3G6LA

The crystal structure of a chitinase crchi1 from the nematophagous fungus clonostachys rosea
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
388
structure length
388
Chain Sequence
b'TGSINAVYFTNWGIYGRNFQPADLQASKILHVLYSFMNLRVDGTVYSGDTYADLEKHYSDDSWNDIGTNAYGCVKQLYKLKKANRSLKIMLSIGGWTWSTNFPAAASTEATRATFAKTAVEFMKDWGFDGIDVDWEYPASETDANNMVLLLQRVRQELDSYSATYANGYHFQLSIAAPAGPSHYNVLKLAQLGSVLDNINLMAYDYAGSWDSVSGHQTNLYPSTSNPSSTPFSTKAAVDAYIAAGVPASKIILGMPIYGRAFVGTDGPGKPYSTIGEGSWESGIWDYKVLPKAGATVITDSAAGATYSYDSSSRTMISYDTPDMVRTKVSYAKGLGLGGSMFWEASADKTGSDSLIGTALSSMGSHDSTQNCLSYPNSKFDNIKNSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase
publication title Crystal structure and mutagenesis analysis of chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with the inhibitor caffeine
pubmed doi rcsb
source organism Bionectria ochroleuca
molecule tags Hydrolase
total genus 141
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3g6lA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3g6lA01
3A6OA 2V3DA 3VPLA 3VIPA 4PTMA 5C71A 1E6XM 1V03A 2E8ZA 4TX6A 5HDRA 1MXDA 3GXMA 1IZKA 3N9KA 3HJEA 1RP8A 1WKYA 2W66A 1R87A 3WIJA 1W3HA 3ARUA 2YBUA 2QV4A 2XM2A 3T0AA 2WWDA 3WL1A 2BY0A 3WF3A 1Q4NX 1B3VA 1UA3A 1JYWA 2CBVA 3VX0A 2J4GA 2G3JA 5E0FA 3LPGA 2QHAA 3OGRA 1HJSA 4HOWA 4MB3A 1HKJA 2E40A 4NZCA 3ARYA 2WHLA 2Z1SA 4CN6A 5CPQA 1JD7A 4W8BA 2V5DA 4D1JA 2XG9A 4GQRA 2Y2WA 1HNYA 1HL9A 4AWEA 4HU0A 1WPCA 1B90A 1OCQA 4U33A 5CLTA 4CU6A 1XSJA 3AMKA 5IFTA 2RGMA 2EEXA 2MANA 3KZSA 1PIGA 3M07A 1J12A 4OOUA 3S6TA 3TTQA 3WL0A 2A3EA 4S3JA 1G1YA 3WEMA 3GBEA 2XYLA 1WCGA 1DHKA 2ZUMA 1W9UA 1JL8A 2XJ7A 4JKLA 1LF1A 1UQYA 3VGBA 3L2LA 1TMQA 4UCFA 2XVGA 2CPUA 3RJYA 4AD5A 4AZ7A 1LG1A 3ZIZA 4BQ3A 1E9LA 1ZBVA 4GXPA 1G5AA 1BYCA 1WE5A 1QNSA 1GQKA 3WMCA 4X9YA 5BXSA 3SCOA 1VF8A 1ZBWA 3NSXA 5E09A 1JXJA 1D3CA 1EIBA 4UR9A 2NT1A 2V3GA 2X05A 2A3BA 2YLLA 3VVGA 4PCTA 1UD5A 1UKPA 2J25A 5EFDA 3VGDA 4ATLA 1TVPA 1LWJA 2WKGA 4W84A 4AMCA 3AS0A 3BMWA 1BG4A 3L4XA 2CHOA 2VCCA 3AMDA 4JCLA 1TZ7A 2J7HA 1UR4A 4E2OA 1JZ3A 3BLKA 7TAAA 1OGGA 1CENA 3ALFA 1TG7A 4P7LA 3ZT7A 1JNDA 2GJPA 3D5HA 3TTSA 3W29A 3EYPA 3CUJA 3K1DA 2VX7A 1J0ZA 4M24A 5ABFB 1H11A 2VQTA 3VGFA 3WQVA 2VURA 2XM1A 1L8NA 3MUZ1 4JL1A 4A3YA 4HPGA 1GORA 2J7DA 2G41A 3BAYA 1OWQA 1JIBA 1ZBCA 3BXWA 2PBOA 1CGUA 3AXXA 1V08A 3B9DA 1HJVA 3VGGA 1WDRA 3EDDA 2DT3A 3WEZA 3WD1A 4W89A 5D8ZA 5I6SA 2G3NA 3SCNA 4M81A 1E4MM 1CZ1A 5KEZA 3CUHA 5DEZA 5A1AA 1CGTA 1MQQA 4W7VA 3WEOA 3SUUA 3UR8A 2WCAA 3N15A 1MW2A 3PZMA 2ZUUA 1IV8A 1PIFA 4J7RA 3OG2A 4AISA 1AVAA 3SUWA 3AQUA 4M80A 1GJUA 4HTYA 4OOZA 3N04A 3W28A 3TP4A 5CSYA 2OSWA 3I3EA 4B15A 3VMPA 1SFSA 2ZOXA 4H2CA 5I3DA 1KXHA 4PTVA 5FL0A 2E9MA 3WKZA 1Q6DA 4HPHA 5ECUA 3EMQA 4ZXOA 3VUPA 5HOSA 3FW6A 2ZUTA 1E6ZA 1W91A 1FA2A 2AMGA 4TOQA 1B0IA 3BMVA 3QGVA 2O9TA 3WNNA 1GVIA 1H4PA 4WIWA 4F8XA 5KZ6A 3GBDA 3DYPA 1X6NA 5BYWA 3CHFA 2D20A 4UFIA 5A6MA 1XC6A 1HKIA 3AYRA 4CU8A 6A3HA 3ARWA 1G0CA 2W62A 4D6JA 4DWSC 4UFMA 4ZE5A 3FHAA 4PEEA 4F9JA 3CHEA 2YA1A 2IXVA 4W8LA 3U7VA 4GKLA 4ACYA 4V2XA 5A94A 5M3WA 1ITXA 2ZWZA 5A6SA 1E6QM 1HXJA 2E8YA 4YHEA 3W25A 4UFHA 1XYZA 2VR4A 3AHXA 3WBAA 3BSHA 3CZJA 1GHRA 1XH0A 2ZUWA 1EQCA 2YDSA 2VZVA 3VIHA 4AD0A 3CPUA 4JFWA 4F66A 1JF5A 3WBEA 4AW7A 3A4WA 4MAZA 2F8QA 1C8YA 1H49A 1H2JA 4UQAA 2EPMX 3UERA 4PMZA 3VIOA 3O2LA 4BF7A 1E72M 2VMFA 4CU7A 3RDKA 3SUTA 1ISXA 1WDPA 2XWDA 1J0JA 3THDA 2DSZA 5CSUA 4MPKA 3U5YA 4QDMA 2VC9A 1XD1A 3GNOA 3OZOA 5A2CA 3B9AA 3K46A 3N13A 2G3IA 2BS9A 1E0WA 4YN5A 3U57A 4TUFA 1UHVA 4MDPA 3WD4A 2WLYA 4YPJA 3GXFA 3PTQA 4RE4A 1VJZA 1ECEA 4QLLA 1H0GA 3WH9A 4HMDA 1E40A 3ARPA 2ZICA 2BXYA 3PN8A 3F5KA 4X0NA 3CMGA 3PZNA 3HU7A 2VCBA 3D3AA 1CXIA 4B16A 2X0HA 3W37A 2VL4A 1CYGA 3UR7A 2Y8VA 3UETA 3OLEA 4LYPA 3AHZA 1GOKA 4W85A 1C8XA 3MSDA 1JDAA 5JIWA 2DSVA 4IPLA 2CYGA 3AROA 2WVVA 3F5JA 3M46A 4QCEA 3T09A 2UY5A 2JALA 4J3UA 4NF7A 3M7SA 4PBGA 4MB5A 3VNYA 2G4FA 1G9HA 1QI3A 4H7VA 4P8UA 5A95A 2ZWYA 2XIBA 4OUEA 1W2PA 3OLDA 5HPOA 3WNMA 4C7DA 1ESWA 3W0KA 5JH8A 3RM9A 2WMHA 4HMEA 1ZU8A 1UUQA 3IANA 2FDMA 2V38A 2RGLA 1QI4A 1K9EA 4XV0A 1UWQA 3WMSA 3CZEA 1XRVA 1UD4A 5LYRA 5BXRA 4UOQA 1G94A 1ISYA 1DWFM 1KXVA 2FHBA 1TE1A 2GSJA 4W87A 1RH9A 1JDDA 1VFMA 2VTFA 5CG0A 3WF2A 4PSRA 1KCLA 2CETA 4PMRA 2B31A 3EBVA 1I1WA 2OWCA 5A2BA 2E9LA 5AC5A 2VX6A 4HA3A 3ZO9A 1DWHM 1OD8A 1LG2A 4ACZA 4GZIA 5M5DA 3CMJA 4ZENA 3TA9A 3VINA 1KCKA 5LA2A 3CH9A 4EAMA 6TAAA 2BVTA 1GW1A 2DIEA 1B9ZA 4P8XA 1W3KA 4H04A 5A6BD 2YL5A 3ARQA 4CVWA 4WJXA 2ZX5A 2J7BA 2BVYA 4U5KA 1E0VA 1ZL1A 1UR9A 1E70M 1PJ9A 3WF1A 8CGTA 1E6PA 4HZ8A 3N18A 1KB3A 4WSJA 4FLQA 3MKKA 4P8WA 3WF0A 3MU7A 2VZUA 2VCAA 5HPCA 3JUGA 1UH4A 1EXPA 4PYSA 1S46A 3NJ3A 4A4AA 4AC1X 1IZJA 1TVNA 3WELA 1BFNA 4GI8A 4AD3A 3W81A 5I0DA 1CDGA 2ZXAA 4M8UA 2WC4A 3AXIA 4TX8A 2OSXA 5E70A 1HIZA 2XIIA 4KRTA 4DWSA 4NSBA 1GOWA 3CIVA 3OLIA 4AIOA 4GI6A 4H8UA 1JI1A 3WQ5A 9CGTA 2VJXA 3CUGA 1E1EA 4CCCA 2DQXA 1DTUA 4JL2A 1J10A 3NDZA 5A8MA 3VDHA 4B9ZA 1NP2A 2GDVA 4LYRA 1V6WA 4JZ5A 2HVMA 4GZJA 5I77A 5EB8A 2CKSA 2PWEA 1TUXA 2J7EA 4MJ2A 3KL0A 1OSEA 5GNYA 3ARRA 1F4HA 4GPNA 3GH4A 3SCPA 4L4PA 4D6EA 1UYQA 5CGMA 5M03A 3GM8A 3PBGA 4MADA 4TXEA 2VQUA 1ISWA 5I5RA 3SURA 3T08A 5FKYA 2V3EA 1B3WA 2XVPA 4AD4A 4Q7NA 3HN3A 1EOMA 5GNXA 3KE0A 4UFKA 1C92A 2VX4A 1OGSA 4GINA 2PC8A 1KGUA 4CCEA 5A6AA 2WVVB 3SCQA 4JFVA 1W32A 4QCFA 3AIWA 1FH7A 3M6DA 5BWFA 1GUVA 3SCUA 3L2MA 3T2OA 4BZYA 3APGA 2A3CA 3GNRA 3AMCA 3AS3A 2XWEA 4D6DA 1ZJBA 1V3JA 1HKKA 4BQ5A 4HOXA 5EFFA 1M03A 3ARXA 3T0DA 4NI3A 1GOMA 1Q6GA 2DGAA 4PMQA 1R85A 3AIRA 4ZXLA 3IK2A 2Y5EA 1JZ5A 1TFVA 3ZSSA 2NSXA 1EHNA 1KR0A 1UKSA 1TR1A 1JZ8A 1B3YA 3PZTA 3G6MA 3OLGA 4LX4A 1K6AA 5CPSA 3IAPA 3DYOA 4DWSD 1LQ0A 1V3IA 2UY2A 3AZRA 3CZ8A 3VU2A 1W9XA 2EQDA 1GOQA 3T2PA 3EDKA 5FIPA 4J3VA 5DO8A 3TONA 1JZ6A 1UWUA 4ACZB 4E8DA 4P8VA 4IISA 2OYLA 4UQ9A 4BS0A 2XVLA 4V27A 4D6HA 3VMOA 3WNOA 1ISZA 3BCFA 5JUVA 2CESA 3FNDA 2C7FA 1GQJA 1QOXA 1QW9A 4V28A 2YA2A 3BLPX 3VIFA 1UWRA 2YDRA 5BXTA 1N82A 2CKRA 1MW3A 2QPSA 1JG9A 3A47A 2A3AA 1J11A 4PMYA 4PUEA 3L4WA 1HJQA 4LGXA 3TTOA 2EPKX 3VILA 3ZM8A 3VTRA 4PSPA 1K9TA 4W93A 3S2CA 1E6RA 1R8LA 1QNOA 2W5FA 8A3HA 4OZOA 4QLJA 4GQQA 4E4PA 1CNVA 3CBWA 2CNCA 3MUY1 3CHCA 2CERA 2NT0A 2NW0A 2BXZA 5CGTA 4C7GA 5D4YA 3CUIA 1ODZA 3ZJ7A 1CLXA 4DWSB 4KGLA 2GDUA 5FOOA 1PEZA 1E4IA 3UG3A 4URIA 4A3HA 5I79A 3BGAA 2Y24A 3N12A 2BY3A 1VIWA 4P7RA 5CXPA 1UZ4A 2CHNA 4DM2A 4CGTA 1MQRA 2EXOA 4B3KA 4BQ2A 2GJRA 1KWKA 3AXHA 1MFUA 2XFRA 3BH4A 4HU8A 4KWUA 3W26A 2WKLA 3RM8A 4HA4A 3ZJ6A 2ZXQA 3AIEA 5CQ1A 3UEQA 5IHSA 2J75A 4IM4A 2ZX7A 4HZ7A 1LWHA 1B1YA 3K4AA 1JYNA 1HN1A 3OBAA 1I75A 3GNPA 3POCA 1HP5A 4D6CA 4W88A 4YHGA 3WUBA 2IUZA 3W27A 3ARSA 3WUEA 4R27A 1KFWA 3GTNA 4Z2JA 2XFFA 3PZIA 2CIPA 5BXPA 5A2AA 3VNZA 3GYCA 3TTYA 1UKQA 4TVUA 3DYMA 1E56A 1WAWA 4MTVA 2XVKA 1KBKA 5C70A 4U3AA 4OBRA 4QLKA 2WAGA 3VM7A 2WW5A 2FH6A 2WHJA 3WFLA 4PMDA 2W4XA 3FY1A 1YQ2A 3KWXA 1SMDA 2ZE0A 1KGXA 3VMNA 1TCMA 5JBFA 4KH2A 1HP4A 2J62A 3GH5A 1B31A 3NSMA 2V5CA 3L4VA 2WMFA 3MV11 3VM5A 1EHAA 2C0HA 3ZT6A 1EDQA 4MNMA 3ZR5A 1CXKA 2WZIA 2ZX6A 4JFUA 1WZLA 2V3FA 3DHUA 3K8KA 4H41A 3WSUA 2CBJA 2QF8A 4L4OA 3CGTA 3FAXA 1V3LA 4PCSA 5BROA 3RJXA 3W38A 4J3XA 2VRJA 1B3XA 3PZGA 4HZ6A 3L4UA 1EH9A 2OSYA 3TOPA 2EBNA 1VFUA 2VZTA 4KRUA 2QPUA 4OJYA 4TTUA 5A8OA 2GFTA 1UR8A 2W91A 1MW0A 1C93A 1MFVA 5A3HA 4CUCA 1H09A 3WDPP 1EO7A 4PN2A 3ZJKA 5A8NA 4U2YA 1XH1A 2D2OA 2O9OA 4UQCA 2JEPA 2JE8A 3VD9A 3OGSA 1M7XA 2YL6A 1MXGA 4M56A 3OIHA 1VRXA 3DHPA 2WPGA 3SIMA 4RL3A 4DUXA 1W9VA 3CO4A 2GVYA 1BYBA 2DEPA 4UFJA 4AD2A 2ZUSA 2X09A 1NQ6A 2VR5A 3W82A 4EK7A 1GCYA 2VUYA 2WZEA 1Z32X 1OINA 4UZUA 3NDYA 5A6BA 1DWGM 4CD8A 2CBUA 1AMYA 3RO8A 1FHLA 1QBBA 4IUGA 2G3MA 3SCVA 1GQIA 5DFAA 1OBAA 3VGEA 3VGHA 2OLHA 2ESCA 1JD9A 4AEEA 1VEOA 5HBFA 5IFPA 1BHGA 3VIGA 4JCMA 2GJXA 3E1F1 4B3LA 1V6UA 3MV01 5JBDA 1JFHA 4U31A 3NIYA 4UFLA 3ZJ8A 3VD7A 2WMGA 2ZX8A 3L4ZA 1XV8A 1JYVA 3ARVA 3AYSA 1E6SM 1UWIA 4LYQA 3T2QA 3WDIA 5FL1A 1MW1A 1WNOA 3K8LA 1Q6CA 1K9FA 1SMAA 4HP5A 4M1RA 3WDHA 5FD0A 2BHZA 2EO7A 4E8CA 1XCWA 4MNLA 2YL8A 1SR0A 2QLYA 4P7NA 1PX3A 2O92A 1J01A 5LA1A 3AZSA 3KEHA 2ZXDA 2VT0A 4CN4A 1W3JA 3AZTA 4W5ZA 1BPLB 3QHNA 3BCDA 1J0YA 3OZPA 4AY1A 1BGGA 3SUSA 4LQ1A 1EGZA 3WUFA 1GOOA 2D3LA 4CVUA 2BHYA 4EKJA 1E3ZA 5IDIA 1VEMA 4HOZA 3WUGA 1HX0A 3IJ9A 3BSGA 2UY3A 4OKDA 4AYSA 1H1NA 4TVCA 1DEDA 3ZT5A 3W53A 1IT0A 1U30A 1C8QA 2JF7A 3AS2A 3PZUA 1WZKA 3U7BA 1UD6A 1PBGA 3FXYA 1W2VA 4HMCA 2C8NA 4DUVA 4AIUA 3W6MA 3DC0A 2ZX9A 2D0HA 4B9YA 4AIEA 5CPTA 3AIQA 5GPRA 5GNZA 1CGXA 3WH8A 2XVNA 1E6NA 4WKAA 3WMBA 2WBGA 3G6LA 4W86A 1MQPA 1WDSA 4D1IA 2PB1A 3KL3A 3CZGA 4XUYA 2BNJA 1C7SA 1E4LA 1RP9A 3AHVA 2X2YA 3N11A 4MDOA 1HJXA 1A47A 1V0LA 2DH3A 1UH2A 4NRRA 4PMXA 2PWHA 1OD0A 1UR1A 4UZSA 3WNKA 1FFRA 1W1TA 3F5LA 3PZVA 4UQEA 5A6LA 4JKMA 1GVYA 5BRQA 1LL4A 2DSKA 4C7FA 2DSUA 1W9PA 1H0IA 1UD2A 1M53A 1EQPA 1P6WA 2XPKA 4J3TA 4XZBA 3VO0A 4CCDA 2D0GA 2ZUVA 3AICA 2WVTA 1OT1A 3SCWA 2TAAA 1C3FA 4F79A 3OA5A 2AOSA 4UOJA 2JEQA 3CUFA 2GK1A 4QAWA 1KXQA 4Z2LA 2FHFA 3PTMA 2J74A 4AZIA 1E71M 2D3NA 2D23A 3VOCA 2CCRA 1O7AA 3VIIA 4ATWA 3AISA 2VVNA 1R86A 2ZIDA 3RCNA 3W24A 1XSIA 2UWFA 4H8VA 1QBAA 1YHTA 5DMYA 2PWGA 3MS8A 1JYXA 4PMOA 1I1XA 1NWUA 2BFGA 1XSKA 2YLAA 4D6GA 5D9MA 1NH6A 1HT6A 4AZCB 1FP8A 1HJUA 1LL6A 2YL9A 3SCTA 1HVQA 2VRQA 1CBGA 1VEPA 3FAWA 1HJWA 2X0YA 5AYBA 1PZ2A 3VDCA 3AMLA 3EMZA 3W6LA 2JIEA 4JHZA 3EMCA 2WMIB 2E9BA 5M17A 1CTNA 1JNEA 2GJXB 3WH5A 1R7AA 4MB4A 4RE2A 4MB1A 2XFYA 1CWYA 1LJYA 4MAVA 2GUYA 2UY4A 1E15A 3WD2A 2J47A 4LPCA 1D2KA 1LLOA 3CZKA 2WXDM 2CEQA 2BHUA 5AYIA 3AMGA 1W9DM 1EDGA 2JF6A 1H3GA 1RD6A 3FHQA 2WM0A 2J8FA 4W5UA 4CKQA 1FOBA 1NOUA 4AEFA 1QHPA 1R7OA 1W1YA 4D6FA 2WC7A 4WK9A 1QNQA 3N1AA 4JKKA 4W7UA 3OGVA 1E43A 1EOKA 1CGWA 3WH7A 1OIMA 1QNRA 3LPPA 3RIKA 4J3SA 1BF2A 4S3KA 4FLSA 3ZQ9A 4CD4A 1B30A 3A4AA 3WD0A 3ECQA 4KMQA 5DT5A 4CD5A 2XSBA 4D71A 1J0HA 4D72A 2Z1KA 2XUCA 3UCQA 2YKKA 4RE3A 1DWJM 2J77A 5EMYA 5EBAA 4BCEA 1KWGA 1CGVA 4ML4A 3MMWA 3HMCA 2VI0A 1GJWA 1NOWA 2J7FA 3WD3A 1V3MA 5AC4A 2VOTA 2Y8KA 2WMJA 1JZ2A 4WKHA 4FLOA 1D7FA 4K68A 5D8WA 2JFEX 2DDXA 2EPOA 3L4YA 3II1A 5A8PA 3GXDA 3U5UA 1JDCA 3NYDA 1NWSA 2PI6A 1E1FA 1ZB5A 4P7QA 3DECA 1L0PA 1J0IA 3I3BA 1VBUA 3IAQA 3NCOA 4AZ5A 1XH2A 1NM9A 4PMNA 1CLVA 4M82A 1UR0A 1JI2A 4MJ4A 1J18A 1PPIA 1QNPA 2XSAA 1JF6A 4H8HA 1UZ1A 3MUAA 4UOZA 1CXEA 1OGBA 3WNPA 2HISA 3MANA 2XGIA 3VD5A 4BQ4A 2J7CA 2G8ZA 3MUIA 2YBTA 1VENA 1ZBKA 4WLCA 3QHMA 1GNXA 1AQ0A 1UWSA 5A69A 3O9NA 1EDTA 2WVSA 2OWWA 4Z2KA 5JBEA 2GK1B 1NWRA 5TD4A 2YA0A 3NSNA 1NP0A 2DT0A 3GZAA 1E5NA 2WC3A 5D9PA 1WDQA 5HNNA 1HVXA 3VIMA 2D22A 2VZSA 1QPKA 1QVBA 4GI9A 4PMVA 3SUVA 1UKOA 3BAWA 1E55A 2JIWA 5HXMA 2DSWA 1BLIA 4R5EA 3EDFA 3VKKA 2FHCA 3RPMA 4Q22A 2Q8XA 2WNWA 3IJ8A 4PMUA 3WNLA 1ZJAA 3VD4A 1XD0A 3B8SA 5C8BB 1ZS2A 4OIFA 4CD6A 5CZKA 1QHOA 1CEOA 2PBGA 1O6IA 2OYKA 3PTKA 4ZFMA 1FH8A 4AZHA 4Z2HA 3FN9A 1V0MA 3WY1A 1V0NA 3SCSA 2W92A 5F7UA 3PHAA 3ARZA 2PF0A 1CECA 3EDEA 3GXIA 4JHOA 3W4RA 1VBRA 1CPUA 4PTXA 4GO8A 1GPFA 5AY7A 2BY2A 3UG5A 5ABHA 5E6ZA 1BAGA 5E6YA 3BAIA 1US3A 1UD8A 4ZE4A 3MO4A 1A3HA 3LPOA 1JZ7A 3AIBA 4Z2GA 5ABGA 4IPNB 2EPNA 2D24A 1UA7A 3AHTA 1PZ3A 2PWFA 1JFXA 1KXTA 3CZLA 2W61A 2AAAA 3VDBA 4HA1A 1WZAA 1VFFA 3KL5A 3WDQA 2A3HA 3THCA 4UTFA 4D6IA 4FLRA 3WENA 3NUKA 3UESA 2DH2A 2ZUNA 5A6JA 2QMJA 2FGLA 5ABEA 4PTWA 1BTCA 2XGBA 3CTTA 3WQ8A 1WZMA 3LPFA 7CGTA 3VIKA 2VNCA 3GDBA 4AD1A 2WHKA 3GH7A 1QI2A 2X1IA 1H41A 1UG6A 4FF5A 4PRWA 2WLZA 4WKFA 4UNIA 4F9DA 4Z2IA 2W63A 4KGJA 1GOIA 2VO5A 2ZXBA 1V6XA 2DPEA 3O6AA 2WB5A 1H5VA 2E3ZA 1TA3A 3WFZA 2DT1A 1DP0A 1BG9A 1JAEA 4AZBA 1AQMA 4JFSA 1UR2A 2CITA 1DWAM 3AS1A 4UQBA 3QHOA 1VB9A 3CLWA 1SYTA 3CHDA 1C90A 1V3HA 5IHRA 5CLWA 1HL8A 5BCAA 2BVDA 5LA0A 3WH6A 5JIPA 2E0PA 2CBIA 3VD3A 3RM4A 2FH8A 1UOKA 2CXGA 3AJ7A 4AZCA 1W1PA 3WN6A 1KQYA 1JZ4A 2WSPA 1KBBA 5I23A 1NWTA 2YIHA 1OIFA 2EJ1A 2W67A 2WWCA 3PZQA 2DT2A 1FH9A 4QFUA 1VJSA 4AXNA 4J27A 1UQZA 3LMYA 4TTGA 1OT2A 1HKMA 3VIJA 1BQCA 1US2A 3T0BA 1JGIA 1EA9C 3N17A 2J7GA 3PZOA 2WMIA 4Y7EA 3UG4A 1F4AA 2EPLX 3VX1A 1BVZA 1CIUA 2WYSA 3QOKA 1G01A 4DUWA 2VZOA 3BAKA 3WDRA 2WZHA 2DIJA 2D0FA 4WSKA 3QR3A 1X1NA 4EE9A 1QW8A 4BA0A 7A3HA 4MNJA 3BAJA 1PX8A 2Y4SA 2VRKA 4P7OA 1GONA 1GHSA 1CXHA 2J8GA 1ITCA 3K8MA 3MSGA 3BC9A 1FHDA 4UQDA 6CGTA 1QI0A 3AHYA 1MWOA 1E4NA 3ZSTA 3A3HA 4U2ZA 2WVUA 5CJ5A 2VVSA 1XHGA 4N42A 1UKTA 4DM1A 2J79A 1OM0A 2YOCA 4FMVA 4CD7A 2OWXA 4EANA 1U33A 1BYAA 2FGZA 2F61A 3ZR6A 1FFQA 5FCZA 1E5JA 4GIAA 1DWIM 1JAKA 4AZGA 5IXEA 2D1ZA 1V0KA 1XCXA 1X6LA 5E0CA 1BGAA 3AIUA 1V02A 4LXFA 1HF6A 4NRSA 4PUDA 1E3XA 1QI5A 1W3LA 1V6VA 4JFTA 2VX5A 1GQLA 3ZOAA 1CGYA 3L4TA 1Y7VA 1ISVA 1MVYA 1Q6FA 3MMUA 1C7TA 3AIVA 2X8RA 1E73M 1GZJA 4JAWA 3J7HA 2WK2A 1PAMA 2F2HA 5I2UA 3A4XA 4X0VA 1UD3A 2QMKA 1MYRA 3AOFA 2WCSA 2YJQA 2E4TA 3ZMRA 3AFBA 2OYMA 4N0RA 4XX6A 4MNKA 1BYDA 2WHMA 2IXUA 1B3ZA 3SEPA 1M04A 4U3CA 1UWTA 1V02E 4XB3A 4TVDA 1B2YA 5I78A 4WF7A 1XGZA 1J0KA 1U2YA 3IJ7A 5D9NA 4OBSA 1J9YA 3EDJA 3QOMA 1EO5A 4W7WA 1AQHA 5GQBA 1C91A 5I24A 1NARA 4XZWA 1RPKA 4J28A 1CXLA 3WQ6A 3POHA 4JIEA 2XHYA 4FK9A 1PX4A 2XTKA 4CN1A 1XYFA 5A6KA 1KQZA 2BY1A 4ZEPA 3SCRA 4M29A 2BV9A 1ODUA 1WB0A 2WSKA 3WF4A 1JXKA 1K9DA 1VAHA 2O9RA 2WBKA 1VFOA 4AZ6A 1TA3B 5D9OA 5BRPA 1M01A 1NOFA 1CXFA 3WDJA 5A8QA 1V3KA 4J3WA 2WCGA 1LL7A 3ALGA 3MMDA 5DF0A 5ABFA 4ATDA 3WQWA 3I3DA 3AI0A 2O9PA 1W1VA 1WP6A 3RILA 1OB0A 2J78A 2WMKA 1FP9A 1KR1A 3K4DA 3OB8A 3PZ9A 1BVNP 1KGWA 1E0XA 3WQ4A 3F4VA 5E9AA 1V6YA 3VDAA 3RMEA 2WANA 2YDQA 1BSIA 4GO9A 2PWDA 1QHZA 3BAXA 1UH3A 3B9EA 4QP0A 4U5IA 4W8AA 1Q6EA 5DT7A 3ARTA 1W9BM 1WO2A 4GZEA
chains in the Genus database with same CATH superfamily
3A6OA 4DLFA 2V3DA 3VPLA 2MNRA 1Q13A 1RY0A 5K3VA 1SO5A 4ZMGA 3B0UX 7XIMA 5HDRA 3GXMA 4LBSA 2DP3A 1WKYA 2HMCA 1RZMA 1R87A 3RHGA 5FJIA 2YBUA 3T0AA 3P61A 3WL1A 4DPPA 1UA3A 5XIAA 2J4GA 2VEKA 2G3JA 5E0FA 1HJSA 3U2CA 4MB3A 4BF5A 1N8IA 4MLRA 3ARYA 2WHLA 2Z1SA 1GZ1A 3KAGA 1JD7A 2V2CA 5H2ZA 2V5DA 2ZFAA 3E2RA 3CU2A 2XG9A 2E28A 2Y2WA 1FWRA 2PPNA 2FFCA 3UPMA 1WUEA 2QUTA 1I0BA 2RGMA 3G0SA 2GQ9A 2EEXA 4XAPA 3F4CA 3MSRA 1PIGA 3G1VA 5I03A 4KEUA 3TTQA 4IIEA 3WL0A 5LGZA 4S3JA 2Y61A 1BTMA 3WEMA 2WJZA 5AHEA 4IIGA 4JTFA 2ZUMA 5GVJA 2HK1A 3OVRA 3WQPA 4QZVB 4UCFA 3P5YA 4AD5A 4AZ7A 3QY6A 1ZBVA 3KABA 1ZAHA 1FWNA 3TZFA 4TMBA 4ICCX 3P67A 1XLHA 3W1XA 4G1NA 4J9JA 3UPWA 1IWPA 1ZBWA 1XLDA 1CLKA 3NSXA 1FWSA 1JXJA 2IQ0A 3MKVA 2OEJA 4UR9A 3THAA 3M64A 4JQAA 3VVGA 4PCTA 1TWZA 4FXJA 5AKQA 3VGDA 4ATLA 3CQJA 4W84A 1N8FA 2ALRA 3HJZA 4ZQCA 2CHOA 1TZ7A 2J7HA 1UR4A 4CQ9A 4FB7A 1HGWA 1OGGA 4F0KA 3AUOA 3IRDA 4XVEA 1JNDA 2PD9A 1OEPA 3DG7A 1NSGA 4MWAE 3SM0A 1OX6A 1CB7B 5I09A 1F40A 3SECA 2FPTA 5EMUA 4M24A 4DO7A 5ABFB 2OZ0A 3W71A 1P5BA 3OVGA 2PMQA 5EKYA 3NG3A 4HPGA 1GORA 2G41A 3Q37A 1OWQA 1ZBCA 4MYXA 4N7QA 4O16A 1CGUA 3AXXA 3LCLA 1H5YA 3B9DA 1BEUA 4IJRA 4LVBA 1FX6A 4ZBCA 2Z25A 3T40A 3BL3A 3OYZA 2QVHA 2OX4A 3NZGA 2PA6A 2D9FA 4NL1A 2GVEA 4RZ4A 1CGTA 3KUMA 4IZGA 1NIUA 4P5UA 3S9YA 5CSSA 4CQ8A 3WEOA 1FKTA 2E67A 6PTDA 3GU1A 1FKHA 2WNZA 4J7RA 4JN7A 1O94A 2E68A 4M80A 1GJUA 3TK7A 3N04A 3W28A 3UGVA 4UBPC 4P2VA 3PBVA 1M3UA 4EPEC 5CAKA 4W9OA 3I3EA 3S2MA 2V6AA 3GVQA 3IPWA 1CT5A 4W9QA 4GVGA 2ZQTA 4Y6GA 4WDTA 3BG5A 1M7PA 2ISWA 2RHGA 3BLDA 3PG9A 2F38A 1IR2A 1Q6DA 3MA8A 2E6YA 3QSTA 4GBUA 3TJ4A 4TOQA 2LPVA 1US0A 4KKXA 3ZWSA 3CGMA 3IJDA 4IP7A 1W3IA 1H4PA 1OC7A 5BYWA 3CHFA 1FKDA 4H9TA 4UFIA 2VP8A 3S47A 3MY9A 2DZTA 4H6EA 4G50A 1T96A 3JS3A 4CU8A 2VEIA 3NQ7A 1G0CA 2W62A 4UFMA 4LEQA 5EBUA 1ZJIA 4IMGA 1UWAA 3TQVA 2XP7A 2MPHA 5DCDA 1W56A 1QXLA 5M3WA 1S2WA 3H2FA 4LRSA 2E8YA 4E3TA 4XD5A 1K8CA 4LAOA 1TTIA 4DAFA 1XH0A 2PLMA 3TN3A 1F2JA 4JFLA 4F0MA 4F66A 4HBKA 2QIWA 4PTDA 1JF5A 4AW7A 4JYSA 4FI4A 1VLWA 1H2JA 4C6CA 5CCZA 3ABQA 3UERA 5GPGA 3U48A 3VIOA 4LUTA 3O2LA 4BF7A 4LB3A 4JTQA 3TYZA 4MJZA 3W00A 3SUTA 3LBMA 3HPAA 1PXGA 3O5LA 2VM8A 4JS3A 1EPXA 3N13A 1ZPTA 2PDJA 3RFAA 2PDWA 4QT2A 3LTPA 3BICA 1SZNA 3CEPA 4YPJA 3R25A 1FY6A 1VJZA 4PL2A 1ECEA 4XAZA 3TROA 4AAJA 5C9ZA 3MZ2A 3NWRA 3VKAA 2V5BA 3T7VA 2CLKA 3SZ8A 3D3AA 4ONVA 4B4HA 1W1ZA 3GQYA 1CXIA 3W37A 1CYGA 2PAJA 2Y8VA 1GOXA 3OLEA 2ITKA 3KTSA 4C5YA 1Z89A 4HSHA 2CYGA 3AROA 1O5XA 5A5WA 3GLCA 3L23A 2QPXA 4J3UA 2A4AA 1F3TA 3QLDA 3A12A 4C1NB 3OG3A 3PUDA 3C86A 4DF1A 1UMYA 3EX2A 1TWDA 3S4TA 1QI3A 4QNEA 3U2EA 1OFRA 3MDUA 4P8UA 4IGSA 3A4JA 4Y9NA 1FKLA 1W2PA 2XISA 1QJWA 5G1YA 4RNIA 4GABA 4PCNA 3W0KA 5J5RA 1VCGA 4RPPA 3A64A 3W02A 4MWAC 2NQZA 3RM9A 2VDGA 2PDQA 3W7PA 4FEZA 2WMHA 1YTEA 5IBXC 2FDMA 4M5PA 2RGLA 1QPQA 3QFWA 2PV3A 3MCOA 4XD3A 5LYRA 1UD4A 1S2VA 3GO2A 5BXRA 2QDGA 1G94A 3AJXA 1KXVA 1W5NA 3GNDA 1JDDA 3GDRA 1FWCC 1KCLA 3LOTA 3FKRA 2J6VA 2PC4A 8RUCA 2GJNA 1Q7QA 3EWCA 2AGKA 2VX6A 3B8TA 3TSDA 3PG8A 3CMJA 1NQKA 2INEA 1KCKA 4K37A 2DIEA 1PVNA 3CIXA 1W3KA 2C15A 4Y90A 3VOGA 3RG6A 4XBSA 1FTXA 2YL5A 4NNBA 3ARQA 4L9ZA 4WJXA 1XLJA 3HOJA 2BLEA 4U5KA 3XINA 2XPBA 2RJGA 1ZL1A 1E70M 1JQXA 1PJ9A 8CGTA 1DQXA 5D2YA 1E6PA 3H53A 3WF0A 3TJLA 1IZCA 1BXNA 1FKFA 3U4FA 3L65A 1FWAC 1EXPA 3K13A 3RO6A 4PYSA 1HFBA 3AYVA 1TVNA 5DY3A 5HR6A 2ZXAA 4NJGA 1ZGDA 2W9MA 1ZJHA 3BGGA 3ITOA 2E5DA 4DWSA 4KRTA 4AIOA 3OLIA 4MMWA 3AAMA 1LZOA 3ELFA 2VENA 3CV1A 1JI1A 1P1XA 4NNCA 3UNDA 9CGTA 1Q6UA 4K6AA 1E1EA 4OU1A 2DQXA 3NDZA 2IPGA 5DMMA 2HVMA 2CKSA 1N2VA 1SUXA 1YX1A 4ZOBA 4OVXA 2BOEX 1PUDA 5GNYA 1F4HA 4GPNA 4FNSA 4QEHA 3GG7A 3TR9A 1XL9A 3GM8A 5M03A 5C6MA 4MGVA 4TXEA 2VQUA 1NFBA 5I5RA 2QCEA 4BJHA 4YTQA 4AUBA 4RW3A 4Q8TA 2BTMA 2F7FA 5KZMA 3HM7A 3HN3A 1MDLA 3W2UA 3KE0A 2XP9A 2ZZ3A 4G56A 1RLCL 3TW7A 2NVDA 2ICSA 1F8MA 4WOQA 5CZ0A 4WVXA 3KDNA 2YXXA 1KGUA 4CCEA 3N3MA 4GCXA 3VKBA 4TMCA 3MI3A 3EX4A 1OFQA 2BG5A 4JFVA 4I5UA 3AIWA 1FH7A 1FAPA 3GD6A 3R7MA 3APGA 4TV5A 5HMFA 1J2BA 3AMCA 3E0VA 3QJAA 3O7UA 2Z2AA 4ADUA 1HKKA 2UZ5A 2R1MA 4K8EA 2VC5A 3EZ4A 3T0DA 3CMFA 1LT8A 4EXBA 4NI3A 1F7BA 1GOMA 1Q6GA 2DGAA 4ZXLA 3IK2A 3MMTA 2PU0A 1RCOB 4A8RA 3OBKA 5EMJA 1UJQA 1TR1A 2CXEA 3G8RA 1U1UA 2Y7FA 1B3YA 1XJBA 3G6MA 2G95A 3OZMA 3KAFA 1K6AA 4QE4A 8XIAA 4HSOA 4Q4KA 4NNAA 4C6NA 4DH0A 4Q8OA 1UP3A 4DLMA 4ODNA 3TWAA 5FIPA 2B5UB 4GRSA 1U83A 4ACZB 3EA2A 3A21A 4P8VA 4UQ9A 3MUCA 3WNOA 1ISZA 5JUVA 2CESA 3M0IA 4H1ZA 3H7UA 4REQA 3N2OA 2DIKA 3H2CA 3IUIA 3LLXA 5BXJA 2CKRA 2RJHA 3IVSA 3DFPA 1UJPA 1Z7AA 2VDHA 2AL2B 3G1FA 1XDJA 4HNTA 1OCJA 1T6MA 2H8XA 3VILA 3ZM8A 4LYKA 2QUVA 2Q5AA 4E4PA 1CNVA 3FJLA 3CS2A 3TMLA 3MUY1 3CHCA 2CERA 2NT0A 3DERA 3B7XA 5D4YA 1ODZA 4DPQA 2ZYFA 2EKGA 4WXYA 3RFWA 1JPHA 4DJFA 3MDYB 4LU0A 3WLJA 3BGAA 3N12A 1VIWA 1TWIA 4Q8MA 4CGTA 1MQRA 2NX3A 3RU8X 4B3KA 4J2PA 1M5YA 1DJZA 1ECQA 3O15A 4QDWA 4K39A 2G0WA 3ZJ6A 4DAIA 2OZ8A 5HATA 1F6PA 5CQ1A 3UEQA 4BF8A 4IM4A 2ZX7A 1T40A 1AJ0A 1H7XA 2NVAA 1RK5A 3WUBA 3DFOA 1TTQA 3E2SA 3B04A 4A22A 1KFWA 3GTNA 3WJYA 5A2AA 4LNYA 1TQJA 4INFA 3TAOA 4RV8A 3G1RA 5LIXX 4TX9A 1AQFA 3DYMA 1E56A 4Q33A 2XVKA 5AHNA 5C70A 3KAIA 4DJEC 2X30A 5IOBA 3BCJA 1PTAA 1YQ2A 4DYEA 1SMDA 2VEPA 3W7HA 3GK0A 5IRPA 3MHGA 1TPFA 2ACSA 5AHMA 3NDOA 5CC6A 2PP1A 4H9YA 3DU0A 2WMFA 4A8IA 4RXFA 1XI3A 3VM5A 4WDXA 4WQ6A 3F2BA 3LHZA 4ZQOA 3PF3A 5T9BG 3K8KA 4ECLA 1SJAA 4L4OA 3FAXA 3LN3A 1SQ7A 1V93A 3TDFA 2YGYA 1EH9A 3GIPA 1IQ8A 2EBNA 2G97A 3SADA 4GUHA 3PFMA 1XKYA 2PCEA 2HS6A 2HDJA 1WBJA 5FEZA 4RZBA 5G1TA 4ICMA 5FJRA 3T78A 2YX0A 3NQMA 1IR1A 4BY3A 1V5XA 2D2OA 2JEPA 3OGSA 4LB4A 1FWHC 3O5KA 3DOPA 2B0MA 4DNHA 4GBDA 1ZUAX 5EL1A 3IV8A 2Z1WA 2Z2UA 4DUXA 4CQCA 3E0WA 3W7RA 1NQ6A 5CBJA 3M43A 4EK7A 2VUYA 5HJXA 4GZ7A 5A6BA 1DWGM 1XIIA 1W31A 2H6RA 3P60A 4L7ZA 4W4QA 3M0VA 4DRKA 2CBUA 4PFHA 3LSBA 4H9XA 1QT1A 3UYCA 2FVKA 3ORWA 2DW7A 2NXHA 2R82A 3VGEA 2RSEA 4D2JA 1SR9A 2OLHA 4DI8A 2HK0A 1XLGA 1VEOA 1S5WA 2IQDA 1BHGA 3IVTA 3CV7A 4Z1CA 4S38A 1JFHA 1HW6A 4PUMA 4UFLA 3BURA 3ITGA 5F1VA 4X2PA 2PODA 3H12A 4NNRA 1TPUA 4R34A 3PBUA 1GW9A 4HP5A 3WDHA 4KRZA 1XFCA 4JTSA 5M2FX 2BGQA 2OKOA 3TQPA 4FZIA 1VFHA 4DT4A 3OA3A 3KVJA 3LZ3A 1ZLPA 2Z28A 1XYCA 3N25A 2O92A 3W1RA 3AZSA 3KEHA 3MCNA 5AHLA 3WMLA 3R13A 2CWNA 2JQXA 3BZJA 4W5ZA 2WNQA 1J0YA 2QJGA 3VNLA 5IDZA 1EGZA 3UR2A 3WUFA 1GOOA 2D3LA 4CVUA 2QUNA 4JTJA 2V67A 1HX0A 2XIOA 4G8TA 3ONCA 2H90A 2OJPA 1H62A 4DVOA 4O12A 3W53A 1S3HA 1FKXA 3ABRA 5AYYA 4DB7A 2I5QA 3S2LA 3AS2A 4FNRA 3JVAA 4MPQA 3M7WA 2ACQA 3NPVA 4PRTA 4HMCA 4C6IA 1XLAA 2ZDRA 4PULA 3W6MA 3W23A 2OU4A 2ZX9A 4EWND 1NDVA 4AIEA 5CPTA 4QJ5B 2PE4A 2VHLA 4NU7A 1X97A 5K9CA 1E6NA 2ANUA 3IKGA 5EPDA 1MQPA 3TXVA 4XUYA 1GG1A 3E5BA 3DZ1A 3JR2A 1UIOA 4JX4A 1UH2A 5FF3A 2GOKA 1GT8A 1UR1A 1H7NA 1W1TA 3V5FA 4JKMA 2GOUA 1GVYA 5BRQA 4JFMA 4HCHA 1W5OA 3P6LA 1U22A 4L1WA 1FJDA 4IP4A 3BLEA 5CPMA 4DXVA 3B8WA 4C65A 1H7PA 5HINA 1O1ZA 4KERA 1C3FA 3EWWA 2AOSA 3CUFA 1SJBA 3DBPA 1XBVA 3NM1A 4JICA 1UC5A 4XISA 2V2HA 4WSHA 3GC4A 3W1PA 1YXDA 3G1HA 4OUIA 4KT2A 1XLKA 1R86A 2UWFA 3MS8A 1JYXA 2BFGA 4AZCB 1HT6A 5DRCA 4QISA 2YL9A 4Y9MA 2BB0A 3VC5A 4AHOA 3KRSA 2VRQA 1EUAA 2GQ8A 2NQ9A 5AYBA 4A29A 3FV9A 4Q8UA 4JHZA 1BKSA 2WMIB 1CTNA 4E2BA 4MB4A 4RE2A 2OFNA 4A3RA 4DUOA 2Z7KA 2J47A 5EY5A 1OFOA 4UR7A 3EPMA 3DG6A 2VGGA 3VXGA 3UZWA 1IGSA 4P61A 3W7LA 3TQ0A 3KW3A 3S5OA 3WQFA 2HZGA 1H3GA 1KRBC 3FVDA 1SZRA 1VHNA 1RD6A 4DJED 2JBMA 4GISA 4CKQA 1ONWA 1R7OA 4D6FA 1QNQA 1DYSA 3N1AA 4W7UA 2Z1BA 1E43A 3QW3A 2ZA2A 2VDIA 3E6EA 2UV8G 3G8EA 3W3OA 4BHYA 2OQLA 3V5OA 5AC6A 3WD0A 4O10A 5DT5A 4S3EA 3VOIA 4CD5A 4X3ZA 1JVWA 2YR1A 1Q2RA 2Z0IA 1J0HA 4D72A 2Z1KA 1XLBA 3L0NA 5HULA 4XG1A 2YKKA 4RE3A 1DWJM 4MKVA 1KWGA 1CGVA 4ML4A 1NMVA 2NUYA 2XIQA 3HMCA 4N4PA 3VZYA 3KS5A 5F2LA 3FA4A 1F76A 1RHCA 5AC4A 2WMJA 1SW0A 3JYMA 2FJUB 3L4YA 1KM1A 1SVDA 2FVMA 2A85A 3GXDA 1JDCA 3NYDA 2PI6A 4A3QA 4ERAA 1L0PA 1TCOC 3NCOA 2DG9A 4UMAA 1QNVA 1QO2A 2XZ9A 1UR0A 2FZ9A 4C91A 1LYXA 1XLEA 4JQ4A 4UNLA 1QNPA 3B03A 7PTDA 4F0LA 4UOZA 1AH0A 3HO8A 1KC7A 1F6YA 1AL7A 2ZQ0A 5HWNA 3QTGA 3MANA 2XGIA 4MY8A 3LD5A 4BQ4A 4WEVX 3EKLA 2CC0A 2IKGA 4O1DA 3SFKA 3DESA 1R9HA 1S5MA 4Q4SA 1RUSA 4CEXC 2X41A 3O9NA 3WLKX 4OWGA 1E9IA 4HCDA 5I3KA 2DT0A 3GZAA 2ZBTA 1WDQA 3F03K 1AD1A 3PAOA 1HVXA 3VIMA 4S23A 5DMNA 4LUSA 3S2NA 2TODA 3TCZA 4OFCA 4H19A 3BAWA 5HXMA 3PPGA 1FWGC 1ONXA 2DSWA 4OE7A 4Y9AA 3EDFA 2DVTA 2FHCA 4IP5A 3UVIA 3UR5A 3W2NA 2HE5A 1S3TC 1ZJAA 4IQJA 3P8JA 4JQ2A 2ABBA 2P10A 4CD6A 1RPXA 4AF0B 2G4JA 2DY3A 3PTKA 1EWDA 2NZLA 4AZHA 3CAKA 4Z2HA 1SSDA 1V0MA 5EA9A 3WY1A 4H9UA 1QASA 1Q2SA 2W92A 4WGHA 4GVFA 4CEUC 2ZTJA 3LERA 4JHOA 1RAKA 1AH3A 1R0MA 4PTXA 4EXAA 4NJJA 3OYXA 4ODOA 3IGSA 4KIRA 1VD6A 2WKJA 1TB3A 1UW9A 1XP3A 4M6QA 5DXYA 5EMLA 1KV8A 3N6QA 2DG3A 3AIBA 5ABGA 2D24A 3XIMA 1PZ3A 1EXBA 3GDKA 1PINA 3T07A 3IGXA 2TYSA 3KL5A 3WQEA 1VHCA 4N9BA 1DXIA 2Q02A 3NUKA 3WENA 2V2DA 5I7GA 2I5IA 1DL3A 1FD9A 1XRTA 3GTXA 2KAUC 3NYZA 3B0VC 3KBWA 4JN6A 3WLOA 1EYWA 2ZE3A 3PRBA 4JY9A 3C0SA 2WHKA 3B4UA 3B9NA 3NURA 4KFOA 4UNIA 4F9DA 4ODRA 4HHHA 2C1GA 4KWSA 4Y2WA 1Q3NA 4ODKA 3GIQA 2WB5A 3GY1A 1YIXA 4I8YA 3WFZA 4JTIA 3E5PA 1UZHA 1ML1A 3LMZA 3GXNA 3UXAA 1BXCA 4ICNA 4B5UA 2PDKA 3G0UA 4UQBA 2XP4A 4NT0A 3LBOA 5FJUA 1J6PA 4YCPA 4EAYA 2QV5A 3V16A 5BCAA 2BVDA 5LA0A 3H26A 1OZQA 1YPFA 2CBIA 1G7VA 3RM4A 1PHWA 1UOKA 3B0XA 3FDKA 4HPJA 1VC4A 3BWWA 2G50A 2WSPA 3W7OA 5I23A 1I45A 1R2SA 4NQ1A 1XKJA 2WWCA 1AK5A 1FH9A 3PZQA 3R8HA 1OT2A 4PR4A 4XZHA 3O6DA 2XP8A 1OJXA 2OVLA 1EA9C 1XBYA 5FF2A 3PZOA 1A5BA 1BVZA 1CIUA 3N9SA 4DUWA 1X6UA 2VZOA 4PB5A 3TSBA 3HQOA 1X1NA 4BA0A 4U28A 3O0FA 3BAJA 1FKBA 1IXOA 3T81A 4P7OA 1E51A 3Q45A 1GHSA 2LGOA 1ITCA 4FX8A 2VWTA 3K8MA 4M19A 4UMBA 3BC9A 1FHDA 6CGTA 3A3HA 1MRQA 3NEHA 1L8PA 1UKTA 4JTKA 2GGGA 1PS9A 1EL3A 2YOCA 3LNMA 4UTHA 3KOZA 3PBYA 2QCHA 5FCZA 1E5JA 4Z0SA 3GVWA 1XGDA 2DZUA 1DWIM 4GIAA 4GKTA 3OZYA 1X6LA 5CGQA 4POCA 3KRUA 5G2WA 1V02A 1HF6A 4NRSA 5HNTA 3WLMA 5CJMA 3BTNA 1V6VA 1FWJC 3G22A 2VX5A 5K2ZA 2B7QA 2PP0A 3NFUA 1Y7VA 2OGJA 2X8RA 1E73M 4O17A 4N6FA 2F2HA 4GIVA 4WCJA 4AMAA 2QMKA 3QEZA 4Y96A 3GHRA 4IMEA 1KFKA 1WKEA 4V15A 3NOYA 4PBFA 2V5KA 3AFBA 2OYMA 4WY0A 1BYDA 2FPYA 3GSMA 3PSWA 1T5AA 1XYAA 2EKCA 5FSDC 3SEPA 1UWTA 2ZQVA 4MYAA 4XB3A 1JQVA 4IIFA 5DELA 1J0KA 4LW7A 5D9NA 4F48A 4OBSA 4YTTA 1P6BA 2AAMA 5HJYA 4ZO7A 4LT9A 2CHRA 1DXFA 3ABOA 2WNNA 1TRIA 3EOOA 5C55A 4MSSA 3POHA 1G6CA 1LRNA 1VLIA 4IMFA 3R0UA 1XYFA 1KQZA 2EG6A 1ODUA 1SFTA 1TRDA 4QITA 2O9RA 2WBKA 3DEQA 1XYLA 3FGCA 3CJPA 3T8LA 3LDVA 1RBOB 3MZNA 3UI4A 4A21A 4A8NA 2XH4A 2V30A 4FNQA 3MMDA 5LKYA 3CAWA 5DF0A 3REQA 1BL4A 3I3DA 3ANYA 1WP6A 1VBGA 1OB0A 2WMKA 3VCCA 3U9IA 3K4DA 4AQLA 4IQLA 3OB8A 4FXRA 1Z44A 5CG7A 1E0XA 3WQ4A 3F4VA 3OHMB 1V6YA 3H21A 2HBVA 2QXWA 2FDSA 3E0LA 2OX1A 4K2SA 3GR4A 4H3DA 4U5IA 4W8AA 4HHMA 1LOQA 4GZEA 1KTBA 4LV9A 1MUCA 5HTGA 3DHDA 3W70A 4H9VA 4TX6A 3PULA 4AX7A 5FA5A 1RP8A 4NJIA 1T41A 4KWOA 1H1ZA 2XM2A 2WWDA 5AB3A 3BSMA 2QJJA 3TN6A 2OZ3A 2HWGA 1D3HA 1XBXA 1MSSA 3URNA 2QHAA 4HOWA 2NV2A 4HARA 3ABXA 2E40A 4ZO8A 1MEHA 1EP2A 4I6KA 2FFIA 2RKXA 4GQRA 1EZ2A 3QH2A 4I7VA 4RZ6A 4O53A 1FXQA 1HNYA 1FWDC 1T7LA 1HL9A 5GJNA 2RQSA 3D0CA 2JKPA 1WPCA 1TCDA 1YNQA 1RBAA 1XLFA 1I2PA 3U4AA 3ZZ1A 4C6EA 5IFTA 4MVAA 2C71A 2MANA 4S3DA 2DVXA 4XSLA 1PHQA 2Y7GA 3M07A 5G1MA 3ZR4A 1POKA 2V5LA 4EF9A 3GXTA 3GWQA 1ROTA 1XIHA 3IJQA 8XIMA 1JL8A 1R46A 4ODPA 4AG0A 1UQYA 3E49A 3VGBA 2NV1A 2XVGA 4R7WA 3S5NA 1LG1A 3PR2A 3UT0A 4GXPA 3RR4A 3K1GA 1QNSA 4WGXA 2AWGA 1S2UA 3O63A 5BXSA 5F2GA 5LGXA 3VABA 4Y8EA 1KBLA 2R14A 3L7RA 1D3CA 3NGJA 1AODA 4ALDA 2V3GA 2FIQA 2H9AB 2QR6A 2A3BA 5HWJA 1OX4A 1RA5A 4AWSA 4XKMA 3QY7A 3DI1A 3AS0A 5HR7A 1BG4A 1IT7A 4A8LA 3L4XA 1SZGA 3GX9A 3TKFA 3VFLA 4IPXA 4E2OA 1LBFA 3BLKA 2PZ0A 1CENA 1PZ1A 1MMFA 4X60A 1TG7A 4P7LA 3ZT7A 3VNJA 3CAQA 5DY2A 3TTSA 4E2DA 3LCWA 3TYEA 2WZMA 3V18A 3VCNA 2B7PA 4YTRA 2BP1A 2QCMA 3DENA 5CJNA 4AH7A 1H11A 1A7XA 4B91A 3VGFA 2E5BA 7ODCA 2VURA 2QGYA 1L8NA 3MUZ1 6REQB 4G9PA 4G7EB 4DBDA 1G67A 1ONRA 1JIBA 1P7TA 2BODX 4Q4RA 2J6XA 2DZSA 1EEPA 3A9IA 2BDQA 2Y5JA 3W7JA 3NQVA 3PWGA 1AW5A 3LV6A 5A8GA 1QW7A 3T55A 1HJVA 2GLKA 3VGGA 3KX6A 3LCHA 2WV8A 3LXAA 2XZ7A 4GUJA 4HD5A 3BW4A 1KNWA 4L6HA 1Q63A 5I6SA 4LV4A 4WY0F 4M81A 3DGBA 3GS6A 5E0KA 3WLNA 5DANA 3ITTA 3PPCA 5C7VA 3CUHA 3M0YA 5DEZA 3N6JA 1YATA 2XFWA 2RUSA 1NJJA 1MQQA 1Q45A 2J9ZA 1XIBA 5B8IC 3UR8A 4O8RA 3W7EA 3PZMA 3H6OA 4X22A 1TPH1 3SUWA 4C6MA 2ON3A 4V33A 3UF8A 4HK5A 4HTYA 3BANA 2XH0A 1QO5A 1OYAA 3TP4A 2D69A 1WOAA 3COTA 2AGTA 2X7WA 2WSYA 1SFSA 2ZOXA 1KRMA 1E9ZB 1KXHA 5FL0A 2E9MA 2G3FA 3FOKA 3PRDA 3GNNA 1H63A 3VUPA 2ZUTA 1W91A 3O05A 1LWIA 4S3BA 5AECA 1FA2A 2AMGA 2I17A 3A23A 3WNNA 3F4DA 2ZZ5A 2KZHA 4F0HA 4J40A 5T9CE 3GBDA 3ODKA 3G5EA 4N4QA 3W87A 2HNEA 1HKIA 5FAJA 4D6JA 4H7ZA 4F9JA 2IXVA 2QULA 3PANA 3B9OA 1D7KA 3LI0A 3R2GA 4HSNA 2ZWZA 2QQ6A 3EX1A 5HNRA 4UFHA 2VR4A 4NG3A 4JY8A 3CZJA 5D37A 4S3AA 5T26A 1EQCA 1O1HA 2VZVA 4AD0A 4JNYA 1NDYA 6XIMA 4LAKA 2Y88A 1WBHA 2F8QA 3P80A 4C6DA 2EPMX 3TNOA 3ATZA 3DFNA 4GXMA 3UJFA 3TX9A 2XN0A 3SN4A 1XG3A 1PIIA 3GW3A 2VMFA 4CU7A 4M7SA 1ISXA 3NQBA 1J0JA 2E6DA 3THDA 2RDTA 3TMQA 3GNOA 3IWPA 1T99A 3QQWA 2BS9A 3QV8A 4Y9PA 5BOFA 1UHVA 4MDPA 3KS6A 3WD4A 5DN1A 4O11A 1H0GA 5KINA 3ARPA 3IHZA 4B5VA 3EY6A 1XLIA 2YW4A 3CMGA 1SZFA 3VKDA 1CX9A 1QPOA 2X0HA 1IXPA 2A21A 3KWSA 3UETA 4LYPA 3AHZA 4DBEA 1A5MC 1GOKA 1UUMA 2ODOA 5JIWA 2DSVA 4K1WA 5K4ZA 2WVVA 4DZIA 5K9DA 3M46A 4QCEA 4ZGYA 2JALA 4NF7A 5CC7A 4JFKA 3UI6A 4E5TA 3INPA 3WG6A 3L0KA 4JFJA 4MB5A 2ISDA 3VNYA 2G4FA 1G7UA 3R89A 4H7VA 1SO4A 3O1NA 4NX0A 3ERPA 2ZWYA 2XIBA 1S2CA 4IT6A 3KM8A 4Z1AA 3WNMA 4J4KA 4OGZA 4WDUA 5JVLA 5JH8A 4X9SA 4HMEA 3O5JA 1UUQA 2IF4A 3IANA 2V38A 5FEPA 4Q8NA 4DRSA 1K9EA 3CXOA 3TIMA 1XRVA 1I2NA 3VNIA 4UOQA 2P76A 3LBCA 1LRQA 1DWFM 4HIBA 2QCDA 4U84A 1RH9A 5F2IA 3GG8A 1TJPA 5E9XA 1RD5A 1AW1A 2B31A 3BE7A 1I1WA 2OWCA 5A2BA 3KP0A 3LENA 5AC5A 3UQNA 2R24A 3O6CA 3P5ZA 3ZO9A 1OD8A 4PTNA 1RQBA 4GZIA 2XP5A 3NZRA 3TA9A 4ZB2A 1B5TA 3VINA 4DZAA 1IEIA 4EAMA 6TAAA 3DI0A 4P8XA 5A6BD 3ZLHA 3PRAA 1WXJA 2Z7GA 3FJNA 4CVWA 2ZX5A 3STPA 1E0VA 5KSWA 2DZBA 3ID7A 2GVGA 3P7YA 3BOLA 2CLIA 4P8WA 5PTDA 2VZUA 3W7GA 1NTHA 3JUGA 2BASA 1UH4A 3K30A 4G6CA 4FSAA 5BOEA 2KGJA 4O0QA 5LHEA 3WELA 1TJ2A 1BFNA 4GI8A 4HNNA 4M8UA 3AXIA 1TPC1 3PBMA 3UW6A 3CIVA 4NSBA 3EWZA 4LUTB 4H8UA 1EC8A 4O18A 1J6OA 3QFEA 4CCCA 3TFXA 1DTUA 2PPGA 4B9ZA 4LYRA 5H6HA 3USBA 1V6WA 1I6NA 4GMEA 5EB8A 2PWEA 2J7EA 4TV6A 1OSEA 1B6CA 4ZSUA 3ARRA 3TSMA 3GH4A 1ROUA 2QCLA 4O57A 4L4PA 5KZDA 4D6EA 2BOGX 4YVPA 5J6EA 5TQLA 1FKKA 3SURA 3P82A 5FKYA 3M5ZA 3ENLA 1JCTA 2OT0A 4Q7NA 4HNCA 1W5QA 5I3IA 3KOXA 5GNXA 3APYA 4PUUA 4UFKA 3UWEA 2E25A 1OGSA 1C8VA 3DIPA 2PC8A 2DZVA 2PTDA 1IYXA 1IXQA 1ME8A 5BWFA 1GUVA 1JJKA 2C19A 1EC9A 4IH3A 2I16A 3GU2A 4BZYA 2A3CA 3UQAA 2A7RA 3AS3A 3G1AA 2J27A 1TJRA 4D6DA 1ZJBA 1V3JA 5EFFA 3ARXA 3SRDA 3B0YA 2V8ZA 3WLRA 5JU6A 2QJMA 4JTTA 1JZ5A 1TFVA 3R0DA 4IGHA 3ZSSA 2NSXA 3UP8A 3PFRA 3IGUA 3IUDA 3RCYA 1Y5VA 3VZXA 3DKLA 2XH2A 3S1UA 1V77A 2ZR5A 3EX3A 3ZS4A 2Y89A 4LAXA 3SDOA 3O6YX 4LX4A 1A3WA 1QOQA 1ZY9A 3N34A 2A6LA 3DYOA 1LQ0A 3AXMA 1V3IA 3AZRA 3BLIA 3VU2A 4XD4A 3C8NA 3UXDA 3C0LA 1YDNA 3EDKA 4MWAA 3I68A 5IBXA 3TONA 1JZ6A 1UWUA 3LCFA 3ANUA 4Q8WA 3O5GA 2CLEA 4DO4A 3E0FA 2OYLA 4BS0A 4V27A 4D6HA 3S5ZA 2HCVA 3FAPA 1Y5XA 2E09A 3PJTA 4Q3MA 1WKDA 4XBKA 3TH6A 2OG9A 5BXTA 1E0UA 3GG1A 1R2RA 3L4WA 1HJQA 4LGXA 1CW2A 1UIPA 4IXXA 3TTOA 1XRSA 2EPKX 1K9TA 1DJYA 4W93A 2BMBA 5CC5A 1E6RA 3KDOA 1R8LA 1QNOA 3T8QA 3P0WA 4QLJA 1MXSA 4GQQA 4V1XA 2PP3A 3CBWA 2XGZA 2YXOA 3SJNA 4NKCA 2NW0A 2VFHA 3TQKA 1VCFA 2E6AA 3Q2DA 4C7GA 4FAMA 1CLXA 1GVOA 4DWSB 4KGLA 3DN5A 2GSHA 1E4IA 2HXUA 4GNVA 2Y24A 4P7RA 2FJKA 3SY8A 4JIRA 1UZ4A 4DM2A 2EXOA 1DORA 4G2PA 1GYMA 3CC1A 5B7YA 3PAJA 1MFUA 3OVQA 2XFRA 3VNDA 4ZOCA 4HU8A 4KWUA 3R6IA 1DJWA 1U5VA 3RM8A 3LUTA 5D38A 1P48A 3IK4A 4QG6A 3EA3A 3WQGA 2PD5A 3LU2A 2CLLA 4EF8A 4JIPA 4HZ7A 2FMNA 3PB2A 2SFPA 2YYUA 3GNPA 3URBA 2VEGA 1LP6A 1N8WA 1YDOA 4WZHA 2OXNA 3OVPA 3ARSA 3FJ4A 1JPIA 4C6FA 3WJWA 3H70A 3ITCA 2PGFA 2XFFA 4HN4A 2CIPA 2FB2A 3VNZA 3TTYA 2KR7A 4M0XA 3VK5A 5HUAA 4OV4A 5BOOA 4MTVA 3W7QA 3UJRA 3MC5A 4OBRA 1AA1B 1W8GA 3VM7A 2FH6A 3H7VA 3WFLA 3RR1A 3Q58A 1H7OA 3KWXA 4XZ9A 4Z0JA 4ZPWR 3VMNA 5HUOA 6ENLA 5JBFA 1I60A 3WLSA 3TV8A 1HXVA 3IRSA 3KVMA 3GH5A 5J5DA 1TWSA 1A5KC 2V5CA 1XX1A 3KRBA 3L4VA 1JCNA 1TX2A 2IMRA 2DJXA 3H55A 2X16A 1XUZA 3URAA 4DHGA 4MNMA 3ZR5A 1CXKA 3NA8A 1WZLA 1F05A 5FJOA 2F6KA 3WSUA 5TIMA 2QF8A 2A0NA 2PWVA 2ZQUA 5BROA 2QJHA 3W38A 4QSHA 1YE6A 3CGNA 1ITUA 1PWMA 1B3XA 4KPLA 5CH9A 4HZ6A 3W85A 4DZHA 1HG3A 1U5HA 1VFUA 2VZTA 2QPUA 3I10A 4LVFA 3R8RA 4U85A 1W1A1 4GJ1A 3NTPA 3PNUA 2GFTA 1UR8A 2ZZ6A 1C93A 1E1CA 3HURA 4ROPA 5A3HA 1H09A 4A2SA 2P3EA 5TF0A 3GXPA 4U2YA 1XH1A 3OO2A 2INZA 2O7QA 1M7XA 2YL6A 4IPIA 4WDWA 3CYVA 4LEFA 4REQB 3UYIA 4DROA 4O15A 4QIUA 2FGBA 4ODQA 2WPGA 3NAVA 3EIPA 1GEQA 3HZ3A 2B7NA 4RL3A 1ZP4A 4XUGA 3NVTA 1W9VA 2VKZG 2HROA 1VBHA 4AD2A 5LNRA 3BZGA 4M3PA 1VGAA 1IE7C 3Q67A 1Z32X 4H00A 1OINA 3UBPC 3WLTA 4NX5A 3ZLGA 4U4MA 4XAGA 4D8LA 1Q6LA 4KFPA 4X2RA 1X1ZA 2G3MA 3SCVA 4O8AA 1YDVA 1OBAA 4CNPA 4HN8A 4GWEA 2ESCA 5E93A 3HBLA 3VIGA 4B3LA 1V6UA 1YE4A 3E12A 4U31A 3NIYA 5I3JA 2QF7A 1Y5WA 3L4ZA 3QPEA 1JYVA 1M68A 4JYDA 3NZ1A 3ARVA 3SSJA 1UWIA 2Y7DA 3FSTA 3T2QA 3WDIA 4DXKA 1RCXB 4BWLC 3K8LA 4YU1A 4GIRA 4RUBA 4J2MA 2BHZA 4E8CA 3GU0A 1SR0A 7ENLA 1ADDA 4P7NA 3EWUA 1M9HA 2RURA 2C79A 3UF9A 3VI2A 3OEXA 2ZXDA 3EEGA 3VKJA 1OADA 1RR2A 1W3JA 4GNJA 5TAOA 3A9BA 4AY1A 1AJ2A 3MKCA 1BGGA 2PSNA 2X1RA 4EKJA 3VE9A 5IDIA 5F1UA 4HOZA 5C54A 3IJ9A 1C9HA 2UY3A 4AYSA 1H1NA 3ZT5A 4L6OA 5AYZA 5H91A 2JF7A 5C9UA 3DX5A 2HNHA 5DLCA 3SBFA 2OQYA 3NO3A 4L65A 4GA8A 2HRWA 3DC0A 4US6A 5GPRA 5C9RA 5GNZA 3SN0A 4K7VA 3WH8A 3TYAA 1P0EA 2WBGA 4ZPTR 1UZDA 4XVDA 1W0MA 4DJEA 1EYMA 4ZVJA 1C7SA 1RP9A 1F6KA 2A7NA 4MDOA 1HJXA 4LCQA 4MJMA 1NSJA 1OD0A 3W9ZA 3WNKA 2TRSA 5D30A 1F8IA 2DZXA 2C18A 3V5CA 3OBEA 2DSUA 1MZHA 1W9PA 1UD2A 5FJPA 1EQPA 1SGJA 4JEJA 3H2NA 4CCDA 1J5SA 4EVZA 2PTXA 2D0GA 1E44A 1KO0A 4YWIA 4F79A 4GJJA 4KF1A 4UOJA 2R6OA 4WJ8A 2JEQA 1GTHA 1DQWA 1KXQA 4Z2LA 3QYQA 3PTMA 2J74A 4HPXA 5ECVA 2D23A 3QXBA 3VOCA 5HT1A 4ATWA 3AISA 2VVNA 3CUXA 1H7WA 4K3ZA 3DCPA 3QV6A 3TW6A 4H8VA 1QBAA 2ATSA 3TCSA 3VNKA 5AVNA 1TV8A 4PMOA 4EPKA 3N73A 3OODA 1EWEA 4IQCA 1I1XA 4BFAA 1NH6A 2M1IA 2DFAA 3A5FA 3SCTA 2VCDA 2A7PA 2EG8A 2YB1A 4GX9A 3BOFA 3GNXA 4JTGA 2MLYA 3CQIA 1XLLA 2ZRWA 1OFPA 1Q6QA 3U3HA 2ZCGA 4W9PA 3LCXA 3EMCA 5HK4A 2QJNA 3HQ1A 1Z69A 4N2YA 3WLPA 3O3RA 1DTNA 3G1DA 4MB1A 1CWYA 1XQKA 4O54A 4MAVA 4PL1A 1D2KA 1LLOA 2NLYA 1AJZA 4LBUA 4J5NA 2FLIA 1ZAJA 2WXDM 3B8IA 2CEQA 2Z00A 2R1KA 3LUOA 2JF6A 4GY1A 4S1FA 1QDSA 3FHQA 3KBJA 1H61A 1RSCA 2PDCA 1OC5A 1QHPA 4L4MA 1LT7A 3DXIA 2DUXA 4J3ZA 1J4HA 4F2TA 2R94A 4UTWC 1OIMA 5DIVA 2CLOA 4J3SA 4S3KA 2CZFA 1NDWA 1JUKA 4JQ3A 3ECQA 1BSLA 4E4FA 4K8GA 1ZAIA 4ZOEA 4XZMX 4D71A 1TREA 3W86A 1O5RA 3A24A 2XUCA 4I9AA 1D6OA 3AUJA 4JDBA 3S5SA 4XTDA 4GGQA 5EMYA 2CLFA 5EBAA 2VEMA 4BCEA 1W26A 3MMWA 4IFKA 2QYGA 3BK0A 4HQVA 4JN8A 1TV3A 3MHFA 1V3MA 2Y8KA 2QCFA 1XQLA 2HV5A 3R58A 4K68A 1D7FA 4HKPA 2EPOA 1IIGA 3IKDA 2PTYA 5A8PA 2ZKMX 3U5UA 3WLLA 4ROQA 1E1FA 4P7QA 3UJ2A 3DECA 1VBUA 3IAQA 1XH2A 4NZ1A 1WQ5A 4RE0A 1PPIA 2PDHA 3F4NA 4C6JA 3WBYA 1JF6A 4H8HA 3MUAA 1CI1A 4DY1A 4OQVA 4GH3A 3HG2A 1GK8A 2F2KA 3MVIA 2I7GA 3C0QA 2G8ZA 3MUIA 3L9CA 1VENA 1YKWA 4IJCA 4UB9A 1ZBKA 1GVSA 2D2GA 3HTWA 4ERGA 3RNDA 1GQNA 4A3UA 1UWSA 4UTUA 3FYYA 5A69A 3C5QA 2VWSA 4Z2KA 2OWWA 1Z6KA 5FEWA 5XIMA 1XFBA 3IGHX 3PP7A 3LNPA 1QPKA 1QVBA 3QC0A 3UQIA 4PMVA 3SUVA 3W2JA 2GSEA 1B54A 4QX4A 1T0OA 1A4LA 1FWIC 1UPPA 2GJLA 3RPMA 3CQ0A 3D47A 3IJ8A 4PMUA 3B8SA 2M08A 2YW3A 1YEYA 4DRPA 5CZKA 3GUGA 1CEOA 1IWBA 2P8BA 2OYKA 2X42A 1ZK6A 1PBKA 1K77A 1F61A 1YADA 1NELA 3ARZA 2PF0A 2I9EA 1XIJA 3TEVA 1O4UA 1VFLA 3WYZA 3ZLFA 3TU9A 1OZMA 1CPUA 4GQBA 5LXXA 4GO8A 4QG8A 1GPFA 3UG5A 4I3GA 2Z1XA 2X0SA 4XIMA 3N2TA 1PKMA 3BAIA 2KE0A 1FKWA 5T8GA 3W7KA 1ZCNA 1UD8A 3MO4A 4O14A 3W1TA 1XRFA 3LPOA 3BJTA 4IPNB 2EPNA 2ISFA 3AHTA 5DCEA 2PWFA 3SSZA 3R79A 1EYEA 3FEQA 2Q6ZA 2W61A 3FK4A 2AAAA 3VDBA 2DZPA 1WZAA 2DORA 1VFFA 2P5NA 4GC3A 1WKFA 4PB3A 4IHCA 3THCA 4UTFA 1QK2A 1Z41A 2ZUNA 5A6JA 2DVUA 1FCUA 1P0KA 3PUGA 3CTTA 1Z9AA 2PWUA 2OT1A 1M7JA 3N2MA 3WQ8A 7CGTA 1TMLA 2F2DA 5BMXA 1SM9A 2EHHA 2OLAA 5LIKX 1D3GA 4AD1A 2Y5SA 1H41A 1UG6A 2NQLA 1OABA 4WKFA 4RDVA 2W63A 1A4MA 3WBWA 3UWWA 1V6XA 2DPEA 1X39A 2C16A 3KXQA 1FKJA 3AU2A 1TPVA 2P88A 3V1PA 1TA3A 4ZL1A 2DT1A 4Q4PA 2D2HA 3QM3A 1JAEA 4JFSA 3B97A 1U1JA 2CITA 4L1GA 1DWAM 2VD9A 3QHOA 1VB9A 1FKIA 5HWCA 1JCLA 1RVGA 1V3HA 5IHRA 3M1ZA 1FDJA 1J79A 3WH6A 2WM1A 1RALA 5G4EA 2RUCA 2E0PA 4DEFA 1R6WA 3DH7A 3GR8A 1HUVA 4O4WA 1R3YA 4DN1A 4ZZ9A 2CXGA 5C9WA 4AZCA 4CNOA 4YJ5A 3V75A 1W1PA 2DUAA 4IT1A 4QG9A 1JCXA 1KQYA 3WN6A 1JZ4A 1XIGA 1NWTA 2YIHA 1F07A 4QFUA 4NZ3A 4J27A 3O0KA 3LMYA 4TTGA 1US2A 4YMZA 4B2DD 3T0BA 2PGRA 2J7GA 2WMIA 2EPLX 4GUGA 3QOKA 3P14A 2IKHA 1SFJA 4GY0A 3TW9A 2ALDA 3BAKA 1MUMA 3QR3A 4LUSB 3JZUA 4EE9A 1QW8A 7A3HA 2DV0A 3GAYA 2Y4SA 2WQPA 4O1AA 1TPWA 1IWAA 4IQEA 1GONA 2MLZA 2J8GA 1F74A 3MSGA 3VC6A 3EA1A 4UQDA 3GVGA 1QI0A 3AHYA 1MWOA 2KO7A 1B3OA 1E4NA 4U2ZA 3UCCA 5CJ5A 2B81A 4LJ3A 4ZO6A 2VVSA 3A13A 3OQEA 4LS2A 2ZRXA 4DQWA 4FMVA 4UMCA 1U1HA 2VYOA 3UU0A 1WA3A 4HHLA 1V0KA 4HNUA 3W6YA 1QPLA 2NV9A 2QDDA 4LAVA 1R9XA 3LGEA 1PB0A 4DZ3A 5FJJA 1E3XA 4XD6A 5D2VA 3KTXA 3ZOAA 1CGYA 3RGCA 3L4TA 1ISVA 1MVYA 1Q6FA 3HGSA 3MMUA 4A35A 1GZJA 2WK2A 3H4XA 1PAMA 3QC3A 3KLKA 3Q4DA 4B5XA 4UXDA 1S38A 4QE5A 1K4HA 1Q6OA 3FVMA 1TX0A 2P3ZA 4EACA 4N0RA 4PMJA 1OYBA 4QHRA 1M04A 1V02E 4TVDA 3F2DA 1B2YA 5DBTA 1QCWA 1P1MA 3QZEA 2JKEA 1KFLA 2VC7A 3CHVA 1A80A 1L6YA 3LI1A 3KBSA 3EDJA 5DO2A 1XDLA 3B3DA 3B40A 3WQDA 5I24A 1RPKA 5D75A 3C6CA 4J28A 1VRDA 4F3HA 4JIEA 1QATA 2PGWA 3VOFA 2XTKA 2BY1A 2HS8A 3NO1A 2XP6A 3S42A 4GYJA 4M29A 1SW7A 1XISA 4L1XA 2OGYA 3WF4A 3O5QA 3UWUA 1K9DA 1VFOA 5D9OA 2ACUA 1YRRA 1X7IA 4ZB5A 1OG0A 5A8QA 3EKGA 3U0HA 3S83A 1TPB1 4F40A 3I7SA 2Y62A 3H2MA 2OTDA 4FOKA 4NASA 1DJNA 2YYTA 3RILA 1XIDA 2W0UA 1FP9A 1PKLA 1KR1A 4AVNA 1BVNP 2IS7A 4NZJA 2QDHA 3G3MA 5E9AA 4RJEA 2V69A 2YDQA 3E2VA 3C2OA 2OZTA 1UH3A 3B9EA 4QP0A 1Q6EA 2F6UA 1U79A 3ARTA 2QCNA 2GVJA 4RDWA 4O1FA 3VIPA 4MKNA 4RLIA 1E6XM 3KCOA 2E8ZA 5CZTA 5KETA 1RQHA 1HO1A 1MXDA 2BXVA 1HTIA 1TUFA 1S1RA 1CB2A 3N9KA 3R1ZA 3I4EA 3H9RB 4CNUA 1G4EA 1YPXA 1FBAA 3MP3A 1W3HA 2QV4A 1ONEA 2BY0A 4EPDC 2Y7EA 3TN5A 3KADA 1JYWA 4YWSA 3MTWA 3VX0A 1EUNA 2ASHA 3OGRA 1HKJA 1DE6A 3TA6A 4HNVA 4NZCA 3AWNA 1X8CA 5CPQA 2JZVA 3C8FA 1ZNNA 2AQOA 5K9XA 4D1JA 3NQFA 3EOSA 1O12A 3PUOA 2GGEA 3E74A 1B90A 1GGOA 1EF3A 1OCQA 2DU2A 4O0KA 3TLLA 4ZA0A 4CU6A 4A2RA 4BI7A 1XSJA 4Z42C 3W1LA 4GY7A 2EAWA 4DX3A 1V6TA 1R3TA 2Z29A 2G96A 1M7OA 2FPVA 3SJ3A 1G1YA 2I57A 3GRIA 3SAZA 2XYLA 4OV9A 4I7UA 1O5KA 4KEZA 2PCQA 2XJ7A 4JKLA 1OY0A 1LF1A 4I6VA 3L2LA 1TMQA 4ZPVR 2CPUA 1DIOA 2ZR6A 1IHIA 3C3NA 4UTIA 3ZIZA 3OW1A 2Z4GA 4WY0B 1E9LA 2XH7A 3RF9A 2EF9A 1BYCA 1A5OC 4LF2A 1X7FA 1GQKA 4KFNA 4X9YA 3WMCA 1EF2A 4BEQA 1BKHA 5E09A 1EIBA 3PC0A 3ANVA 3O07A 5I02A 4KQZA 5DCBA 2WSQA 1TO3A 2X05A 2YLLA 2CWXA 3FEMA 3TVAA 1L9WA 1UKPA 2J25A 4UNKA 2XPAA 3EX6A 1P0NA 2WKGA 1LWJA 4O1BA 2J66A 4AMCA 3TJXA 3BMWA 4RNJA 1REQA 3KBVA 1TMHA 4GC4A 3AMDA 4JCLA 1K70A 1NMWA 1JZ3A 4DZ5A 1H7RA 5LNWA 2C1IA 4H2HA 5AVHA 2GJPA 3FGCB 2Z27A 4KESA 2NQJA 3L12A 1X98A 4FO4A 3W29A 3EYPA 5C7HA 3CUJA 1LTDA 1EKOA 1J0ZA 3UI5A 2VUNA 4NUWA 3REQB 1AH4A 1KKRA 1KCXA 2C14A 3EWXA 3R5EA 3WQVA 2XM1A 4A3YA 4AU0A 4AY8A 2J7DA 4YYCA 1PDZA 4Y9OA 1V4YA 3P3BA 4ORIA 2QW5A 4DO6A 4ILSA 4AVFA 2JGQA 1WDRA 4DO5A 3WEZA 3NQ8A 1TKKA 1MNSA 5D8ZA 3S1WA 1KCZA 2ZDSA 3HGJA 1ITQA 3CL8A 1CZ1A 5KEZA 1RY8A 1LQ2A 3QY8A 4XAFA 3MYPA 3SUUA 4HZMA 3N15A 1SU5A 1ZQ5A 3HPFA 1MW2A 1TPDA 2ZUUA 3LEPA 5U7SA 4AISA 2PV1A 1FWWA 4GYKA 3AQUA 4MWAD 1GTEA 3ITXA 1BWLA 1LUCA 4NY2A 4PZVA 5CSYA 3H4WA 3T4CA 4UTLA 2OSWA 4GK8A 4B15A 3VMPA 1F8AB 3NQCA 4H2CA 4YTUA 3TE9A 3WLIA 3WKZA 3BPWA 4GE8A 4HPHA 5ECUA 3OTRA 5HOSA 3FW6A 2OQHA 4IPJA 2O9TA 3E3HA 1GVIA 1ME9A 4FX6M 1NF7A 5HW7A 4HB7A 4F8XA 5KZ6A 2XINA 4JYEA 2D20A 4K7YA 1XC6A 5F2MA 3LTYA 3AYRA 2HQAA 3ARWA 2YXGA 4ZE5A 3FHAA 4PEEA 3CHEA 2YA1A 2QAPA 5LIUX 1UP2A 3U7VA 2OB3A 4FR6A 2E5CA 4GKLA 1KD0A 4V2XA 2KX9A 4AC7C 3SGGA 2ZQSA 2HXTA 3LGDA 1A0EA 4YHEA 3W25A 1AG1O 3AHXA 3WBAA 4H7CA 1GHRA 2ZUWA 2YDSA 1R30A 4JTRA 1YTKA 4ORMA 4LUYA 1RLDA 3NM3A 3CPUA 4JFWA 5D02A 1PSCA 2FZDA 2OPJA 1OX4B 1R3VA 3EWYA 3WBEA 3I6TA 2G37A 2QNEA 1C8YA 4UQAA 4PMZA 3LLFA 5I3GA 4F0RA 4F0SA 1EP1A 3H22A 1BRLA 1KFEA 3RDKA 1J6YA 2XWDA 3M0LA 4I90A 4ML9A 2M2AA 3ZVIA 2DSZA 5CSUA 4MPKA 3U5YA 1EGVA 3CEUA 1OFDA 5CC3A 4Q32A 3K46A 3SRKA 1E0WA 3U57A 1EJUC 4TUFA 3C2YA 2WLYA 3UCDA 1YNPA 2Q09A 3PTQA 1HQTA 5REQA 3WH9A 4HMDA 3CK5A 2BVWA 5AZ1A 3T4WA 3F5KA 4NP7A 4X0NA 3TUUA 3P8IA 4B5TA 1P7TB 4O0ZA 4FXSA 4GD0A 1TIWA 2VL4A 1SJDA 1EPVA 4MHBA 3UR7A 4AFYA 3SGUA 1RV8A 1L6WA 2D2JA 1W8SA 2IKIA 3MSDA 4LTSA 2HTMA 3F5JA 3RLUA 3W07A 1OK4A 1XUUA 2R1LA 3P81A 1GVQA 3M7SA 4RCXA 2INFA 1Q6RA 4RNHA 5CPOA 1KW1A 4PBGA 1G9HA 3QGAC 1Q7ZA 4GIEA 4DRHA 2HE8A 3APTA 4OUEA 3OLDA 4C7DA 4MUZA 3UJEA 2GL5A 1TTJA 1VPXA 4S3FA 1ZU8A 1FCQA 4I5RA 3R43A 1VYSX 1UWQA 4TNSA 4GACA 3WMSA 3GFXA 3CZEA 4NAEB 1VCVA 4CNNA 5AFDA 3IJ6A 3W7NA 1TE1A 4QR6A 1LOSA 4W87A 1VFMA 2VTFA 5CG0A 3KRZA 4PSRA 4FPSA 1POJA 4HCLA 1PV8A 2CETA 1VPYA 4PMRA 2J13A 4GG9A 1KFJA 4UTTC 2QEZA 3RYSA 3HF3A 1LBLA 4HA3A 4FS9A 1R5YA 4XAKA 1LG2A 3GTFA 5M5DA 4GJIA 4ZENA 1GEHA 4MKSA 4OBTA 1K7FA 3CH9A 2BVTA 1GW1A 1B9ZA 1R2TA 4ZQPA 3TCEA 3UXKA 4R85A 1NFGA 4V1YA 4QTGA 4QXIA 3O5FA 2I5GA 3MQTA 1JNSA 3N9RA 1F3EA 4L5ZA 3MI2A 1IIHA 3MT1A 2OOGA 2QCCA 1UR9A 5I3FA 3BG9A 4W9TA 4HZ8A 3AO0A 1JUEA 4FLQA 1P43A 1TWWA 3I6RA 3MU7A 3IIOA 2H8ZA 2VCAA 5HPCA 1A53A 2PDMA 3STCA 2I56A 4A4AA 4E0CA 4AC1X 1TPEA 1IZJA 1ADOA 3W81A 2PRLA 4TX8A 3FX4A 4AX6A 4L72B 2OSXA 4RZ5A 3U6WA 2DUZA 3NQ2A 5E70A 1HIZA 5AOUA 1GOWA 2CZVA 3WQ5A 3AXKA 2VJXA 3CUGA 5A8MA 3VDHA 1AZ1A 3TZNA 1EC7A 3CT2A 4JZ5A 3WFAA 3UJSA 3TAKA 5I77A 1TUXA 2OELA 3QV9A 4KBXA 1WX0A 3KL0A 2NUWA 4O1EA 4IGMA 3SCPA 4ODLA 5CGMA 3PBGA 2A1YA 1N55A 2CLMA 3H8AA 4JNMA 3W1NA 1B3WA 4C6LA 2XVPA 3O5OA 2HVOA 5HA7A 3GB6A 2L2SA 1Y0EA 3CB3A 2ZA3A 3VNMA 2VX4A 4LS0A 4PUKA 3QGKC 2WPBA 4CCZA 5JH2A 5A6AA 5FF7A 1MEIA 4YTSA 2MNTA 4S3GA 2WVVB 3SCQA 4C1LA 1KKOA 2VFIA 1YDYA 2PDGA 3GAKA 1DIEA 4IX2A 3GNRA 5LXEA 1JRCA 2XWEA 5F4WA 4ODMA 4BQ5A 1YXYA 4C6PA 1M03A 3GDTA 3DFSA 1GVEA 5D03A 1SZEA 4YVVA 3RN6A 3PY2A 3W7CA 1EHNA 3O5RA 1KR0A 2VOMA 3RGTA 3OIXA 2QCDB 3TC5A 1I2QA 1VKFA 4RNFA 4TO8A 5CPSA 2VGBA 3G1SA 2UY2A 2V81A 4MUPA 3CZ8A 3ITYA 2Z1VA 2EQDA 4Q6XA 3T2PA 3B05A 4E6MA 4D8ZA 1XYBA 4XZLX 4J3VA 5DO8A 2MLXA 5B80A 1KTCA 4JR5A 1J8VA 3QMTA 3BCFA 4FNTA 1IEVA 4DRMA 1UROA 1GQJA 3W1UA 1QW9A 4V28A 4JIQA 1UWRA 2YDRA 1KRCC 3FIGA 4Q4OA 2WO5A 3EB4A 3V3WA 1ADSA 3T05A 2K8IA 2BSLA 2A3AA 1J11A 2V5JA 4PUEA 3W88A 3RX3A 2HBXA 1Y0OA 3B0PA 1UR3M 1S39A 2REQA 2W5FA 3FYOA 4OZOA 5K7JA 2QUMA 2PEVA 2CNCA 3IACA 3LM7A 2BXZA 4KQNA 2QZRA 1PDYA 4B5NA 6XIAA 4JFIA 3ZJ7A 4EIVA 3IJIA 3KFTA 3ZXWA 3UG3A 3WBXA 4A3HA 5I79A 1O5QA 3QTPA 4N9EA 3TR2A 3LY0A 5H8MA 5CXPA 1C9WA 1Q65A 3I7RA 2GJRA 1QPFA 1OFAA 3W26A 4HA4A 4LRTA 3SRHA 3AIEA 2J75A 1DHPA 3C4UA 3VE7A 3MJYA 4EX4A 3I65A 1JYNA 1HN1A 1I75A 3WJZA 3GE7A 4IICA 1HP5A 2CZ5A 4D6CA 4W88A 3KOFA 3NPUA 3C2RA 5B7ZA 4WHBA 2XIJA 4XAYA 4JDYA 3R0KA 1JUBA 4R27A 1T8XA 2ISVA 3PZIA 2NQHA 3HQNA 3SY5A 3GYCA 3UZ5A 4DJDC 1UKQA 1UP0A 4TVUA 4X63A 4A6GA 1ELSA 2RDWA 1WAWA 1PTGA 1KBKA