3G6LA

The crystal structure of a chitinase crchi1 from the nematophagous fungus clonostachys rosea
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
388
structure length
388
Chain Sequence
TGSINAVYFTNWGIYGRNFQPADLQASKILHVLYSFMNLRVDGTVYSGDTYADLEKHYSDDSWNDIGTNAYGCVKQLYKLKKANRSLKIMLSIGGWTWSTNFPAAASTEATRATFAKTAVEFMKDWGFDGIDVDWEYPASETDANNMVLLLQRVRQELDSYSATYANGYHFQLSIAAPAGPSHYNVLKLAQLGSVLDNINLMAYDYAGSWDSVSGHQTNLYPSTSNPSSTPFSTKAAVDAYIAAGVPASKIILGMPIYGRAFVGTDGPGKPYSTIGEGSWESGIWDYKVLPKAGATVITDSAAGATYSYDSSSRTMISYDTPDMVRTKVSYAKGLGLGGSMFWEASADKTGSDSLIGTALSSMGSHDSTQNCLSYPNSKFDNIKNSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase
publication title Crystal structure and mutagenesis analysis of chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with the inhibitor caffeine
pubmed doi rcsb
source organism Bionectria ochroleuca
molecule tags Hydrolase
total genus 141
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3g6lA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3g6lA01
1GVYA 4MDOA 1GPFA 1E0VA 4ATWA 3SUVA 1JZ7A 1H2JA 3VMOA 1MFVA 4MB3A 5I78A 3K4DA 4OZOA 3RM9A 1ZJAA 5ECUA 1OIFA 4LXFA 4CGTA 4GZJA 2D1ZA 1OINA 1KCKA 3WN6A 5JBDA 2VUYA 2CBJA 4EKJA 1KR1A 4PUEA 3G6LA 4P8UA 5I6SA 3GM8A 4JCMA 3PZOA 2ZX9A 5FL1A 1X1NA 2WMFA 5KEZA 1UD2A 1UKPA 2OWXA 3AHYA 3N9KA 3AS2A 4UQAA 4NRSA 4PMXA 2WM0A 2DSKA 1UOKA 3KEHA 1JZ4A 4U5IA 1E40A 2EO7A 3L2LA 4GIAA 2ZICA 3CZEA 3T09A 3ZOAA 5BXRA 2CKRA 2XWEA 2Y8VA 1JIBA 4JAWA 3MUAA 1G01A 3OLGA 2CKSA 2X1IA 2UWFA 1HXJA 2WC4A 4AC1X 2CXGA 3CHFA 1TA3A 2O9RA 1EQPA 3F5JA 4M29A 2D0GA 4ACYA 1G0CA 1H11A 1LG1A 5JBFA 3MU7A 1ITXA 1B0IA 4GI9A 2EPNA 3K4AA 3WEOA 2C8NA 1LL4A 5CGTA 4DM1A 3WFLA 1TMQA 1W9VA 2VX7A 2CESA 4OOUA 4OJYA 1GOKA 3AIWA 1E6SM 4JKMA 3O9NA 1HP5A 2ZUNA 1C91A 1FHLA 3L4VA 3NSNA 3SCQA 3VIJA 1VB9A 2Z1KA 2QHAA 5AC5A 4EAMA 5IXEA 2D0FA 3GZAA 1VF8A 5C8BB 1ZBCA 5BXSA 3WD4A 2PI6A 3BLPX 2VT0A 4YPJA 4P7NA 1HL9A 4W84A 5CSYA 3AXIA 4PBGA 4AYSA 1QI3A 3EDDA 2WSPA 3CHCA 1QI2A 4CD8A 1H4PA 4E4PA 4AIOA 3VIHA 2J7FA 3ZMRA 3PTQA 1Q6GA 3CZ8A 2CCRA 2G3JA 2GK1B 5M3WA 1PX3A 1VRXA 1QPKA 5FOOA 2GUYA 3IAQA 1E4NA 3AXXA 2W4XA 4Z2IA 2J7CA 3VD9A 5BRQA 3WUGA 4UFKA 4TVDA 3VPLA 3VM5A 1JZ3A 1E43A 2W92A 4F79A 1KR0A 1TR1A 2OLHA 3W24A 3VKKA 4GQQA 2DSUA 2EQDA 1E1FA 2FHBA 2ZXAA 2YDQA 3CUFA 2D22A 1FOBA 4JFWA 1ECEA 4N0RA 2GDVA 4PMZA 4XV0A 1ZJBA 5HPOA 3AOFA 4D1IA 1V6VA 2FDMA 1FH9A 2OYKA 4RE2A 3ZJ7A 2WVUA 3SCRA 4LYQA 4MNMA 2WHJA 4JKKA 4HA3A 1GJWA 3POHA 5EMYA 2PC8A 4DWSA 1WNOA 2WKLA 4DM2A 1HKJA 2WC3A 3BSHA 2BY0A 2WXDM 2X8RA 2J8GA 3VX0A 1VEMA 4HMEA 1WZLA 5F7UA 1ISYA 2X09A 3U5YA 1ISZA 1AQHA 3RPMA 2OYMA 2OYLA 1Q6DA 2BVTA 3CZKA 2DH3A 1V3KA 1OSEA 2PWGA 3A6OA 4KRTA 3APGA 3CIVA 1UQZA 4UR9A 3CZGA 1BYCA 4OBSA 4PCTA 4PTVA 2W63A 1V3MA 4NZCA 5I77A 3RJXA 3N15A 1C92A 3FY1A 5E09A 4DUXA 1QNSA 3L2MA 3DYOA 3VNZA 4P8WA 1BGGA 3OGRA 2DPEA 4LGXA 1XC6A 1VBUA 1ODZA 4AZ6A 3ZJKA 4F66A 4XZBA 4UQCA 1UHVA 3WNPA 1GJUA 1NOWA 3KL5A 1BSIA 2DT3A 1EXPA 2J7HA 5C71A 2XJ7A 4PSRA 4E8CA 1LL6A 3TONA 1SR0A 1LJYA 4AIUA 2BNJA 3BCFA 1TCMA 1W1TA 3WQ8A 2ZOXA 4P7LA 5D4YA 1EH9A 1OT1A 3QHMA 3VGBA 3VIMA 1A47A 3BXWA 3GXIA 3S6TA 2X0YA 2VL4A 3HJEA 3KWXA 3NSMA 4H8HA 1VJZA 4CD5A 1UWUA 2PWDA 5EFFA 4WKHA 1C8XA 1UD6A 1Q4NX 1UR2A 2JFEX 2YL9A 4ZXOA 4ACZB 3ZQ9A 4HOWA 1WDQA 1LLOA 3ALFA 3EMCA 5CG0A 4QP0A 1J0HA 2DT1A 3N18A 5ABGA 3WUEA 4MNKA 1MQPA 1H09A 3PZIA 1WDPA 4HTYA 3JUGA 5A6MA 1U30A 4PMVA 1E6QM 2ZXBA 4Q7NA 2D23A 5C70A 4CN4A 1W3JA 3BLKA 1XH0A 1MQRA 1TE1A 2UY4A 2WAGA 2Y2WA 4B3KA 3KZSA 2J8FA 2W5FA 3AZRA 4UOJA 2YDRA 1CIUA 3AS3A 1HKIA 3W27A 1CENA 3SUWA 1UR1A 5IHSA 3VX1A 1LG2A 4UQDA 3M07A 1MXGA 2ZX7A 3GXFA 4AD5A 2EPLX 4P7OA 2DSZA 3LMYA 3WFZA 3WD1A 4HZ6A 1QBBA 1KCLA 4OKDA 2OSYA 1R86A 3UG3A 2XSAA 4BA0A 2D3LA 2BVDA 2CBVA 1W9XA 1QNRA 3AHTA 2Q8XA 3AIVA 1MXDA 4CVWA 1EO7A 2DIJA 3WF0A 5CQ1A 5D9OA 1VAHA 4CCEA 5I24A 1MFUA 3WNOA 2VX6A 3EMQA 4IISA 4F8XA 4UQ9A 1CZ1A 1J01A 3PZ9A 2J7BA 3WF4A 2FH6A 4ML4A 1GW1A 4NI3A 4J27A 3WDHA 3OZOA 4CU7A 1JG9A 4MJ2A 3FAWA 1JAEA 1JGIA 2VRJA 4TUFA 2E40A 4HOXA 3LPOA 3VM7A 4GQRA 3ZR6A 2QLYA 3WL0A 5JH8A 2OSWA 3WH6A 1HP4A 4TXEA 2DH2A 2XM1A 3VTRA 4PMYA 3AIQA 3ZM8A 1CXKA 2CERA 1JNEA 1NWUA 5LA0A 1JZ5A 2BS9A 2F8QA 4W93A 1E0XA 1G1YA 3T0BA 5A6KA 1FHDA 3EBVA 4XB3A 1UZ1A 4AZBA 2WLYA 4JZ5A 5CGMA 1VENA 1QHOA 1B3XA 1GUVA 5BRPA 3PZMA 4D6DA 2ZX5A 4JL2A 3BMVA 1UKTA 1KGXA 3ARWA 3L4XA 3WBAA 2A3CA 5D9MA 1J0IA 1WDRA 1VEPA 2GK1A 2GJRA 4R27A 1E1EA 1R85A 1Y7VA 5I79A 3AXHA 2NSXA 3W26A 2BXZA 3ZSSA 1S46A 4J3VA 3VMPA 4BQ4A 4AW7A 5A94A 5D9PA 1UH3A 5AY7A 3ZJ6A 3AS0A 5D8WA 3TTOA 5A2BA 2XVNA 2MANA 1SMDA 1UD5A 4HMDA 2WCSA 2WK2A 3UESA 2TAAA 1Q6CA 2YKKA 3VD3A 1R7OA 1VBRA 1BLIA 3OLEA 2J79A 8A3HA 5LA1A 4AZHA 3BAYA 1L0PA 2ZUUA 2WMIB 3DHUA 5A6AA 4YN5A 4OBRA 3MSGA 1UR8A 4WJXA 2ZWYA 3PZTA 4J3SA 2DT0A 1NWTA 4W7VA 3I3BA 2WCGA 1UWRA 3M46A 1X6LA 2G3MA 3L4WA 1E71M 2YA0A 1UWQA 1XCXA 4RE4A 1EOKA 3EDFA 2EPKX 3SURA 2ZUSA 4FMVA 3BAXA 5BXPA 3WF2A 1R8LA 3U5UA 5A2CA 3FHAA 1TVNA 1C7TA 3I3EA 2JALA 4AZ7A 1BG9A 4OOZA 5JUVA 3WQWA 1HJUA 1ZBWA 1UYQA 3UETA 4L4OA 4H04A 4PMDA 2YLLA 1WPCA 3RJYA 2JEQA 1CDGA 4J28A 4W7UA 3RMEA 4TVUA 1JI2A 1E55A 4D6CA 5BROA 3GH7A 3CGTA 3EMZA 4XUYA 2O92A 2CBUA 2J7GA 3VD4A 2XGIA 7CGTA 4UFJA 2X05A 4EANA 5IHRA 1U2YA 3WBEA 2CITA 1WB0A 1V0KA 2CETA 1GOIA 1H41A 1CBGA 2FHCA 4D6EA 2CNCA 1E6XM 1W1YA 2E8YA 3K1DA 3T2OA 5BYWA 3CUGA 1C93A 4ZENA 4GZIA 5A2AA 7TAAA 4W88A 4UZSA 1C7SA 1EDTA 1J0ZA 2VZOA 3WDPP 1QI4A 4JCLA 4W8AA 3A3HA 3UG5A 1J18A 3L4YA 1ZBKA 3OGSA 1OD0A 3EDEA 2HISA 1D2KA 1UWIA 4LPCA 1F4HA 1GQKA 5FL0A 1K9FA 5A6JA 4S3KA 3VD7A 1QBAA 2VX5A 1E9LA 1UD8A 1E0WA 3CMJA 2WVSA 1WZMA 3UERA 5LYRA 1C8QA 1HX0A 1XV8A 2JF7A 4ACZA 3ARZA 3OGVA 1UQYA 1M04A 2ZX8A 3THCA 1BVZA 4W87A 4AISA 1NP2A 4BF7A 2W62A 4QDMA 3I3DA 3NSXA 3QHOA 1F4AA 1YHTA 3AMGA 5D9NA 1NM9A 3VD5A 1TVPA 3U7VA 1FH7A 2IUZA 4EK7A 4J3UA 4Y7EA 4J7RA 5E0CA 1ZU8A 1DWHM 3SEPA 3CUIA 1K9TA 1JL8A 1US2A 1CLXA 2BY2A 1SMAA 4MADA 1JZ8A 1PZ2A 4AD4A 2VNCA 2VCCA 1GNXA 4ZXLA 3SCOA 4MNLA 4URIA 3M6DA 1B90A 1NOUA 2WB5A 2Y24A 4M82A 3GXDA 1GHSA 3VNYA 3MMUA 3RM4A 1XYFA 4UOQA 2O9OA 4V27A 1D3CA 2D2OA 4D71A 2NT1A 1Q6FA 2W67A 3UR7A 1J0KA 3MUY1 3RCNA 5CPSA 2JEPA 1JDAA 3WMSA 1M53A 2YL6A 1GQLA 1C3FA 1E5JA 1Z32X 2VVSA 3K8LA 5GNZA 3SCUA 4KRUA 1V3HA 1FH8A 3WH9A 1N82A 4TOQA 1O7AA 2ZXDA 3FW6A 1RPKA 2VZVA 4MJ4A 2WWCA 4MTVA 3QOMA 3MV01 3GYCA 5I5RA 1QI5A 2UY2A 4BCEA 5I2UA 3UEQA 1DWFM 4U33A 2ESCA 3VO0A 2PF0A 3B8SA 4KMQA 3WQ5A 5IDIA 2F2HA 3AS1A 3W53A 2BVYA 2W66A 1CGTA 1ITCA 1SYTA 4CD7A 2BXYA 3UCQA 2CBIA 3QGVA 4A3YA 1EDGA 4HOZA 3ARYA 1KWGA 1DWJM 1UKQA 4AD2A 5E6YA 1V6UA 1VFOA 3THDA 5EFDA 3WNKA 3PZNA 1XCWA 3ARXA 2VVNA 4X0VA 3CMGA 2GVYA 3AISA 4HPHA 4W85A 1E72M 3DECA 3QR3A 5HDRA 3VGFA 3T08A 1JAKA 1QW9A 1GZJA 1JNDA 2OWCA 1CTNA 1LWHA 3BAJA 2J77A 3F4VA 1CXLA 1FP8A 1HJSA 2XVPA 5A8PA 2G41A 5A1AA 1OGSA 1FFQA 3N04A 2ZUTA 4QCEA 2DDXA 3WDRA 2V5CA 3UG4A 3GNPA 1JYWA 5M03A 3WMBA 3GBDA 2UY5A 4AD1A 3ARPA 3BAWA 2JF6A 3VIGA 2XVLA 2ZUMA 1QNPA 4YHEA 1V0MA 3J7HA 1V6XA 2DIEA 4GO8A 1PX8A 2ZIDA 5HNNA 2EJ1A 4X0NA 4BQ5A 3LPGA 4PMOA 1EHAA 4D1JA 1E3XA 2WMIA 2YL5A 3AHVA 1QNOA 3AZTA 1GVIA 2PWHA 4KGLA 3ZIZA 1XD1A 4CUCA 2W61A 3CZJA 3L4TA 3IK2A 4TTGA 2VJXA 4JFUA 2QPUA 3AMLA 1FA2A 2WANA 4AY1A 4U31A 1RD6A 3DHPA 3NDZA 1BHGA 2WVTA 2YL8A 4H8UA 4W8LA 1U33A 3ZR5A 4LYPA 2DT2A 4MPKA 4HU8A 5A6BD 3W0KA 1UUQA 1NQ6A 1ODUA 4CD6A 3AHZA 1BYAA 3VIKA 1CGUA 3NJ3A 3KE0A 1W2VA 2XUCA 1DWAM 3LPPA 3PTKA 4QCFA 1NWSA 3WDJA 1CXHA 2XTKA 1CXEA 4HU0A 1WZKA 2O9PA 4Z2LA 1JFHA 4PEEA 4UFLA 4GZEA 3CPUA 1EIBA 2D0HA 3A4AA 3RIKA 4P7RA 1HKKA 1UKSA 3IJ9A 1WP6A 4TTUA 4AZCA 2IXUA 4DUVA 2CYGA 3DYMA 2WW5A 3AIEA 1B1YA 3B9AA 4UZUA 1J0YA 1HL8A 2YA1A 4ZFMA 3FXYA 1V3LA 4U2YA 1MVYA 4DWSC 1HKMA 3CUHA 1E70M 4H41A 4JL1A 4E8DA 1XHGA 1EDQA 2CIPA 4TX6A 1GCYA 1WO2A 4WSJA 2VCAA 3FNDA 4LQ1A 4BZYA 3K46A 2WHMA 1YQ2A 3TP4A 5BCAA 3U7BA 4UNIA 3CO4A 3IAPA 1J12A 3AYSA 3T0DA 3WKZA 3ARQA 5ABEA 2FH8A 1OD8A 5ABFB 2BV9A 3VGGA 2BY1A 3GBEA 3II1A 1ZB5A 4U2ZA 3EYPA 4Z2KA 3GXMA 4BS0A 3WF3A 1ISXA 1G5AA 2QV4A 3U57A 5AC4A 1HNYA 5A8MA 5TD4A 4EE9A 3TA9A 1H3GA 2Y5EA 3M7SA 4J3TA 4PRWA 6TAAA 3ZO9A 4AIEA 5E70A 5CJ5A 2YLAA 4W89A 1V08A 3WF1A 2ZUVA 1UD4A 3WH8A 1OIMA 1JYXA 3AYRA 2VRQA 1BPLB 4KWUA 3E1F1 1XGZA 1HT6A 4AMCA 1JYNA 1JDCA 5A8OA 1XH1A 2ZE0A 1CGXA 3MANA 2J78A 3OLIA 4CD4A 5I0DA 1UWSA 2EPOA 2XWDA 5CLTA 2ZWZA 3RILA 1UA3A 2WBKA 2J47A 4QLKA 5M5DA 1B3ZA 4Q22A 2YIHA 2ZX6A 4PN2A 2WCAA 2DSVA 5JIWA 2V3FA 3RM8A 3OLDA 2D24A 1ESWA 2E9LA 3PN8A 1GONA 1HF6A 2VQTA 5BXTA 4MB4A 4H8VA 2QMKA 3NYDA 3SCVA 4X9YA 3AI0A 1GOQA 1W32A 3QOKA 3PBGA 4ATDA 4CKQA 4C7GA 3IJ7A 4NSBA 1EA9C 1OBAA 2XVGA 1UA7A 3A4WA 1DTUA 1TZ7A 4R5EA 3SUUA 1KXVA 8CGTA 1MW0A 1UWTA 1E6RA 5A95A 3B9DA 3POCA 3BC9A 2F61A 1NARA 1US3A 4ZE4A 2NT0A 5HBFA 1B2YA 1UKOA 4PMUA 2IXVA 1R87A 1QHZA 2WPGA 2BY3A 1XH2A 2UY3A 1K9EA 3F5LA 1CECA 4J3XA 4M8UA 1V3JA 3WNLA 4D6HA 1PJ9A 1GHRA 1KQYA 1TUXA 1E5NA 4B16A 3UR8A 3VDAA 3VIPA 4AXNA 3AZSA 1AVAA 2XHYA 3QHNA 1K9DA 2VI0A 4PMRA 2PBOA 2EXOA 6CGTA 5A8NA 4UCFA 1HJVA 1M7XA 1MYRA 4A3HA 3AQUA 4J3WA 3SIMA 2A3HA 1NP0A 1OB0A 1CPUA 1CXIA 1BFNA 1WE5A 5IFTA 2EPMX 5AYBA 2JIEA 3MMDA 3CH9A 2GFTA 4AWEA 1BQCA 3OB8A 1K6AA 2A3BA 4JFTA 3ZSTA 2YOCA 1E4LA 1VJSA 4CN6A 1NWRA 1H0IA 3SCNA 3W29A 5FIPA 4NRRA 4HP5A 4F9JA 1W9UA 4CVUA 2E9BA 2X2YA 5KZ6A 1BYDA 1WDSA 5DMYA 1HVXA 3WQ6A 5DFAA 1WKYA 4JKLA 2GDUA 3AROA 2XGBA 1H0GA 2WKGA 4MB5A 4UFIA 3CTTA 5E0FA 1IZKA 5CZKA 3RO8A 4AZCB 1MW3A 1BVNP 1MW1A 3ARVA 3WELA 4LX4A 4FLRA 3W38A 1PEZA 3AFBA 2G3IA 1BAGA 5E6ZA 4XX6A 1I1XA 5GNYA 1KGWA 4JFSA 1C8YA 5A6SA 4W5ZA 3HN3A 1GQIA 1KXTA 1O6IA 3W6LA 2XG9A 3CLWA 5A6BA 1J9YA 1G94A 2E8ZA 1HN1A 4S3JA 2G4FA 4QFUA 4KH2A 1E73M 3WDQA 1DHKA 2B31A 4U5KA 3WDIA 4U3CA 1JF5A 1JF6A 1HIZA 2VZTA 4D6JA 3AICA 1EO5A 3OA5A 3BGAA 3WH7A 1L8NA 3MSDA 1G9HA 4HA1A 3GDBA 3VDBA 1UG6A 1RH9A 4D6GA 2XVKA 2EBNA 4D72A 1JDDA 2GJXB 4PYSA 3O2LA 1XD0A 2J75A 3BSGA 1LQ0A 4IPNB 1TFVA 3ZT5A 1JD7A 4W8BA 2Y8KA 2XIIA 5A3HA 1BG4A 1M03A 3TOPA 1C90A 1IZJA 5HOSA 3PZUA 4JHZA 4FF5A 4M56A 2A3EA 4PTMA 3AMKA 1ISWA 3L4ZA 2WNWA 2WVVB 1X6NA 2E3ZA 4P7QA 3HU7A 3FN9A 1W9DM 1J10A 2G8ZA 3AMCA 3T0AA 4UTFA 2WZEA 3B9EA 3BMWA 5ABFA 5GNXA 3A47A 1OT2A 1B3VA 2VX4A 2WHLA 1E6ZA 2PWEA 4BQ3A 1OCQA 2VOTA 1GOOA 5HPCA 4RE3A 3BCDA 3NIYA 2DEPA 2GJPA 1QOXA 1JZ6A 3EDKA 4QLJA 2YJQA 5CPTA 4B9YA 1KXHA 1W3LA 4WSKA 9CGTA 1H49A 1W9BM 1VIWA 4H7VA 4FK9A 3TTYA 5CLWA 1PX4A 4QLLA 4AEEA 4WF7A 4M24A 2CHOA 5AYIA 3GTNA 5A8QA 2V38A 2NW0A 4N42A 3VVGA 3GNRA 2Z1SA 1AQMA 4P8VA 2VURA 1EHNA 4GKLA 1VFUA 1ISVA 4JHOA 4AD0A 1W9PA 1E3ZA 2V5DA 2OSXA 2JE8A 4GI6A 2C7FA 4PUDA 3D5HA 5HXMA 4UFMA 3PZGA 4L4PA 1PIGA 1GQJA 1XSJA 2VCBA 1NOFA 5FD0A 3VMNA 3L4UA 2AAAA 1UR0A 1UR9A 4PMNA 1B3WA 1CGVA 1JYVA 2J7DA 3CHEA 5FKYA 5DEZA 1UZ4A 4YHGA 3WEZA 4MAZA 1MQQA 4Z2HA 3BAIA 1LF1A 3VILA 1AQ0A 2PBGA 4F9DA 1QVBA 1I1WA 1DWIM 3TTQA 2CEQA 1HJWA 2BHYA 2VR4A 4MAVA 2WMHA 2HVMA 4HA4A 1OWQA 4OUEA 1JXJA 2WZHA 1E4MM 4B15A 4TVCA 5DF0A 3AHXA 2XYLA 1KBBA 2ZUWA 4OIFA 3VUPA 1I75A 1H5VA 5A6LA 1EQCA 1JI1A 2XFYA 4A4AA 3WY1A 1VFFA 3VIOA 1GOMA 1UH4A 3WL1A 3AJ7A 4D6FA 2X0HA 4AZGA 5GQBA 1M01A 1QW8A 3MUIA 2VZSA 2WMKA 4QAWA 4UQEA 3CHDA 4JIEA 2VC9A 2GSJA 2J4GA 3MS8A 3WNNA 1CGYA 2WC7A 1W3KA 3NCOA 2V3DA 2J25A 5I23A 4FLQA 4ATLA 4H2CA 2XSBA 1R7AA 4MDPA 1KXQA 4GPNA 1B31A 4LYRA 3WH5A 3A4XA 1EGZA 3IJ8A 1LWJA 1XRVA 1B9ZA 3MKKA 4C7FA 2CHNA 3MO4A 3RDKA 2DGAA 1VFMA 2YA2A 1W1VA 4WKAA 2VQUA 1V02A 1WZAA 3CUJA 2Y4SA 3W28A 3AIRA 2YDSA 3VIFA 3NUKA 1E6NA 3WUFA 5I3DA 1DWGM 3GH4A 4IPLA 1FP9A 1KFWA 2PB1A 4AZ5A 2JIWA 1IT0A 1B30A 1J11A 4ZE5A 2EEXA 1QI0A 2A3AA 5CXPA 3OBAA 4CU6A 1XYZA 2XPKA 3OIHA 3AMDA 5DT7A 1V0LA 1TA3B 3WMCA 2YBTA 3N17A 1OM0A 1AMYA 1XSKA 3WSUA 5BWFA 1CNVA 1CLVA 3GNOA 1SFSA 3ARTA 3CZLA 1W2PA 4PTWA 2J74A 2WSKA 3SUTA 3KL3A 1E6PA 4UQBA 3MV11 3ARSA 1KBKA 1Q6EA 2W91A 2WMJA 1BYBA 2ZXQA 4U3AA 4AZIA 4W86A 3S2CA 4HPGA 1J0JA 3O6AA 3F5KA 4NF7A 3IANA 2J7EA 2D3NA 2V3GA 4AD3A 4V2XA 3W25A 5EB8A 3BH4A 3BAKA 1UD3A 2G3NA 3CBWA 1PPIA 2E4TA 1E15A 3TTSA 2WWDA 2VO5A 4Z2JA 4B3LA 1E4IA 5IFPA 4PSPA 3SUSA 2O9TA 2WBGA 4IUGA 3SCWA 2XIBA 1PAMA 3G6MA 1B3YA 3T2PA 3FHQA 5D8ZA 4CCCA 4M81A 3VGHA 3VOCA 1HVQA 1V6YA 1TG7A 2V3EA 1E56A 3ZJ8A 2GJXA 2J62A 5JBEA 1UR4A 3VINA 1XSIA 4RL3A 3AIUA 5CPQA 1JXKA 4WK9A 2BHZA 2VTFA 3PTMA 5FCZA 4DUWA 1WAWA 1BTCA 1PBGA 2FGLA 3W81A 2E9MA 2QPSA 5JIPA 1CEOA 1NH6A 2QF8A 2D20A 3ECQA 4BQ2A 4W5UA 4HZ8A 4WIWA 4UFHA 5LA2A 3KL0A 3GH5A 2XM2A 3OG2A 4GI8A 6A3HA 4M80A 2WVVA 4UOZA 1CWYA 2VR5A 3N1AA 1PZ3A 4KGJA 4AEFA 3WQVA 3WD3A 1VEOA 2CPUA 2C0HA 4V28A 3WENA 7A3HA 1GOWA 4WKFA 1D7FA 4B9ZA 1W91A 1OGGA 2BHUA 1CXFA 3VDHA 1P6WA 4W7WA 3NDYA 3MUZ1 4C7DA 1RP8A 5EBAA 3SCSA 4Z2GA 1PIFA 3SCTA 3DYPA 1CGWA 1A3HA 5CSUA 4IM4A 2OWWA 1HJXA 4DWSB 1DEDA 4FLSA 1KB3A 3PZVA 1QHPA 4TX8A 4HMCA 3WD0A 1V02E 1RP9A 4HZ7A 2YBUA 4MNJA 1DP0A 1UH2A 3W6MA 4E2OA 5ABHA 3ZT7A 3D3AA 2FGZA 4CCDA 3AIBA 3T2QA 5M17A 1V03A 2WMGA 4GINA 3ZT6A 4DWSD 2XFRA 2WLZA 3W37A 1JZ2A 3EDJA 1GORA 3HMCA 4CN1A 4XZWA 1IV8A 3MMWA 2RGMA 3DC0A 2VZUA 4JFVA 5DO8A 1BF2A 1EOMA 1WCGA 5E9AA 1FFRA 3FAXA 1JD9A 4M1RA 4PCSA 1W1PA 2WZIA 3WUBA 1ZS2A 3ARRA 3WEMA 4P8XA 1BGAA 4WLCA 3SCPA 5A69A 1KGUA 2E0PA 2WHKA 4CU8A 2VRKA 3PZQA 1KWKA 1MWOA 1HJQA 3W82A 4D6IA 4PMQA 3ALGA 2VMFA 3WD2A 3LPFA 2DQXA 2QMJA 4MB1A 3WNMA 2BFGA 3VDCA 1KQZA 1ZL1A 3VIIA 1W3HA 2RGLA 1V0NA 3VGEA 4GXPA 3W4RA 3VGDA 4FLOA 4GO9A 3OZPA 2AMGA 2XFFA 3K8MA 1V6WA 3VU2A 2WYSA 5DT5A 3K8KA 1JFXA 2AOSA 1ZBVA 1CYGA 5GPRA 3N11A 1OGBA 3N12A 4K68A 1QNQA 1MW2A 3PHAA 3N13A 1LL7A 2FHFA 3WQ4A 2PWFA 3WIJA 2DSWA 1H1NA 4PTXA 3ARUA 4ZEPA 1V3IA
chains in the Genus database with same CATH superfamily
4ZTYA 3I7RA 4LU0A 4ATWA 5M2FX 3G0UA 4LUYA 2PUZA 3CK5A 1A0DA 4DBDA 3S6DA 4REQA 4KIRA 5C0QA 3S1GA 4LXFA 4UBPC 3FJLA 4LH8A 2NQ5A 1UP3A 2D1ZA 3VI2A 4MFEA 3EY6A 1PKMA 4P8UA 5I6SA 2V2CA 1TMLA 4C5ZA 1IEVA 1OF8A 2ZX9A 1R3YA 5FL1A 2Z25A 2WMFA 4IQLA 1UD2A 4GY7A 1RXOB 3AHYA 4UQAA 1IWPA 2WM0A 4AB4A 3KEHA 1K7XA 3GC2A 1JZ4A 2X30A 4IQJA 1XRFA 3ITVA 1UIOA 3L2LA 3DAQA 4O12A 2F6UA 5HR6A 4C1LA 3CZEA 5K9XA 3ZOAA 3MCNA 3WQDA 5I02A 5KZMA 4WOZA 2KFWA 2XWEA 2Y8VA 1JIBA 4DJDA 1UCWA 4DYKA 4N9BA 3MUAA 1GW9A 2R6OA 4AVFA 1V5XA 2CKSA 3OLGA 2WC4A 5AHEA 1PUDA 1TA3A 5LIYX 2H8XA 3LBMA 4U4MA 1EXBA 3F5JA 4ACYA 5LHFA 1G0CA 1W1IE 1XLMA 2DFAA 4AEOA 1LG1A 5JBFA 3EWXA 3MU7A 3UYIA 2PP0A 4Q8NA 1XUZA 3KWSA 4O16A 3K4AA 3WEOA 2HMCA 3GWQA 3TN3A 1DQWA 4RK8A 5CGTA 5D30A 4K8HA 4DM1A 4ZTXA 1W9VA 4NASA 4AFYA 3QKZA 4HHPA 3PA7A 1VC4A 3HG5A 3T05A 2ZUNA 4HK6A 3VCNA 2NVAA 4IMFA 3O8AA 5FJTA 3HQNA 3PUEA 2QHAA 4LEFA 5AC5A 1TJPA 3SJ3A 2NZLA 3A9IA 5KITA 3LTPA 4NQ1A 4OECA 4YPJA 2XH0A 4UWMA 3AXIA 4E8GA 4DHGA 1LUCB 2PDLA 2WSPA 3N6HA 4I9MA 4E4PA 4AIOA 2DIKA 2OG9A 1XQLA 5CZSA 4CEUC 2ZRWA 3USBA 2Y7FA 1EQ3A 5M3WA 3CAQA 2E5CA 4NL1A 4NYYA 4CNSA 1E4NA 1C9DA 3AXXA 2JZVA 2W4XA 3BW2A 4EACA 4PCPA 5BRQA 4TVDA 2ATMA 3QFWA 1UPMB 4DXXA 1E43A 2W92A 4F79A 1X6UA 4RDWA 2DSUA 5CZJA 1KTBA 2AQWA 3CUFA 4GUFA 1LBLA 4JFWA 1LT7A 3AC0A 4GXWA 3O15A 1V6VA 1WOAA 2VGGA 2WHJA 3POHA 4P5UA 5A5WA 4DWSA 4DJDC 3WJZA 2O7SA 2WC3A 2BY0A 2WXDM 2CWNA 4J5NA 4UTWA 3PP7A 3ABOA 1XIGA 1TKKA 1QK0A 3DDMA 2A6LA 1Q6DA 3S6OA 3O0KA 4O1BA 3L9CA 5AHIA 4XK2A 3O5QA 3TJIA 1R5YA 2DH3A 4Q8TA 4PUNA 3APGA 3CIVA 1BYCA 2R9RA 4OBSA 5FEXA 4PTVA 3GR7A 5FF7A 1OADA 1OCBA 1XCFA 3TXZA 5I77A 2R82A 3FY1A 1PINA 2ZA1A 4QNWA 1QNSA 3L2MA 1WX0A 3VNZA 4B2DA 3P5YA 3OGRA 4N9EA 2P8BA 4LGXA 2ACRA 3I4EA 2XISA 2B81A 4XZBA 2OODA 1RALA 4LV9A 4KCUA 3TNBA 1RBLA 4KESA 1BSIA 2DT3A 4I5UA 4QM1A 2J7HA 2XJ7A 3KAFA 3KDOA 1AH4A 1LJYA 1QNVA 4AIUA 2ZZ1A 3R89A 2FZMA 1RPXA 4XAYA 4YCOA 3EPOA 3KBVA 1XIBA 1OT1A 3VIMA 4FOUA 3GXIA 4JQ3A 3LUOA 1YX1A 4AC7C 1ME9A 1YYAA 4ODOA 1O60A 4Q4RA 4HBEA 1DHPA 4CD5A 2W3ZA 1UD6A 1K8XA 2JFEX 2YL9A 5FJRA 3T0TA 2OO0A 3ZQ9A 3EMCA 4MHBA 1J0HA 3UNTA 2VENA 3EEGA 1ZUAX 4IXXA 3M0MA 1TIMA 2OGJA 5C2GA 1U30A 1FXQA 3S46A 4PMVA 4Q7NA 4KWOA 4CN4A 1RCXB 1XH0A 1FKIA 4X60A 3QQ1A 4B3KA 1SW3A 3E96A 3OVQA 1Q1CA 1CIUA 3V0UA 4YU1A 1X1ZA 4ZB0A 1HKIA 4IJCA 1XUUA 3V4BA 1PWLA 4UTWC 1QPFA 1TPVA 3CV6A 1ZAJA 4GIYA 1AFSA 2ZX7A 1KRMA 1TJ0A 1BF6A 1F8AB 2R14A 3I6EA 1DORA 1FKKA 3QC0A 2Z7KA 3LMYA 4GRSA 3WD1A 4HZ6A 4YWIA 1KCLA 1XFBA 2V0TA 3RPTA 3CV2A 3NZQA 4JIPA 2OSYA 2FB3A 3UG3A 2X1UA 5C9XA 2A6NA 3PUDA 2ACSA 2D3LA 1RY8A 2E09A 4LAUA 3C2RA 1W9XA 5FJOA 1JPDX 3GW0A 2QDDA 4JN8A 3UA4A 3VE7A 3RLUA 4IT6A 4FNPA 1KCXA 5CEWA 3UWUA 4GJJA 4F8XA 3TYCA 4XVEA 3WF4A 3UD6A 3PPCA 1EYMA 4GD0A 1GG0A 1YW1A 3BQ5A 4J27A 3WDHA 2QV5A 1XIEA 2H9AA 3K4WA 1JG9A 2YB1A 4P61A 4MJ2A 3FAWA 1J5TA 4AF0A 3UWQA 3L0KA 3XIMA 4ICCX 3LPOA 4GQRA 4TV5A 1EGVA 3AWNA 4ADUA 2OSWA 4WDTA 1HP4A 4TXEA 3NQ2A 1XJBA 2XM1A 4S2BA 1GZ1A 3AIQA 3P5ZA 4M0XA 2P50A 1FKHA 1JNEA 2OQHA 4FNQA 4PB5A 5DMMA 3TCEA 1X8CA 2QR6A 1G1YA 2H3BA 3QMSA 3NOYA 4XB3A 4AZBA 1QHOA 5BRPA 4ITZA 1GWJA 3SFWA 4BEQA 4D6DA 4O14A 3BMVA 4I8DA 3PSWA 1CW2A 1YBQA 3PRDA 4MKVA 2NQ9A 3DUGA 1P0EA 1H7NA 2P88A 2PFHA 3C86A 4WJEA 1NY1A 1Y7VA 3W26A 1S46A 3WJWA 3RUBL 1GVEA 1KT0A 1WXZA 2YZ5A 4LRSA 1RVKA 3EGJA 4O53A 3KOFA 4JTHA 3W01A 2PU0A 4GGHA 4O8RA 4JTAA 4I6KA 3H22A 1TV8A 3QW4B 3CH0A 2TAAA 2YKKA 1TZ9A 1Y0OA 1X1OA 2WMIB 4G7EB 3VAVA 3NDOA 4NILA 3QSTA 4OBRA 5I3JA 3HQOA 4F0RA 4IUOA 2DT0A 3WLIA 1KV5A 3IGXA 4L4LA 2Q01A 2WCGA 1UWRA 4KWSA 1GVFA 4LS1A 3N2MA 4U85A 1OX5A 2G3MA 4LEQA 1P0BA 2C18A 1EJTC 3EDFA 3M47A 5BXPA 4NAEB 4H7ZA 5A2CA 1TVNA 1HW6A 1JNSA 3ITGA 3EOUA 1BG9A 3TH6A 3EB2A 1ZBWA 1CB7B 4LUJA 3UETA 2PEVA 4H04A 2YLLA 3RJYA 2PU1A 1JI2A 4UTTA 4JTEA 2XN0A 3CGTA 3WCZA 3TR9A 2PV2A 5FF3A 3EOSA 3LUTA 4EANA 1Y5XA 3LMZA 5IHRA 1A49A 3WBEA 3O16A 2NX3A 2QVNA 3DG7A 3O5JA 2VFHA 2CETA 1CBGA 2FHCA 3P60A 1TQJA 1W1YA 3DIPA 3CUGA 1AZ1A 3TYDA 3OZMA 5EMUA 4X2PA 1C7SA 1J0ZA 4G5DA 2IQTA 4JCLA 1MNSA 3OOBA 3E02A 2ISVA 4L64A 1MDLA 1ZBKA 3OGSA 3F4WA 4P2VA 2HISA 4QQUA 4LPCA 3SQLA 3MYPA 1F4HA 3CUXA 1IXOA 3MQTA 1RJQA 3NTYA 5A6JA 4S3KA 4EX4A 1E9LA 1UD8A 3CMJA 4QGCA 1YTDA 3VYLA 5C5YA 4PH6A 1F9CA 1C8QA 3ARZA 3WZ0E 2Y70A 4S23A 4GH3A 1UQYA 2UZ5A 4Q4PA 4W87A 2W62A 3I3DA 2P3EA 1F4AA 2XZ7A 4NAFA 4IHCA 3AMGA 3UZYA 1RLDA 2KAUC 2KR7A 3I65A 4RX0A 3LERA 3TE9A 5IOBA 5E0CA 3THUA 3CUIA 1JL8A 3GU0A 2PF8A 1JCLA 1OHLA 2X16A 1KM5A 3VOJA 3EA2A 3LCIA 3EX6A 1EUNA 1OK4A 4WGHA 3JU2A 4NVTA 4HNTA 4HPJA 4M82A 3BZGA 5I07A 1ZK6A 2E68A 1NDYA 4DIPA 4LC6A 2WZTA 4NZ1A 4V27A 2CXEA 2D2OA 1M68A 1Q6FA 3STEA 3EKGA 3W7CA 2YCEA 1JEZA 1J0KA 3MUY1 2PDFA 2CLIA 2JEPA 3TMQA 3PNZA 2C13A 1M53A 2YL6A 1GQLA 3K8LA 4C6DA 4QT3A 1V3HA 1FWSA 4K1WA 1RPKA 3G18A 4LV4A 2WWCA 2ODOA 3EX2A 3SRKA 4G2PA 1RUSA 4H01A 5I5RA 4DT4A 4ZOEA 5I2UA 4YTRA 1OX4B 1TWSA 1WDWA 2OFJA 3VO0A 1ECQA 4KMQA 3WQ5A 4UTLA 1FDZA 1Y65A 1DJZA 5G4EA 4U86A 2W66A 1ITCA 4FX7A 2AL2B 5DXYA 2BXYA 4XSLA 1EDGA 3LG3A 2AQOA 3ARYA 4O13A 1KM3A 4O50A 3L23A 3QV6A 1V6UA 3WNKA 1XCWA 4X0VA 2A79A 3OVPA 3TCSA 5HDRA 3B8WA 1CTNA 9XIMA 3M5ZA 1GEQA 1ZAHA 4F0MA 1CXLA 3MYOA 2XVPA 5A8PA 1EKOA 2IQ0A 4K3ZA 4QX4A 4ORMA 4ZBCA 3ITCA 2ZUTA 4HVXA 3GUWA 3WDRA 3CEPA 3I4KA 3GNPA 3K30A 5M03A 4LCSA 3GBDA 1W3NA 2UY5A 2JF6A 3VIGA 2ZUMA 4YHEA 4S38A 5AN7A 3CUZA 4MMWA 2DIEA 1EC9A 4MY9A 4GO8A 2ZIDA 5HNNA 3V5CA 4DRNA 2EJ1A 1R2TA 4BQ5A 2QS8A 3GPKA 1RK6A 1AW5A 1TSIA 3UVIA 1NMVA 1FHVA 2MLXA 1E3XA 4EXAA 3ZVHA 4PEKA 1QNOA 1GVIA 2OEMA 5D02A 1K7EA 2PZNA 4CUCA 4L5ZA 4F48A 3L4TA 4RV8A 3RN6A 4H9VA 4TTGA 1VFLA 3RO6A 1FWBC 4BY3A 2RJGA 4AY1A 4U31A 1RD6A 4ZCWA 3DHPA 1BHGA 4LYPA 3LQLA 4HU8A 3NQFA 3W0KA 5BXJA 3LCLA 5J8LA 4JY8A 1ODUA 3STPA 1G4SA 4CD6A 2B7QA 3HV8A 5CZ0A 1CGUA 4E2DA 1RD5A 3O6YX 1R9YA 1FJDA 4JIHA 2I9UA 3WDJA 4L9YA 1WA3A 5HNTA 2VD9A 3NQBA 4Z2LA 1Z9AA 1JFHA 4PEEA 3W7GA 1XKYA 4GJ1A 1S2CA 3LSBA 1CX9A 1R46A 4P7RA 3HGOA 3RIKA 3IJ9A 3OIXA 3IIOA 4AZCA 2FZNA 4DUVA 4GIEA 2DG3A 4UZUA 3B9AA 1NAL1 3CWNA 2YA1A 4DJDD 3JR2A 1X7IA 2FYMA 5HTGA 4ZB2A 2LLEA 1E51A 2JKEA 3CUHA 3PC0A 4E8DA 3PBYA 3USZA 1XHGA 3OTRA 2CIPA 2HXUA 2V5LA 4WSJA 4LQ1A 3K46A 5AFDA 2WHMA 5FJUA 3TN4A 3TP4A 1FKXA 5IBXA 4UNIA 2RDWA 4LNYA 3FA5A 5D2VA 3AYSA 2AKMA 3T0DA 3WKZA 5ABEA 1TPC1 3KLKA 3II1A 1ZB5A 4HPNA 2GYIA 1GT8A 3GXMA 1SGJA 4B5XA 1W3IA 5HW7A 3N4AA 4PC8A 3RRXA 5AC4A 4C02B 4EE9A 3E12A 3G1FA 3VUSA 3R79A 3LGEA 4J3TA 4ZSTA 4PRWA 1Q6QA 4Y6GA 1L6FA 2QJGA 4AIEA 5CJ5A 1NIUA 5EGRA 3W7JA 1OIMA 9XIAA 5FJPA 1BPLB 4XD4A 1AJ0A 4KWUA 1XGZA 2DP3A 1HT6A 1JQXA 3UYCA 2IPJA 1ONWA 3TZNA 3OLIA 3NQCA 4JTDA 5I0DA 1UWSA 1WKEA 2WBKA 3W87A 3MWCA 5HQEA 4O15A 3T44A 4WGXA 1BVWA 4PN2A 3LHVA 4X63A 4OU1A 2V3FA 2VFFA 1ESWA 2E9LA 1FWCC 2VXNA 1HF6A 2VQTA 2XH7A 4J4NA 4IPPA 4Q32A 1W32A 3PBGA 3O0FA 4C7GA 2DVXA 3FYYA 1TCOC 1EA9C 4RPPA 4A22A 4YVXA 1FAPA 3PWGA 4R5EA 1M5WA 1XDLA 3R0KA 3RCMA 2WZMA 1EF3A 3PY2A 2KX9A 4ZO9A 2F61A 2Z1XA 1DJHA 3ATZA 5HBFA 2OEJA 2QAPA 4AWTA 1P5BA 3DFNA 4H9YA 4C6LA 2TRSA 1XH2A 1SSDA 2FVKA 4Z1BA 4J3XA 4M8UA 4FNTA 1V3JA 5BRBA 3BURA 1W6TA 1GVRA 5T9CE 2IF4A 3EPMA 1KQYA 1TUXA 1G4TA 4B16A 3UR8A 2DZSA 4JXCA 4ZQOA 4Y90A 4UNKA 5IBXC 3SSZA 1KFJA 1S2AA 4B5TA 3QR0A 4WCJA 2FMNA 2OLAA 3D46A 3QHNA 3CGMA 1K9DA 4HA0A 4IOTA 1RLCL 2EG6A 3A12A 1UP2A 2ZRUA 3O5PA 1HJVA 4AU0A 1RVGA 4A3HA 4HQVA 3RITA 2NSOA 1NP0A 1OB0A 4B2DD 2I5QA 1BFNA 1D7IA 4FB7A 4LCRA 3GHTA 3PR2A 2JIEA 3MMDA 1JJKA 2GFTA 1BQCA 1FWJC 2YOCA 4MF4A 4TNSA 4X2RA 1QO2A 3MCMA 4FR1A 2R24A 3CPRA 3B40A 1TPWA 1XBZA 1WDSA 5DMYA 1K8YA 4IIFA 4XBJA 3S2JA 1H0GA 3GDMA 1DKWA 1IEWA 3REQA 5E0FA 3NL6A 1Y5VA 1MW3A 3LTSA 3WELA 4LX4A 3GFXA 3W38A 1BAGA 3WLKX 5E6ZA 4XX6A 1TV3A 3TCZA 3SDOA 5FEZA 1J6YA 4F0HA 3N3MA 1XBVA 2HK1A 1C8YA 4W5ZA 4X22A 1KXTA 4GBUA 1UOZA 1O6IA 2QCNA 3C3NA 3CMFA 5A6BA 1J9YA 3VKBA 4RW5A 1NELA 3NL2A 4KH2A 2B31A 4U5KA 4E2BA 2QJJA 3WK3A 1JF5A 3T1GA 1JF6A 1ONEA 3I7QA 5E5CA 3BG3A 4R34A 1EO5A 1QASA 3BGAA 5D04C 1SJCA 2XINA 2QJHA 4HA1A 3GDBA 4DRHA 1ZJIA 4NIRA 2CC0A 1SSGA 3URQA 3W1NA 4PZVA 4A3QA 5K9DA 1PKNA 4ZQRA 3D3FA 4H3DA 1LOQA 3C0QA 1JCMP 2QCDB 3UGRA 3A9BA 4OHQA 1ROTA 4KCTA 3O2LA 1HUVA 3BSGA 2DJLA 4Q8UA 4MUZA 1LQ0A 4IPNB 1AQFA 2X2GA 2R91A 2BP1A 1U5VA 3R7MA 3TOPA 1IZJA 2ATSA 3S1WA 3PZUA 4CEXC 4JHZA 2OCZA 4FF5A 1R3TA 4PTMA 1ISWA 3NQGA 3EKZA 3LBCA 4F0SA 5LSMA 3FSUA 1X6NA 3OVGA 4LUTA 2GPTA 2CZFA 1ELSA 1W9DM 2G8ZA 2NUXA 5BOEA 1L6WA 4KCVA 1XQKA 4UTFA 3W88A 3LRLA 3A47A 2WHLA 1E6ZA 1FQ0A 3IACA 3O1NA 4BQ3A 5ECVA 1CT5A 1OCQA 3G24A 3NIYA 4PB4A 3UXIA 2DEPA 1X96A 4DBUA 3NVTA 5HJYA 4QLJA 3QY7A 1A3WA 3RU6A 2ZZ4A 4WSKA 3GD6A 4H7VA 3BK0A 2BGQA 3EWDA 5MHBA 5AYIA 2J9ZA 3M0XA 1XYBA 2PD9A 4LJ3A 3GVRA 3GNRA 5DY3A 3S9ZA 3MHFA 4TU1A 4N6EA 1FKRA 1EHNA 4GKLA 4AD0A 2V30A 1SZRA 4QR6A 2OSXA 3VFLA 3R11A 4GI6A 5K3VA 4AHOA 3FGCB 1PYMA 2E5BA 4L72B 3PZGA 2MLYA 2YXGA 5CJMA 1PIGA 1FTXA 5XINA 3WLMA 1XSJA 3KVKA 4EPEC 3LCFA 2MNRA 4BWLA 4DRQA 2ZC8A 2WJFA 1HZYA 4Q4MA 7REQA 4AVNA 3BANA 1JYVA 2J7DA 1VD6A 5DEZA 2RUDA 3RHGA 1MQQA 4Z2HA 3SY5A 1LF1A 4F9DA 1QVBA 3BOFA 4DRMA 4Y9AA 4ICMA 1FVPA 2BHYA 4MAVA 5XIAA 4OUEA 2DV0A 1JXJA 2WZHA 6XIMA 3JZEA 3B0XA 1SFTA 3M0IA 3WO8A 2CU0A 5DF0A 2F2KA 3AHXA 5G2IA 2ZUWA 1H5VA 3HO8A 3QW3A 2GGEA 1I2OA 1UBPC 1OYBA 1FCQA 1TO3A 4HZMA 1GOMA 3AJ7A 2UZ9A 4D6FA 2XGZA 4HJFA 3RAOA 1QWGA 1X7FA 3RLHA 5G5IA 3CHDA 4REQB 1DYSA 2Y7DA 4JIEA 2J4GA 3MS8A 3HPXA 3HJZA 2WC7A 2W6RA 2V3DA 1I2PA 4RNJA 2J25A 4FLQA 4ATLA 1IT8A 3AAMA 4H19A 2XSBA 4FX8A 1Q6LA 4GPNA 2E6AA 3S2MA 3C61A 4IIDA 2ISDA 4MLJA 2D2GA 1GYMA 1CB2A 1J96A 3WJXA 1FUYA 1WZAA 3M44A 1R2SA 2YDSA 3VIFA 1GPWA 4FXSA 3QYQA 1KFWA 1JCXA 1B30A 1J11A 1TPEA 2EEXA 4A6GA 2G96A 1VLIA 3TN6A 5CC5A 3DFOA 1XYZA 1O5QA 3AMDA 1V0LA 1TA3B 3WMCA 2YBTA 3N17A 1OM0A 1I6NA 2PDNA 1AMYA 1XSKA 1CNVA 3GNOA 5ENLA 3ARTA 2OTDA 3TC3A 1T96A 4BI7A 5HMDA 2J74A 2WSKA 1AUSL 3MV11 3ARSA 1Q6EA 1EX5A 1SO3A 3H2OA 3D0CA 3U9IA 4GX8A 3DFYA 4YVVA 2R94A 3FS2A 3S2CA 2ZA3A 3IS4A 4FIQA 2Q8ZA 4QITA 4NF7A 3GR4A 2XIQA 4IIEA 1P0KA 3C52A 4JR5A 2V3GA 4V2XA 3TDBA 3O5IA 5EB8A 1XISA 3M41A 1AH0A 2G3NA 4JTTA 4EAYA 1ROUA 1GK8A 2Q5AA 5HMSA 1ALDA 1O5RA 3TTSA 1B9BA 3P2VA 4B3LA 1E4IA 5IFPA 3SUSA 4JTRA 2O9TA 3CHVA 2VEFA 4F2UA 4S3BA 3H23A 4L1XA 2QW5A 3UQAA 1PAMA 1VZWA 1F5ZA 3T2PA 3HFTA 3UNDA 1HVQA 1V6YA 4OTKA 2V3EA 1LZOA 3ITTA 2AGKA 2J62A 1DV7A 1UR4A 3VINA 1QFEA 1QMLA 3GY1A 2FGLA 3W81A 1EJUC 1NH6A 1U5JA 4KKXA 8XIMA 1EJXC 4GACA 2F84A 3WBWA 1FXPA 3L66A 4A8IA 3VXGA 2WVVA 4UOZA 3GNNA 4DO7A 1XGEA 4IFOA 3TYZA 3EKLA 1R9XA 4KGJA 4GVGA 1RSCA 1QK2A 4RNHA 4FOKA 1OGGA 4A29A 3TZFA 3MUZ1 4NUWA 2OJPA 1B54A 1XBXA 5EBAA 1PIFA 1CGWA 4Y96A 4PBEA 4M6UA 5CSUA 2OWWA 1HJXA 4DWSB 1FWIC 1KB3A 4FAPA 3R10A 1TPDA 3DENA 6REQA 3FKRA 3WD0A 3MI6A 4GK8A 1TTJA 1UH2A 1LDCA 4F2BA 3KCLA 4DLMA 2FGZA 3T2QA 4AX6A 4GGBA 3ZT6A 5C2XA 2XFRA 1J8VA 1FDYA 3VKDA 3W37A 1N1AA 1GORA 3MSRA 1IV8A 3MMWA 3DC0A 1D3HA 4MJZA 1EWEA 3QTGA 3T7VA 3CIXA 3FAXA 1Q6HA 1JD9A 4JQ4A 4Q8PA 3E0LA 4WLCA 3WG6A 5LXXA 2A21A 4DX3A 5F4SA 5A69A 3M4HA 4ODRA 2VRKA 4MFDA 2W27A 5E93A 1HJQA 3W82A 1Q8JA 4RLIA 2NUYA 4JTGA 3UZWA 3WD2A 3LPFA 2DQXA 3PPFA 1TVLA 2REQA 3VDCA 1ZL1A 2RGLA 1H7PA 1V0NA 2P0OA 3T4WA 4K38A 1A5LC 3U2OA 4TX9A 5AVHA 1NFBA 4OGZA 4ODQA 3K8MA 4J2PA 2R1PA 1GTHA 2R1MA 7ODCA 3QEZA 3K8KA 1ZBVA 3H53A 3HTWA 4U28A 1QWKA 3W72A 1BRLA 3N12A 3BV4A 4K68A 1I0BA 1LL7A 2ZQ0A 3BCJA 3NFUA 2DSWA 1H1NA 4UMAA 3W7KA 4ZEPA 3L5LA 3HQ1A 1GVYA 4MDOA 4YVPA 4GC3A 1E0VA 3GZ3A 3SM0A 4GY0A 3FX4A 3GC5A 4BR1A 1ZFJA 4NJIA 3GXNA 3KP1A 5I78A 4IFRA 2Z00A 4Y9MA 5ECUA 5TBOA 3PTDA 3NM1A 3KS5A 4XIMA 1KCKA 3WN6A 4UUIA 5JBDA 3R58A 2OU4A 1ZLPA 1KR1A 2M08A 4JCMA 1SQ7A 4JTJA 2F38A 4JYSA 1JCYA 2YFOA 3AS2A 1YTEA 3H4WA 5HWMA 3BOXA 4U5IA 4C1NA 4H6RA 3AXKA 4QS6A 5DQPA 4GIAA 1R9HA 3QM3A 2HRWA 5I3KA 5K9CA 1H5YA 2ZDRA 3H54A 2NVDA 2C16A 4PB3A 4H1ZA 4R7OA 4JAWA 2NX1A 3RRAA 1E9ZB 4ERIA 3IUDA 2UWFA 3CHFA 4UIOA 1EQPA 2P4VA 5MKGB 4GMEA 1B0IA 4GI9A 2QKFA 2V5BA 1J2BA 1LWIA 1F3XA 4QDPA 1ADSA 2PZ0A 4AF0B 3CQKA 4FO4A 3WFLA 1XPGA 2G50A 3QLLA 4OOUA 1GOKA 1E6SM 4M3PA 3WX7A 2HDJA 3VNIA 4X9SA 3M0LA 2AWGA 3GZAA 1P0DA 1OQFA 3QPEA 1VF8A 2ZRVA 3P74A 1KFKA 1KW1A 3BLPX 4OT7A 4RPQA 2VT0A 5KTLA 4GVIA 5CSYA 3ZYZA 4PRTA 1XIHA 3VE9A 1ZCNA 4JN6A 3UJEA 4CD8A 4PL1A 3M1ZA 1YBQB 3GVWA 5LGZA 2G3JA 5C7HA 1PX3A 3I6CA 1VRXA 2LKNA 2HQAA 2E7FA 1QPKA 1O66A 1YPIA 2WKJA 2GUYA 3IAQA 4HBKA 3KRUA 2Y62A 1S3TC 4Z2IA 3CM4A 2ZR4A 3CQIA 3V5OA 2AKZA 3WUGA 4UFKA 2A7RA 3VM5A 3R43A 1JZ3A 2D69A 2PDJA 2BOFX 4UB9A 1TR1A 2OLHA 3VKKA 1Q7MA 4DXVA 1DJNA 5D2YA 2ABBA 2FHBA 2HZGA 1U22A 2ZXAA 3VKAA 2ACUA 1AG1O 1M65A 3DFTA 3IWPA 2XPAA 4IQ2A 3WLNA 4N0RA 4DAFA 4XV0A 3AOFA 3IVUA 2FDMA 1W26A 3URAA 3SCRA 1NSJA 4M6QA 3YPIA 4LYQA 1QJWA 1GJWA 5M1TA 1OFEA 2PC8A 3DHDA 4ONVA 4DM2A 3S5NA 3BSHA 3GTFA 3UVAA 4HJWA 2J8GA 1IXPA 3SGGA 3UJRA 3PB2A 1VEMA 3B03A 2VKZG 3QMTA 4K7VA 2X09A 3TSDA 3TAKA 1ISZA 2GWGA 2BVTA 2QF7A 2BWGA 1EL3A 2BOGX 3ID7A 1HO1A 4IT1A 1OSEA 1O68A 4KRTA 1EGMA 4PR4A 4UR9A 5HAOA 1JUKA 4IICA 4PCTA 5F4XA 4OFCA 3TK7A 3G8RA 3JS3A 1PTGA 1OG0A 2MPHA 1VPYA 3LHTA 3S5YA 3TTEA 3GAYA 2Z0IA 3DHFA 4JNYA 1UJQA 1PCKA 2IKHA 2XN1A 3DYOA 2HV5A 4P8WA 4O0QA 1G7VA 1XC6A 1VBUA 4JQ1A 1PIIA 1ODZA 4AZ6A 3FOKA 3ZJKA 4JS3A 4NJJA 4UQCA 1MZHA 2ZBTA 3CB3A 1K8ZA 2YCKX 3KL5A 3W7OA 1YTKA 5C71A 4PCFA 4E8CA 3W1MA 1NDVA 1R6WA 3H4XA 4C6BA 5HT1A 2BNJA 3BCFA 3PPHA 1IWBA 1TCMA 4C65A 2ZOXA 3KAIA 2QCMA 1KBIA 3L5MA 1A47A 4Z42C 3BXWA 3S6TA 1WBHA 2X0YA 3QSRA 3HJEA 3S42A 3W02A 3W71A 3P82A 3KWXA 2Y7GA 3JXVA 4U10A 1NJJA 4DRSA 1KNWA 3CQHA 3EWYA 1EZ2A 2PWDA 3EOEA 4DY1A 2DQWA 3C8FA 1WDQA 1LLOA 1G7UA 4QP0A 1VIZA 1FKTA 3WH0A 3N18A 4JFIA 4Q6XA 3TN5A 1IEIA 1UUOA 4MNKA 4NAFB 1FWFC 4LUIA 4XUGA 1PVNA 2GJLA 4HTYA 3JUGA 2HBVA 2PGWA 4ZOAA 1QUMA 3KAOA 1T0OA 2Z1VA 3WJSA 3V1HA 2Y2WA 3MP3A 4HARA 2I1OA 2A5HA 2J8FA 3KZSA 5CC3A 5LIWX 4FP1A 4W9PA 3WK2A 5IHSA 3VX1A 1TQXA 5DRIA 3DKJA 1LG2A 3MDYB 1MXGA 3KABA 4EIVA 2OQYA 2EPLX 4J40A 3GG0A 1TX2A 4OKDA 1I2QA 1E1CB 5AYXA 3UGVA 2EAWA 3EOOA 3F2DA 4AWUA 1R86A 1J6OA 2TMDA 3P8IA 2BVDA 3EXRA 2GQ8A 1SO5A 3LZ3A 2YBVA 2Q8XA 1MXDA 5DBTA 3SY1A 4GJIA 3ZWTA 2A85A 3UJSA 3GQYA 5I24A 1MFUA 2H3DA 2HXTA 3EMQA 4IISA 3W7IA 1CZ1A 3NPUA 4ML4A 5HMEA 2J6VA 4IX0A 3FAPA 3WQGA 4UTIA 2EKGA 2GVEA 4CU7A 1XLFA 2HVNA 3ZZ1A 2VGIA 1P5QA 2PPGA 5K7JA 1JAEA 3OHMB 3KXQA 2E40A 4HOXA 2YYUA 3PS7A 3GR8A 3C2EA 2VN1A 2QLYA 3WL0A 5CH9A 5JH8A 1JPMA 3MI3A 3WH6A 3D47A 2GGGA 4DAIA 1QRQA 3KVMA 3N6JA 4NZ5A 1JPIA 4GZ7A 1VKFA 5CGMA 1Z48A 4B91A 3BW3A 4XQ6A 4I6VA 2HPIA 1UKTA 3L0GA 1KTCA 3L21A 2AMXA 3F03K 2A3CA 1SUXA 1XLGA 5D9MA 2CLFA 3APYA 2ZTKA 2ZTJA 1VEPA 4V15A 1AW1A 3WQEA 3LCGA 4G7FA 2GJRA 4R27A 3T78A 4LAVA 3GFZA 1R85A 1JUBA 3AXHA 3LHUA 4JDYA 3OZYA 3TSMA 4E4UA 4NZFA 2NSXA 1N8WA 1W5OA 4J3VA 1CLKA 1MEHA 4EWJA 5AVNA 5A94A 5D9PA 1UH3A 5AY7A 2VEIA 4QG8A 2VHLA 2J88A 4ZQCA 2XVNA 3NR0A 3EEZA 3GDKA 3S83A 1UD5A 1Z42A 3KZ7A 1Q6CA 1R7OA 1VBRA 1PB0A 7TIMA 3G77A 2J79A 3B8IA 4DXKA 2CW6A 3BJFA 3N2BA 4I9TA 3B4YA 3BAYA 1XLIA 2QIWA 2ZUUA 3ZVHB 3NURA 3DHUA 3PWIA 4YN5A 3MSGA 2Z29A 3UZZA 2OVLA 2ZWYA 1IYXA 4J3SA 4W7VA 3I3BA 3M46A 3H2AA 3NL3A 4O17A 3IHZA 4O1CA 1E71M 5HWCA 2YA0A 3N14A 4JTCA 3VFCA 1XCXA 4RE4A 1EOKA 4DZ2A 3DFHA 2WQDA 2BBFA 1K3UA 1R8LA 3NO1A 4G1NA 3T0CA 2OO6A 3I3EA 1XM3A 2JALA 1DTNA 5JUVA 1HJUA 1UYQA 4YXGA 4L4OA 3KW3A 1OFRA 4TVUA 1E55A 2PV3A 2CWXA 4MLRA 2RDUA 3QYSA 1AJ2A 4XUYA 2O92A 2CBUA 4HYRA 2OOGA 3VD4A 2IS7A 2XGIA 3LDVA 4UFJA 1LORA 3IVTA 4ZQMA 1WB0A 1GQNA 5HWJA 4CQ8A 1GOIA 3W83A 4GNKB 3K1DA 3T2OA 5JXQA 1R2RA 4GZIA 7TAAA 3RU8X 4W88A 2ZZ6A 1Q6UA 3WDPP 1XLKA 3A3HA 4S3CA 5H1WA 3TKFA 3L4YA 3GG1A 3NGJA 3FYPA 4CQ9A 5HWNA 1D2KA 4L1WA 2PURA 1FWEC 5FL0A 4KEVA 1K9FA 3VD7A 1A5SA 3WLPA 2VX5A 4K39A 3W86A 5H8PA 3E38A 2WVSA 3N9SA 3UERA 3W9ZA 4TW6A 3SW6A 1EPXA 1M04A 1TWDA 3THCA 2WJEA 3E0IA 1R3VA 3AWOA 1NP2A 4B5VA 4QDMA 1F6PA 4HNLA 4PL2A 1Z44A 3MPGA 4JIQA 1I8JA 5D9NA 3O06A 5CZTA 1TVPA 1FH7A 4AWSA 5I09A 1VCVA 3SEPA 1US2A 2BY2A 1D7JA 4XZ9A 3LI0A 1PZ2A 1REQA 2CLHA 2VNCA 4C6PA 3TDFA 2Y1HA 1GNXA 3B0VC 4RZ4A 4JQ2A 1S3HA 2P1FA 3V7PA 4HKPA 3UWYA 4YTSA 4GUGA 1VR6A 2CFFA 1YDYA 3L12A 3NTPA 3HF3A 4H9MA 4O2TA 5DXXA 2QJNA 2OR2A 4S3GA 3TW9A 3UPWA 2ZQUA 4E4FA 4UOQA 4XAPA 5IDZA 1QPQA 3L65A 1D3CA 3PM6A 1EP2A 1X8FA 4JIIX 4CNTA 1BWLA 4RXFA 4KQNA 4M6PA 3S3GA 4QJ4B 4H9UA 3H24A 3LCXA 1JDAA 3WMSA 3SCUA 5D33A 1A5NC 5GNZA 5HA7A 4KRUA 2C1IA 3WH9A 3SN4A 3P7YA 4TOQA 2YW4A 3FW6A 4MJ4A 4CQBA 2DY3A 1KC7A 2NQJA 3MV01 3GYCA 5AB3A 4XKYB 2KO7A 3PAJA 2UY2A 2VC5A 2FTWA 4GQBA 2ESCA 3RLGA 3ITLA 4PTDA 1TTQA 3UFYA 4FS9A 2PF0A 4Q4SA 2E67A 1KM1A 3KHDA 3ABZA 5LGXA 3W07A 3BGJA 1XPYA 1QR7A 2HE8A 1SYTA 4CD7A 3UXKA 1FWHC 3QGVA 1WUFA 4F40A 1P6BA 3CEUA 4M7SA 1A3XA 1WXJA 3A24A 3CMGA 4RV3A 2GVYA 3NPWA 4HPHA 1E72M 3DECA 2RFGA 5TNVA 3VGFA 3T08A 1GZJA 3M9YA 1JNDA 2CLLA 3RFWA 1VYRA 3DG3A 3UCDA 2J77A 1YXCA 3P81A 4FA3A 1FP8A 1HJSA 3OVRA 2G41A 1SJAA 1F8IA 4G50A 4S3FA 1IEQA 4HNUA 4QCEA 2DDXA 4AUBA 1TRDA 4XKMA 1GGOA 4G9PA 3R8HA 3REQB 5G1TA 2DW7A 4OBTA 2XVLA 4DNMA 5EMMA 3PJXA 4IMEA 2DZUA 3FJ6A 1ZTVA 4IIGA 1SZGA 2MLZA 2RDXA 4TW7A 1EHAA 3B9NA 3S9YA 4JTFA 2YL5A 3JRKA 5AYYA 2XP3A 1T8QA 2HSAA 2VJXA 4W9QA 4JFUA 2QPUA 3TQPA 3AMLA 3TLQA 4DI8A 1P6CA 4U84A 2E5DA 3N4EA 1QPLA 2ISWA 2PWVA 3TWBA 1IX5A 4W8LA 3ZR5A 1P48A 2PDPA 3C8NA 4BK9A 1B57A 1RCQA 3NVDA 1EJSC 1UUQA 2V8ZA 3EAUA 3H2FA 3P93A 2PP3A 4XZMX 1O4UA 2HROA 2XUCA 1U1JA 1DWAM 3W70A 4QCFA 1NWSA 2P0IA 2A7NA 3VABA 5AHMA 1EIBA 2D0HA 2F7FA 1HKKA 1UKSA 4X61A 4JIRA 3IJ6A 2IXUA 1U1UA 4AXKA 1JUEA 4PODA 4ZFMA 3W7DA 4LVBA 1MVYA 2WNNA 3SFKA 3W1UA 5CC6A 3LI1A 1HKMA 4H41A 4JL1A 4DROA 4HNCA 1EDQA 5FESA 1GCYA 5EPDA 4I5RA 4LUTB 3MCOA 3MB9A 1YQ2A 5BCAA 3PPGA 3U7BA 1Z69A 3A3XA 3ARQA 2HVOA 4O54A 2XP4A 3VGGA 4L3NA 3S4TA 2V5JA 4IL0A 3EYPA 1LQ2A 2WSYA 3WF3A 1ISXA 2QPXA 1MNZA 2QV4A 3U57A 4RKAA 2ZRYA 3HMJG 3HPAA 2Y6ZA 3TROA 4JHMA 3SADA 1F05A 5F2IA 1LCOA 3KVLA 3ZO9A 5DRCA 4ODKA 2O55A 3W1XA 5DELA 4CNNA 1XC4A 4DBSA 1UD4A 1SM9A 2J8TA 4L6OA 3LCHA 3W74A 2DZTA 3TC7A 1DXEA 5F2LA 1BXNA 5A8OA 2ZE0A 3UJFA 3MANA 2J78A 2I57A 4XD3A 2ZDSA 2ZWZA 2PCQA 4GVFA 1M6JA 3E6EA 4CLMA 3GTHA 4QLKA 3GAKA 3H4GA 1N2VA 1B3ZA 3N3TA 2PDQA 2ZX6A 2EHHA 2WCAA 4M5PA 7REQB 2XP9A 3TJ4A 1K8CA 3OLDA 3PN8A 1GONA 1SZFA 3GSMA 4MB4A 1G69A 2QMKA 4FR6A 3SCVA 4IP7A 3PFMA 1E44A 1VYPX 4KS0A 4ATDA 1TZZA 3CLMA 3DFPA 3FJ4A 1YLVA 2XVGA 4JTLA 4I3GA 3HIJA 1MW0A 3KBSA 1LBMA 4EPDC 1E6RA 1XRSA 1YNPA 3B9DA 2X41A 3POCA 2ETNA 3BC9A 3M0KA 4HSNA 1US3A 4ZE4A 1Q2SA 2QCCA 3ATYA 3EB3A 3NNTA 3S0CA 4AY7A 5HULA 5IM51 3B7XA 3WNLA 1XLEA 3SRFA 4D6HA 1PJ9A 4MOZA 1GHRA 1SVDA 3IJDA 1UMLA 3VZZA 1E5NA 4HSOA 1S5VA 3AZSA 1VPQA 4R7WA 1DIKA 3ANVA 2QGHA 5K4XA 4RZ6A 3H21A 5LHEA 3PWAA 3LHZA 2VI0A 2PBOA 1J6PA 3BUVA 3H8AA 2GZXA 1QZ2A 3GK0A 2OLSA 1M7XA 4Y9OA 5HKGA 2YSWA 2YGYA 3TJXA 5GPGA 3G1RA 3SQSA 4C1KA 3GTXA 5IFTA 2V68A 3UZ5A 2EPMX 5HMFA 1PSCA 5AYBA 1W1A1 2INZA 1TJ2A 4AWEA 2B7PA 2A3BA 1OC7A 1PZ0A 1E4LA 2VWSA 2BGSA 4ADTA 1VJSA 2KGJA 4CN6A 3GO2A 3SCNA 4Q6JA 3W7RA 4CVUA 4R9OA 2E9BA 2X2YA 2XDFA 1FKGA 4DZ3A 2QXWA 4A35A 1XFCA 3UPBA 4L7ZA 3AROA 3DH7A 1EC7A 4ZPTR 1PBKA 3G22A 4MB5A 4UFIA 5CZKA 4WUIA 3RO8A 1FWTA 3NA8A 1BVNP 4YL2A 4OWGA 1PEZA 3N4FA 5HW6A 3U2ZA 1AJZA 1I1XA 4Q33A 4QIBA 4JFSA 5C9ZA 3NPXA 4C91A 2H6RA 2PTZA 2XG9A 3W6LA 3CLWA 3PBWA 1NMWA 3DI0A 1G94A 2ICSA 1I60A 3HG4A 2G4FA 4NX0A 4DBEA 3TQKA 1JNTA 4LF2A 1VBHA 4R33A 4O0ZA 3AALA 4PMJA 3EWZA 4D6JA 5HUAA 3TR2A 1L8NA 1G9HA 3VC6A 3NQMA 1UG6A 1DPMA 4BI6A 1LOLA 1RH9A 1SFJA 2XVKA 4JFLA 1XD0A 2J75A 2ZQSA 4L9XA 4IWWA 1JD7A 3PJTA 5CCZA 4QAIA 2XIIA 5A3HA 1J4EA 1C90A 5HOSA 5BU6A 3GHSA 4M56A 1VYSX 2C71A 5I7GA 1AH3A 3IJLA 4GNJA 3L4ZA 5FAGA 2NXIA 2A0NA 2WNWA 1IXQA 2WVVB 3RXZA 3UT0A 2VDGA 2E3ZA 2PMQA 3AMCA 1E9YB 1OFOA 5LNWA 3T0AA 3UXDA 4DJEA 1RR2A 5GNXA 1ZSXA 4LY8A 1MUCA 2VX4A 1O5KA 3BARA 2CZ5A 3W7HA 1EX1A 3GDLA 2VR2A 4HHLA 3OJGA 1EP3A 3UJ2A 2GOUA 5LNVA 3MT1A 3DFSA 3LM7A 6REQB 4TW8A 1OYAA 3WK0A 5HJXA 1W3LA 3A64A 2Y8UA 3VCRA 1QU4A 1H49A 2PDGA 5CLWA 1PX4A 4QLLA 3TNOA 4EF8A 2IKGA 4M24A 3KADA 3ANYA 3B05A 2V38A 3VVGA 1I45A 2NV2A 3B8VA 2VURA 3N9RA 4JD4A 2BXVA 1W9PA 4MKNA 5TF0A 4PUDA 3D5HA 3BSMA 4L4PA 1Q3NA 4WZHA 4WHBA 2VCBA 3VMNA 3DGRA 4IGMA 3KOXA 1EIXA 3U4FA 1UR0A 1UR9A 1W37A 3CHEA 3VZYA 4JYEA 2NV9A 4PULA 1W1ZA 2WJDA 2AGTA 1UZ4A 4YHGA 2BX7A 2REQB 1FBAA 4M51A 3VILA 2R1NA 3B97A 1Y5WA 1PWMA 4GE8A 4RW3A 2VEGA 1EA0A 4NG3A 3TTQA 4GNVA 2WMHA 4HA4A 2IPFA 5JU6A 1OWQA 3L5AA 3T40A 3PBMA 5G4WA 3RPDA 3DN5A 3BZJA 1S1PA 2ZRXA 4TVCA 4LBRA 1BRLB 2BDQA 3C0SA 4F2TA 2XYLA 1OZQA 3VUPA 1KLZA 3EA1A 3UBPC 2QCLA 1MDRA 1NQKA 2XFYA 4FX6M 2X1RA 4LB3A 3WL1A 3U2CA 3NZ1A 2X0HA 4AZGA 3N2OA 1M01A 1QW8A 3MUIA 2YCLA 4DF1A 2VZSA 2ADAA 4QAWA 1MUWA 3NEHA 3IIXA 2Y63A 1BQGA 3TA6A 4DJEC 3OEXA 2PDMA 3WNNA 1BKSA 1CGYA 4O1AA 4FNUA 1PXGA 3BLEA 4QHRA 3W1AA 1PYFA 2L2SA 1XICA 3W73A 3E5BA 1LLWA 4MDPA 1X98A 4LYRA 1AA1B 3A4XA 1LWJA 2YR1A 3ENLA 3LBOA 4NKCA 1QO5A 3MO4A 2YXOA 2Y5SA 2OPJA 3F2CA 4OUIA 3MY9A 1V02A 4O57A 1VRDA 3CUJA 2E28A 2HE5A 2Y4SA 3W28A 4QZVB 2NQHA 3K13A 4C1NB 4MYXA 1SJDA 1PE1A 1HTIA 1FP9A 2ZCGA 2P76A 2PB1A 2XSXA 3TVAA 4ERGA 4AZ5A 2YFNA 4MUPA 2ZA2A 5I00A 1QI0A 3DFQA 2A3AA 3U2EA 3EWCA 4CU6A 2IKIA 1D8WA 3OIHA 2C91A 5DT7A 3LU2A 3WSUA 3KBMA 5BWFA 1CLVA 3H2MA 2POTA 3CQ0A 1SFSA 4PTWA 3T55A 2FFCA 1E6PA 2DZPA 4UQBA 1IQ8A 3NWRA 1F40A 3EIPA 1BYBA 5D03A 7XIMA 2FVLA 3F5KA 2PGEA 1TTIA 3KDNA 3W25A 1OF6A 3W1LA 1EC8A 2DUXA 4POCA 4L9ZA 1TMHA 3VNDA 2FB2A 1DQXA 2PN0A 4ODNA 3CS2A 3Q58A 2WBGA 3KHJA 3SCWA 1QOPA 4HU4A 4LANA 2XIBA 1YIXA 1LTDA 3FHQA 4YCPA 5D8ZA 5BNKA 3D6NA 4M81A 3VGHA 3VOCA 2VFDA 3HPSA 3DERA 4C6CA 1Z3NA 1E56A 3ZJ8A 2GJXA 3OODA 3LGGA 2PGRA 3CC1A 3CYJA 3GNDA 1Q85A 4WK9A 2VTFA 5FCZA 2R1KA 4CQCA 3N34A 1WAWA 1BTCA 3M0JA 5MKGA 4QTGA 2D20A 2QVHA 4HZ8A 5E0KA 4WIWA 3NEVA 5LA2A 3KL0A 3O5DA 3IRDA 5DITA 3KBJA 4NU7A 2ZE3A 4M80A 2QCHA 1CWYA 1S2WA 1TTPA 4AEFA 4AX7A 3ORWA 4R3UA 1VEOA 4V28A 1B4EA 3LA4A 7A3HA 1GOWA 4WKFA 4JOMA 1MRQA 3KAHA 2ON3A 2BHUA 4UDMA 3VKJA 4DZ5A 3VDHA 1P6WA 4C7DA 1PV8A 3NDYA 1PHWA 1ZY9A 3HGRA 4AY8A 2I9EA 4FALA 1O12A 2PLJA 4GIRA 2EG7A 1A3HA 5JMUA 1LP6A 1WUEA 1LBFA 2ZQVA 4O0KA 4CCZA 1DP0A 5AZ0A 3EX3A 4IT4A 4YTTA 4NXKA 3D3AA 4IJRA 3RX3A 3F2BA 4GINA 4DN1A 3G2GA 3GE7A 3W85A 3W3OA 1YADA 2WLZA 3BPWA 2YPIA 1JZ2A 3HMCA 4CN1A 4XZWA 3RR4A 1TV5A 4JFVA 1RY0A 1EOMA 5E9AA 1XIIA 3TW7A 4M1RA 3NI6A 2VEMA 3WUBA 1ZS2A 3NGFA 4GWEA 3LZ5A 5AECA 4PRRA 3SCPA 1VQTA 3QLDA 3W7QA 1VGAA 2E0PA 3P3BA 4C5YA 4CU8A 1KWKA 4WXYA 1MWOA 3OW1A 1W5PA 3ALGA 1YPXA 3GU9A 2Q71A 2BFGA 1KQZA 1M5YA 1W3HA 3CT7A 1F3TA 3VGEA 4FXJA 4GXPA 4NNAA 3QPZA 3W4RA 3W2UA 4GO9A 3JVAA 3OZPA 2XFFA 1V6WA 5HR7A 5FF2A 4QEHA 4F0LA 4XBKA 5KZDA 2YW3A 2Z7GA 2AOSA 3CNYA 2TPSA 5EBUA 1OG6A 3N11A 3EPNA 4KT2A 1QNQA 1MW2A 4PUJA 2DZWA 4J1OA 3DESA 2NQLA 2VYOA 3WQ4A 4DB7A 5JVLA 2J24A 5E9XA 3RGCA 2WV8A 3ARUA 3V3WA 1V3IA 5E1QA 1R9ZA 1TB3A 3EA3A 1GPFA 5EU9A 1MEWA 1JZ7A 3VMOA 1MFVA 3EB4A 3BLOA 3DU0A 3RM9A 1ZJAA 3I6RA 2KZHA 3RNDA 3IPWA 3QPYA 4CGTA 5JH2A 4GZJA 3ABRA 1NF7A 1XI3A 2G3FA 1OINA 2VUYA 1XLJA 2CBJA 4PUEA 1L8PA 2CHRA 2ZQTA 3GM8A 5D2TA 2IW0A 4NX5A 1OCNA 3LHYA 4QS5A 2FDSA 1KKOA 1X1NA 2PV1A 3LLDA 5KEZA 1UKPA 3N9KA 3LV5A 4NRSA 1Z6KA 4AQLA 4PMXA 2FVMA 2DSKA 4XBSA 3HB9A 1E40A 2VOMA 3UQNA 3R4IA 4I8YA 4JQAA 5EMJA 3TIMA 4RXGA 2YCIX 3O5FA 4LB4A 2CKRA 1PDZA 1A5MC 2BLEA 5RUBA 4R9XA 3C0JA 2C6QA 2GUUA 2X1IA 3P14A 4AC1X 3WLLA 5AC8A 2GGIA 2VGFA 3PF3A 3VOGA 4M29A 2D0GA 3T42A 2XP6A 4TYOA 3UI4A 1H11A 2FKEA 4E2VA 5HUPA 2C1GA 2VWTA 4Q8MA 2YXXA 1XLCA 4J4OA 4N19A 2ZR6A 2EPNA 4ZB5A 5I98A 2C8NA 4B92A 1UWAA 1LROA 3SJNA 1TMQA 3FVDA 2CESA 4DRPA 4OJYA 4ZODA 2NXGA 2VDHA 4JKMA 3O9NA 3E9AA 1HP5A 5G2WA 2MUCA 1YDVA 2VGBA 4O1FA 1TPH1 1HGYA 3VIJA 1VB9A 2FAPA 2Z1KA 3SZ8A 5IXEA 4EAMA 3G5EA 1KLYA 1TIWA 5C8BB 4GHRA 4C6OA 2PI6A 1EBGA 1E1CA 4NHVA 3UWVA 1OC6A 1FWWA 1HL9A 1JR1A 1NEYA 4W84A 2TODA 4Q4KA 3KUMA 3H9RB 4PBGA 4AYSA 1QI3A 3MWAA 3R94A 3LCWA 1VFSA 3IRSA 1A0CA 1PTDA 4DRKA 2PDUA 3GW3A 1S5TA 2J7FA 3ZMRA 2PLMA 1Q6GA 2CCRA 5DX7A 1RQBA 2J13A 4TMBA 1GKQA 3U6WA 5FOOA 1RBAA 4IIHA 5D05A 5GJNA 1S2TA 4FI4A 3VD9A 2NX9A 3VPLA 3P0WA 9RUBA 3NQ6A 1Z89A 3C4UA 1H1YA 4GQQA 2PPNA 1E1FA 3EZ4A 5KINA 3WLHA 1I9CB 2Y7EA 1ECEA 2GDVA 5HPOA 1FH9A 3M5YA 2OYKA 3ZJ7A 3O07A 3KACA 4QJ3B 4I90A 1DJWA 4JKKA 1XW8A 5DY2A 8XIAA 1XIJA 3UY8A 4Z08A 3KCOA 3CAWA 1H51A 1O1ZA 1J4IA 2PDCA 1QT1A 2OZTA 1ICPA 1QDSA 1AQHA 3IV8A 3RPMA 2OYLA 3CZKA 2VEPA 5A8GA 1EWDA 3JZUA 2QYGA 4ODPA 2PWGA 1UQZA 1LRQA 2PE4A 1VP5A 4DRJA 5DANA 4GGQA 1VPXA 3QTPA 1H62A 3V5FA 2YX0A 1L1PA 1GKRA 3RJXA 1C92A 1A80A 1IGWA 5E09A 4DUXA 1A5BA 1FKFA 4DVOA 4W9TA 4AHQA 3N6QA 2XH4A 1SZNA 1DOSA 1FCBA 2QULA 1UHVA 3WNPA 1GJUA 1XL9A 3HPZA 2JKAA 1F07A 2BSLA 1EXPA 2VFGA 3GNXA 4W9OA 2Q3RA 4PSRA 2F6KA 1LL6A 3Q65A 3TONA 3TU9A 1US0A 2FKPA 3Q94A 1CI1A 1W1TA 3WQ8A 5D4YA 1FWGC 1EH9A 3QHMA 3P8JA 3URNA 3VGBA 4ZOCA 2D2JA 3BL3A 4WDUA 1FKLA 1FX6A 2VL4A 4K8EA 4IMGA 2A3LA 2XH2A 2B7NA 2EPHA 3T07A 4EP8C 5I3FA 1VJZA 5EFFA 4WKHA 1YE6A 1Q4NX 4JYDA 4ZXOA 4LAXA 5TQLA 1FWAC 4HOWA 1S38A 4JTSA 4Q8OA 4GG9A 3XISA 3NM3A 2DT1A 1XLBA 4PFHA 1U1HA 5ABGA 5D32A 1MQPA 3PZIA 3EWWA 5BOFA 1VBJA 3W2NA 5DMLA 4IJBA 3BW4A 4N9CA 1E6QM 3R5EA 3QF0A 2BMBA 4L56A 1W3JA 2FJKA 1MQRA 1TE1A 2UY4A 1EEXA 2QCGA 1ADOA 2VC6A 3BWWA 1REQB 2W5FA 3AZRA 4GABA 1XG4A 1W5NA 1DQUA 2Y61A 2VCDA 3W7NA 5HATA 4O1DA 1XKJA 4UQDA 2NV1A 3GXFA 6ENLA 4MPQA 4P7OA 3HFYA 3WFZA 1QBBA 2OXNA 1E0UA 3NYZA 1Y0EA 4FAMA 2A7PA 5HW8A 3UA3A 2Z4GA 4Q7BA 2CBVA 3HURA 5G1YA 3TQVA 3RF9A 3AIVA 4D8LA 2FPTA 4QJ1A 1BL4A 1EO7A 1T99A 4DJFA 5CQ1A 3HQPA 4DJED 3EXSA 5D9OA 2XZ9A 1A5OC 3B8UA 3IGHX 4Z1DA 4TV6A 4ZQNA 4UQ9A 3QXBA 1J01A 3PZ9A 3O63A 5C9RA 3NXLA 4NI3A 1AK5A 3OZOA 3BO9A 4M7TA 2V6AA 1ME7A 4TUFA 4C60A 3VK5A 4PUWA 3NPVA 3KRBA 4IFKA 3BJSA 3ZR6A 1XLDA 3C56A 5CAKA 4BFAA 5LIKX 4PMYA 3ZM8A 1EJ7L 4JX4A 4IGSA 2CERA 1NWUA 5LA0A 3WLJA 1JZ5A 1OC5A 2VDIA 2F8QA 2PBCA 1FY6A 1EF2A 3T0BA 1RK5A 3Q45A 4BF9A 5A6KA 1FHDA 3EBVA 3ZXWA 1GVSA 4JZ5A 3N25A 3NQ7A 4HHHA 3Q67A 1SZEA 1B3XA 1DE6A 3PZMA 2V69A 5EYWA 2ZX5A 1FRBA 5CJNA 4JL2A 2C0AA 3UZXA 3GUGA 3L4XA 1F8MA 1QXLA 1LM1A 2GK1A 5D2WA 5CPNA 5AHLA 4IL2A 4FIRA 3CPGA 4LUSA 4H9ZA 4RNFA 2OELA 1MSSA 3NQ8A 3MW7A 3LENA 2BXZA 3OP2A 3QR1A 5HK4A 3R6IA 3VMPA 4BQ4A 3LN3A 3NL5A 3ZJ6A 4XKYA 4B5SA 5FF4A 3AS0A 3MVTA 2AAMA 2FMOA 5HANA 4GXMA 3CTLA 3TTOA 5A2BA 2D2HA 3PAOA 4EVZA 1YEYA 1GTEA 1BLIA 1GYNA 3OLEA 1UPPA 4JFMA 3MDUA 1L0PA 1PO9A 5A6AA 4O1EA 4YLWA 1Q6RA 3ZS4A 3GVVA 1TJRA 1Q63A 1O5XA 1NWTA 1IZCA 1EJWC 1L6YA 3T81A 4DJFC 4FN2A 3V16A 3L4WA 4RNIA 2PTXA 1H7OA 4ZPWR 2EPKX 1A5KC 1J2WA 1B3OA 4FMVA 4KWVA 3BAXA 3ITOA 4S2CA 3WF2A 3U5UA 5CPMA 3DEQA 3WQWA 2IPGA 4E0CA 1OY0A 1CDGA 4J28A 1FWNA 4D6CA 1BSLA 1ITQA 5BROA 3GH7A 1Q65A 2J7GA 2X42A 1SFLA 7CGTA 2HK0A 1HFBA 4FNRA 1U2YA 2CITA 3F4CA 4ALDA 1V0KA 1H41A 5CBJA 1ZGDA 2E8YA 1HGWA 4D6EA 5BYWA 1C93A 4H2HA 2HS8A 5KETA 4H7CA 1VH7A 1KT1A 4RR4A 3UR2A 4OV4A 1XP3A 4JEQA 1XX1A 3UG5A 3UWWA 1J18A 3INPA 5G4HC 1XIDA 1K03A 1UWIA 1UC5A 3S1XA 4JY9A 4LNCA 3SQMA 1GQKA 3WMLA 2GVJA 2VELA 2PDXA 2CZVA 3W2KA 1WZMA 1HX0A 4ACZA 4HCHA 4QG6A 3R12A 1BVZA 5BMXA 4AISA 3NSXA 4XTIA 4XISA 3QHOA 3KM8A 1VFTA 1RV8A 4JGDA 4NI8A 2Q6ZA 3U7VA 1FKWA 2IUZA 4J3UA 2B4GA 4J7RA 1AW2A 1WAUA 1YXYA 5CKSA 1K9TA 1BEUA 3M6YA 3VCCA 3K1GA 4K1GA 2LPVA 1SMAA 4MADA 5FAJA 4AD4A 4IP4A 2VCCA 2GJNA 1YPFA 4LYKA 3SCOA 5B80A 4URIA 3M6DA 2BZNA 1TV2A 2XP5A 1Q5MA 1LQAA 3HV9A 2GLKA 3LV6A 5J6EA 3GXDA 4IX2A 3A21A 1GHSA 3CJPA 3VNYA 3RM4A 2EG8A 2O9OA 4K6AA 2BOEX 3G0XA 3L7RA 4D71A 2NXHA 1S5WA 3MC5A 2NT1A 3ABQA 3TC6A 2EJAA