5IY5 B;  2RN9 A;  1MNG A;  2X6C A;  4I50 B;  1G6U A;  1H2K A;  2LQT A;  1WA8 A;  1M56 C;  2ADQ B;  3N2G B;  2VWJ A;  4AHC A;  3ETE A;  1FFX A;  4DR6 O;  3CP1 A;  3RW0 A;  4AQY O;  1ARO P;  1K5S A;  5KHI A;  2KQX A;  2DJV A;  4IHJ A;  1NU1 H;  3IFX A;  1XHZ A;  5F2V O;  2XUM A;  5EBL C;  1ZL8 B;  4JI0 B;  1WJZ A;  1KMI Z;  3HB3 B;  4PI2 A;  4MTG A;  4DV7 O;  3CD6 V;  2WLN A;  3DC5 A;  3J7A U;  2QDO A;  3O65 A;  2KKW A;  2WLJ A;  5KHH A;  4BIO A;  2HEP A;  1B04 A;  2PF4 E;  4X1K B;  3AK3 A;  4B08 A;  5KUK A;  3CPW U;  1Y76 A;  4KXR A;  2B9Z A;  3K5O A;  1M90 W;  3OT7 A;  4O4H A;  2W0F C;  4IGG A;  4LH6 A;  4JAA A;  4I5S A;  1ZSP A;  1EM1 A;  2AW9 A;  4FFB B;  2LW7 A;  3TXS A;  5FLX N; 
#chains in the Genus database with same CATH homology
 1S5H C;  2NLJ C;  1FXK A;  4X88 A;  5B1A C;  3MD0 A;  5BZB A;  3ZMU A;  3MHS C;  3SYQ A;  3F7V C;  2WSS G;  4JAU A;  1GTO A;  2AHY A;  1K4D C;  1MAB G;  3OEE G;  3ZMS A;  4LCU C;  4DO2 A;  1W0K G;  4RQF A;  4JYB A;  5L3C A;  3K9A A;  4QPJ A;  4PDM A;  3LDD A;  2EZP A;  4RO2 A;  1JOY A;  2JJ1 G;  1E79 G;  3OEH G;  3E2E A;  3B8M A;  3QO5 A;  2X7R B;  4UVC A;  2D3O W;  3EHB B;  2ZQM A;  4JF3 A;  2OTJ V;  1CEZ A;  4TSF G;  4X8A A;  4JAS A;  3GB7 C;  1AR1 B;  3K08 A;  4JTC B;  2W6J G;  1VQ4 V;  3TK1 A;  1NQT A;  2OCC C;  2B1G A;  3ABT A;  2HVJ C;  2DYS C;  2NNU A;  3EFF K;  5FL7 G;  3FYI B;  3E8F A;  3FB6 C;  4G27 B;  2DYR C;  3ASO B;  3W7W A;  2DWE C;  2XAS A;  4KUM A;  1H8H G;  3ABM B;  3FB8 C;  3SYA A;  5LGU A;  3CXC U;  1VQP V;  1VQ5 V;  2GHY A;  1AI6 A;  1KP2 A;  3UKM A;  2OTL V;  2XAF A;  4CBC A;  1Y4M A;  2X6B A;  4QE9 A;  3JYC A;  4MVR A;  2EZO A;  1RM1 B;  2R9R B;  1I5Y A;  1ENV A;  1SET A;  4PDL A;  1FXV A;  4FIP C;  3I55 V;  4R8C A;  2IJK A;  1SES A;  5EC1 C;  3SPJ A;  1R6N A;  2XAJ A;  1VQO V;  1K92 A;  4RQE A;  2R9I A;  3K0D A;  2ZDI C;  3ABL C;  4UV9 A;  2WLK A;  4FMT A;  3OUF A;  1MSW D;  3ASN B;  1AJP A;  2DYR B;  3ASO C;  1WLE A;  3E89 A;  1TUE B;  4LP8 A;  1R6K A;  2JEU A;  4QE7 A;  1NJI W;  1V54 C;  3OW2 U;  2PI5 A;  1K34 A;  1GM7 A;  1XL4 A;  3OR6 C;  2IW5 A;  1CP9 A;  3ABU A;  4PA6 A;  3SPI A;  1E1R G;  2UXX A;  1VQ9 V;  3ZCC A;  1QVF U;  2EIM C;  2HG5 C;  3NXS A;  5B3S B;  2WWW A;  3SPG A;  1Q81 W;  4MVO A;  1FFT B;  5H9C A;  1KKD A;  1DLB A;  2MK3 A;  3TCU A;  1YIJ V;  1YJ9 V;  4U7O A;  3WFV A;  4GT1 A;  2YSU B;  1PNL A;  3CYO A;  3ZRS A;  1RM1 C;  3BEH A;  4PA4 A;  4WFA V;  4BIU A;  5LHG A;  2ATK C;  3K03 A;  1JPX A;  2HVK C;  4MVU A;  1EZJ A;  2BOC C;  2WPD G;  4N23 A;  3T4Z A;  4MTX A;  4LBE C;  1ZWI C;  2DQ3 A;  1YI2 V;  2FTK A;  2BOB C;  3CCE V;  3OFN G;  4CZZ A;  4ZKI A;  1NH2 D;  1K8A W;  3E8G A;  4MVM A;  3ETG A;  3WG7 B;  2EBO A;  2ZR2 A;  4U7N A;  4Z1M G;  5H6Q A;  4F4L A;  2Y69 B;  5KA5 A;  3FB5 C;  2Z5U A;  2EIN C;  2IH1 C;  2X6A A;  1R73 A;  1K3E A;  2DWD C;  2JK5 C;  2B5U A;  2HR3 A;  2CK3 G;  1YTF D;  1ORQ C;  4R6Z A;  2ZXW B;  4MVS A;  1V54 B;  4QJF B;  5B1B C;  1AI7 A;  1S0V A;  4UUJ C;  3E35 A;  3RBZ A;  1Q86 W;  1K4C C;  1QLE B;  4GX5 A;  4PA9 A;  3CCV V;  2XOK G;  5B1B B;  3W7X A;  5EC2 C;  3K79 A;  2H94 A;  4P9O A;  3TET A;  3OMN B;  4WFG A;  5LHI A;  1FXH A;  1OCR B;  3MHH C;  2WLI B;  1OCZ B;  4JPR A;  2QA4 V;  1JX9 A;  2K1E A;  3CC7 V;  1XL6 A;  5CBH A;  1OCZ C;  2OT5 A;  1FXK B;  4HZ3 A;  4JYC A;  2IJJ A;  1BMF G;  3CMA V;  5GW7 A;  5LGT A;  5LBQ A;  3OMI B;  4UVA A;  2WAM A;  1JCH A;  1FS0 G;  3LUT B;  3QO7 A;  4BIZ A;  3W7U A;  1AI5 A;  3T4D A;  4R7C A;  3CCL V;  5EK0 A;  1NKD A;  2ITC C;  2OCC B;  1NH2 B;  1K5Q A;  1WPX A;  3ZN0 A;  1SER A;  4GCZ A;  3K06 A;  1VQ6 V;  2XAG A;  5DM6 V;  1GM9 A;  1NR1 A;  4RUF A;  4UVB A;  5B1O A;  2W6I G;  3T1C A;  3ZRW B;  3JD3 A;  1OCO B;  3STL C;  5IYB O;  1DF5 A;  2ZD9 A;  4X89 A;  3I56 V;  1YTF B;  2Q67 A;  4GX0 A;  4GX1 A;  4G28 B;  5IYC O;  2XND G;  3DGE A;  1BL8 A;  2GSM B;  1K9M W;  4I9W A;  3ZRV A;  1H2G A;  2QKS A;  4HYO A;  5KA6 A;  2DQ0 A;  5B1A B;  3JD4 A;  3P32 A;  1E1Q G;  4ASU G;  3OAA G;  4H37 A;  1GKF A;  3AG3 B;  3LNM B;  5IY5 C;  3FYE B;  2X0L A;  3ABM C;  5L3E A;  5L3G A;  3ASN C;  1AJN A;  3H01 A;  1G4Y B;  2ZXW C;  2WLH A;  3DTU B;  2ZDI A;  2B1I A;  3CC2 V;  1K97 A;  4LC1 A;  2IU3 A;  3CME V;  3SPC A;  4E2L A;  3ABK B;  4JTA B;  1S77 D;  2LFR A;  2WLM A;  1OZ0 A;  4DXW A;  4MSW C;  1QVG U;  2V1D A;  5J9P C;  4UXN A;  2Z3Y A;  3SJQ C;  2UXN A;  1EFR G;  1OCR C;  4PDR A;  1ROP A;  1YIT V;  2JEX A;  2WLI A;  3W7T A;  3HPL C;  3K3W A;  5IDJ A;  3D3I A;  4EKW A;  1JJ2 U;  4BAY A;  4XBF A;  1JVM A;  1P7B A;  2ZR3 A;  1R3L C;  3B8N A;  3OM3 B;  1M1K W;  1S76 D;  1V55 B;  4YXW G;  4QNH B;  2HJF C;  2A0L A;  1S72 V;  3UM7 A;  1I5X A;  3M99 B;  2P90 A;  3BY6 A;  2EJR A;  3ABL B;  3D36 A;  2QEX V;  2Q69 A;  3CCJ V;  1B6Q A;  1QLN A;  1THZ A;  4MVQ A;  1M57 B;  4QPK A;  5EBW C;  4JAV A;  3ZN1 A;  5L3B A;  2EIK C;  4FPP A;  3AG2 C;  3F5W C;  3K04 A;  4MTO A;  3LDE A;  4G2K A;  3IC7 A;  3OMA B;  4FK5 C;  2A9H A;  1W0J G;  1V55 C;  4J9Y B;  1RPR A;  3ABK C;  5DN6 G;  3SYP A;  1DF4 A;  3A0R A;  1PL0 A;  1UJW B;  3JD2 A;  1F51 A;  1GK9 A;  2XAH A;  3CCM V;  4MVZ A;  1KP3 A;  2C2A A;  2QE7 G;  3ETD A;  1R3I C;  3FKS G;  5LHH A;  1YJN V;  1M9N A;  1VQN V;  2Q6A A;  3KG2 A;  4KP4 A;  4WFF A;  4WFH A;  4XDJ A;  3ZMT A;  2EIK B;  5C93 A;  4PDV A;  1EBO A;  4MS2 A;  4XDL A;  1SZT A;  2JDI G;  2HFE C;  1AJQ A;  3ZRX A;  1PD3 A;  1W2B U;  4H33 A;  4MTF A;  4BW5 A;  4PA3 A;  2HLD G;  5L3D A;  1VQM V;  2EIM B;  5LGN A;  1J95 A;  3R65 A;  1Q82 W;  1LNQ A;  1SRY A;  2JIZ G;  3STZ C;  4WFE A;  1JQ0 A;  1K7D A;  1PNK A;  1HWY A;  1GM8 A;  1IXM A;  2DYS B;  2YEV A;  5CA3 A;  1Q7Y W;  1MOF A;  4WCE V;  5HFL A;  4P30 A;  4TWK A;  3K0G A;  3SYO A;  4OXS A;  4PA7 A;  2LFS A;  1GO3 F;  1OHH G;  2EIN B;  4R50 A;  1VQL V;  3AG2 B;  3W7S A;  1FXK C;  5CN0 A;  2AHZ A;  1MG1 A;  3QO8 A;  5CBG A;  2HKO A;  2ITD C;  4WFB V;  1M56 B;  1VQK V;  5EBM C;  3CCR V;  3E8H A;  1K73 W;  4XDK A;  1PNM A;  1R3K C;  2XAQ A;  4PEL A;  1H38 A;  4GX2 A;  2QM8 A;  3LDC A;  4JTD B;  1S3J A;  5B1N A;  1R3J C;  1L1F A;  1H8E G;  3X2Q B;  4P2Z A;  4FJC C;  4QIW F;  2Q68 A;  3G6E V;  1QCE A;  3AEI A;  1NR7 A;  4TT3 G;  1KQS U;  3ZIA G;  1YHQ V;  5HFM A;  3PJS K;  3E86 A;  5E1A C;  1OCO C;  3ZMV A;  1PKX A;  5B3S C;  1KD1 W;  1VQ8 V;  2Y48 A;  2EIL B;  3RVY A;  3ZJZ A;  4JGS A;  5CMU A;  2F43 G;  3IGA C;  4KFM A;  3ML0 A;  1N8R W;  3T2M A;  1AI4 A;  1OCC B;  1K33 A;  3SYC A;  3E83 A;  4HAM A;  3X2Q C;  4RUE A;  3OGC C;  1GMG A;  1NBM G;  1COW G;  3QNE A;  1Y66 A;  4ZBM A;  2IU0 A;  3CCU V;  4MW3 A;  3OUS A;  1KEC A;  3VOU A;  1VQ7 V;  3F7Y C;  1NVP B;  4WF9 V;  2V7Q G;  3VBB A;  3AG3 C;  4J9Z B;  5IY5 B;  2X6C A;  2LP7 A;  1F23 A;  3LSS A;  1G8M A;  4Q20 A;  4N21 A;  3P30 A;  1F4N A;  3JD1 A;  1M56 C;  4P9P A;  2P67 A;  3GWO A;  3JD0 A;  2IJH A;  2QTO A;  5L3F A;  3AG1 B;  1OCC C;  1QR8 A;  3CCQ V;  1RPO A;  3ETE A;  1BHA A;  2JJ2 G;  2YEV B;  5KUM A;  2Y69 C;  3CP1 A;  3RW0 A;  3WG7 C;  3CC4 V;  1NVP D;  3G71 V;  1ARO P;  1K5S A;  1P4R A;  1BHB A;  3AG4 C;  3JCZ A;  3IFX A;  1QBZ A;  4MT8 A;  5EBL C;  5CBF A;  1CPY A;  1QR9 A;  1QLE C;  2QM7 A;  3HB3 B;  4MTG A;  1YSC A;  2WLN A;  3CD6 V;  2DW4 A;  2EIJ B;  2H8P C;  4MW8 A;  2EIJ C;  4UV8 A;  1KC8 W;  2P7T C;  2PI4 A;  2WLL B;  2WLJ A;  3G4S V;  2WLL A;  2EIL C;  3ZRW A;  5IYD O;  3CCS V;  3OE7 G;  2IH3 C;  3AG4 B;  2IJI A;  3B77 A;  3OR7 C;  3LSQ A;  4L87 A;  1YJW V;  3E8B A;  3CPW U;  1M57 C;  5KUK A;  2P6J A;  1M90 W;  2A79 B;  2W0F C;  2M7W A;  2KB1 A;  3RVZ A;  4RAI A;  3SPH A;  4I5S A;  1DTO A;  3AG1 C;  3ZMZ A;  1F4M A;  3FB7 C;  5H6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...