3G71F

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g71F00
2I6DA 4TZZA 3JAMM 2QA4F 1YJWF 1QVFF 1Q7YH 1K8AH 3NMUC 5DCVA 1PXWA 2JNBA 1W3EX 3GYQA 1VQMF 2VGMA 1KD1H 5FLXM 1T0KB 3CPWF 1K73H 1YJNF 5EWRA 1Q81H 3LWPC 3CC4F 5FJ4C 2KTVA 3LWOC 3AGKA 3ON1A 2OHWA 3CCRF 3V7QA 3CCVF 3CCMF 2KG4A 3FFMA 3G6EF 2VGNA 2OTJF 3VMFB 3MCAB 3CCLF 2HVYD 3CMEF 3CCSF 1VQPF 3J80M 4LCKA 5G4VC 3CCUF 1W40A 1NMUB 3CMAF 1W2BF 1IPAA 1W42A 3N4YA 4X3MA 4BW0B 3CCEF 1YJ9F 2OZBA 1ZWZA 3LWQC 3G4SF 2FC3A 3IR9A 1E7KA 3E1YA 1X52A 1NJIH 5GINC 1KC8H 3LWVC 1X7OA 1XBIA 3N4ZA 3RA5A 5GIOC 1VQOF 3CCJF 3CCQF 2BO1A 1JJ2F 1YIJF 3J7AR 3OW2F 3PLAC 1X7PA 1YHQF 1CN7A 3HJWC 1RLGA 3JCMM 3LFOA 5IT9M 3CPQA 1H7MA 2KTUA 5GIPC 1KQSF 3NVKE 1VQ9F 3CG6A 2LBXA 2WALA 5GAPK 3RA6A 3NVIB 2QEXF 3CC2F 5EO3A 1N8RH 2ALEA 1GO1A 3J81M 1W41A 1VQ6F 1Q82H 1Q86H 3SIUA 2CZWA 3NK7A 3CC7F 1VQNF 1GO0A 3E20B 3OBYA 5A2QM 4NUTA 3LWRC 1DT9A 2OTLF 1VQ8F 3HAXD 4X3LA 3I56F 1M1KH 3CD6F 1YI2F 1S72F 1VQ4F 1QVGF 1VQ5F 4BY9D 4C4WC 1VQKF 1K9MH 1YITF 5GANK 3CXCF 1GZ0A 1M90H 1SDSA 3I55F 3VI6A 2AIFA 3V7EA 3SIVA 1VQ7F 1RA4A 1CK2A 1VQLF 2QI2A 3OBWA 3G71F 3WXMB 2LBWA 5G4UC 3O85A 3PAFA 3NK6A
chains in the Genus database with same CATH superfamily
1Q7YH 1K8AH 3NMUC 5JCOA 4WBNB 4G4VA 1KD1H 2AIZP 1IV1A 3T80A 5ITZA 2IQQA 3JATB 4BT5A 4TV8A 1K73H 2GVIA 5AVMA 1YJNF 5EWRA 4ZOLA 3S06A 1JD1A 3JALB 4NWOB 4M8IA 5JVDB 3CCRF 1JFFB 4G4XA 2KG4A 4WBNA 3FFMA 3G6EF 2LCAA 2P6YA 3P10A 3VMFB 4O4LA 3JATA 1PF5A 4LCKA 3ERNA 5HY4A 4EI9A 1NMUB 3KJKA 3FBAA 1JFFA 1XRGA 2I6RA 1IPAA 3N4YA 4X3MA 3CCEF 4X1IB 3WGLA 3F0DA 3LWQC 3G4SF 1E7KA 3E1YA 3LMEA 3ZP7A 4B62A 5LYJA 3IEWA 1KC8H 1RQ2A 1X7OA 4I4TB 3N4ZA 3RA5A 3JARB 5LXTA 2UYPA 5EYPB 3I7TA 4B5CA 3VYUC 1TUBB 5IYZA 2BO1A 2H6LA 3J7AR 1CN7A 5FNVB 5CA0B 3HJWC 1FSZA 5CA1A 5HWEA 2HRUA 3IEQA 2K1SA 3RYHA 1H7MA 3S0YA 5CB4A 3OONA 4IIJB 1VQ9F 1T0AA 3NVIB 2VAMA 2BTUA 1X25A 5FNVA 5CA0A 3E22B 3HKCA 3JAWB 3CC2F 4DRXA 1OFUA 2QTPA 1W5BA 4X1KB 3S03A 1XHOA 3RYCB 1Q86H 3SIUA 2ZAUA 3S02A 1VQNF 2YYEA 1GO0A 3LWRC 4BVQA 4O4HA 5LOVA 3CD6F 1IV3A 3ESJA 1QVGF 3M1XA 4C4WC 3JAWA 1M90H 3ZO8A 2H8EA 1KNKA 3KHNA 3V7EA 3SIVA 3RYFB 3MQWA 1RA4A 1VHAA 2QI2A 4O2AB 2UYNB 3C9SA 3OBWA 3Q8HA 4O2BB 5LP6C 4G4YA 4I55B 4HNAB 1JN1A 1XV2A 3PAFA 2I6DA 4TV9A 1FFXB 3MDOA 4EB6B 3K12A 2QA4F 4C8GA 2OTMA 2JNBA 1W3EX 2VAWA 3IMPA 3RYFA 3TD4A 5KMGB 5FLXM 3CPWF 4ZHWA 4TUYB 4HNAA 5B8FA 3CC4F 5FJ4C 3LWOC 1FFXA 3HKBA 3F0EA 4ZK7A 4ZI7A 4C8EA 3FD6A 3V7QA 1U3PA 2KGWA 1U43A 3GHZA 2VGNA 4C8IA 2OTJF 3D01A 4EI7A 1W5EA 2CHTA 3TD5A 3VTIC 3VYSC 3CMEF 3J80M 5IJ9B 3CCUF 5HP7A 2HS4A 4YJ3B 5C8YB 4BT6A 1YJ9F 2OZBA 3WGJA 3HKDB 5LP6A 2F9ZC 4IHJB 3UT5B 3S0HA 2G9IA 5KX5B 1XBIA 1CLIA 5GIOC 4PWTA 1VQOF 3RE3A 1IV4A 4EI8A 4YJ3A 2CVLA 4C82A 3MCQA 5IJ0B 3CCQF 2RB9A 1YIJF 3OW2F 1X7PA 3D00A 2N48A 1J7HA 2DT4A 5EB0A 3JALA 3JCMM 3LFOA 4DXDA 5IT9M 3CPQA 4NQ3A 2KTUA 5JVDA 5GIPC 3R0PA 3FD5A 1VQVA 2NMUA 3V4DA 5EZYB 1H47A 3CG6A 2RHLA 2ZVYA 2LBTA 5EIBD 2RHHA 2Z1UA 3B6NA 4O4JB 1YQNA 3JASB 3J81M 3KJJA 2CZWA 1COMA 3E20B 5HP8A 4X1IA 1SA0B 3N2GB 4NUTA 1DT9A 2OTLF 2GLZA 1VQ8F 2CSLA 3C9TA 3LYBA 5LA6B 1W55A 3JVHA 1TVKB 2R751 3MBMA 4C81A 1YI2F 1VQ5F 4I4TA 4O4JA 2HS0A 3VYTC 1R1MA 2GZLA 3FPIA 1GZ0A 3JARA 3CXCF 1YITF 5EYPA 4G88A 1TUBA 5HY2A 3WPXA 1CK2A 3K14A 1SA0A 2V9YA 5JH7B 3G71F 3WXMB 2HX0A 3O85A 2HP0B 3VOBA 1GX1A 1W5FA 2Z1FA 2WALA 3TD3A 5GONB 3JAMM 2H8CA 4IIJA 2CHSA 1QU9A 3GYQA 1VQMF 5BMVB 1ONIA 5HXUA 1QAHA 3E22A 5J2TB 4BT3A 3N2KB 4X1KA 3P4EA 5HXZA 2R6R1 3RYCA 5GONA 2DYYA 4ZHQB 3HKEB 5JQGB 4BT7A 3QUWA 4BT4A 2IG8A 3VIUA 3MCAB 2HVYD 3CCSF 3WGKA 3CB2A 3P0ZA 3RYIB 1VQPF 5G4VC 3D54A 4KWEA 3K2XA 1W40A 3CMAF 3DDNA 3C9UA 4XCQA 1W2BF 4O2AA 1W42A 3WGNA 2UYNA 5JQGA 4I50B 4X20B 1RQ7A 4O2BA 1ZWZA 2FC3A 3IR9A 1UFYA 1X52A 4I55A 2ZVZA 3BYQA 4ZHYB 4EB6A 3CCJF 2Q1YA 3VOAA 5HY0A 5KMGA 2MQEA 5EAZA 1JJ2F 4X20A 1RLGA 4TUYA 2UZHA 1H48A 4BT2A 1U40A 4YJ2B 3CYPB 1KQSF 3NVKE 1NQ3A 2BTQB 3ZP4A 2LBXA 1YGYA 4B45A 5GAPK 3RA6A 3QHDA 2QEXF 4LNUB 5IJ9A 1N8RH 2CW4A 5C8YA 1U3LA 1W41A 4YJ2A 1VQ6F 1Q82H 1W59A 3NK7A 3CC7F 5MN5A 3OBYA 3HKDA 2VAPA 3JAKB 4X1YB 4BVSA 3I56F 3F0GA 4IHJA 3UT5A 1M1KH 4O4LB 5KX5A 4LNUA 1K9MH 5GANK 1VK3A 3KE1A 2HP3A 3I55F 3VI6A 5IJ0A 1VQ7F 4R40B 3JAKA 2LBWA 4X1YA 5G4UC 3LDTA 4RQOA 2VXYA 3C8LA 5LYJB 3NK6A 3I3FA 1Q8RA 4TZZA 1YJWF 3WPWA 5LXTB 1QVFF 5EZYA 3KIZA 3WJQA 5DCVA 5J2UB 2RHOA 3V3TA 1PXWA 5IYZB 2Q1XA 2VGMA 4BVTA 3CYQA 2HQSC 1T0KB 3IKEA 5EIBC 5CA1B 1Q81H 3JASA 2IAFA 3LWPC 4O4IB 2KTVA 3AGKA 3ON1A 3RYHB 2OHWA 4U3JB 2L26A 2YXZA 5EB1B 5CB4B 2W8BC 3CCVF 3N2GA 5J2UA 5MN6A 3CCMF 1UI9A 1FNJA 5LA6A 3F6MA 2Z01A 1TVKA 3IKFA 3CCLF 3WJPA 1ODEA 3HKCB 4O4IA 4DRXB 4U39A 3WGMA 3M84A 5HY1A 2UYKA 4U3JA 1OAPA 1DBFA 2Z1EA 5JH7A 4BW0B 1Z5VA 2HP0A 1NJIH 4O4HB 5GINC 3DC2A 3QTYA 5LOVB 3LWVC 4G4ZA 1KNJA 3VCZA 3HWUA 3S0WA 5BMVA 3PLAC 1RLUA 1YHQF 3GTZA 5J2TA 2EWCA 3L7QA 3N2KA 2FGYA 3F0FA 2ZODA 4TV9B 4ZHQA 3HKEA 2PMPA 2AMTA 2UYJA 5JCOC 3VO8A 4ERHA 3M4SA 2PHNA 3ZOPA 3RYIA 1W57A 1QD9A 4FFBB 5EO3A 3HTNA 4F6RB 2ALEA 2B33A 1GO1A 4RHAA 2HRYA 3HKBB 4E6EA 4ZI7B 5A2QM 4I50A 3ELCA 1W581 3HAXD 4X3LA 4B46A 3WJRA 1VH8A 1S72F 1IV2A 1VQ4F 3EORA 4BY9D 4FFBA 2Z1TA 2ZOVA 1VQKF 1FNKA 1SDSA 3K0TA 4F6RA 5MN4A 2ZF8A 2BTOA 3C9RA 2HS3A 1SZQA 1W5AA 2AIFA 2CWJA 4G4WA 3U0OA 4ZHVA 1VQLF 5ITZB 5LP6B 4BVRA 4TV8B 1Z5WA 4ZOLB 2RHJA 1JY8A
chains in the Genus database with same CATH topology
2I6DA 4TZZA 3JAMM 2QA4F 1YJWF 1QVFF 1Q7YH 1K8AH 3NMUC 5DCVA 3V3TA 1PXWA 2JNBA 1W3EX 3GYQA 1VQMF 2VGMA 4BVTA 5HXUA 1KD1H 5FLXM 1T0KB 3CPWF 1K73H 1YJNF 5EWRA 1Q81H 3LWPC 3CC4F 5FJ4C 2KTVA 3LWOC 3AGKA 3ON1A 5HXZA 2OHWA 3CCRF 3V7QA 3CCVF 3CCMF 2KG4A 3FFMA 3G6EF 2VGNA 2OTJF 4EI7A 3VMFB 3MCAB 3CCLF 2HVYD 3CMEF 3CCSF 1VQPF 3J80M 4LCKA 5G4VC 5HY4A 3CCUF 1W40A 4EI9A 1NMUB 3CMAF 5HY1A 4XCQA 1W2BF 1IPAA 1W42A 3N4YA 4X3MA 4BW0B 3CCEF 1YJ9F 2OZBA 1ZWZA 3LWQC 3G4SF 2FC3A 3IR9A 1E7KA 3E1YA 1X52A 1NJIH 2F9ZC 5GINC 1KC8H 3LWVC 1X7OA 1XBIA 3N4ZA 3RA5A 5GIOC 1VQOF 3CCJF 4EI8A 5HY0A 3CCQF 2BO1A 1JJ2F 1YIJF 3J7AR 3OW2F 3PLAC 1X7PA 1YHQF 3D00A 1CN7A 3HJWC 1RLGA 5HWEA 2FGYA 3JCMM 3LFOA 5IT9M 3CPQA 1H7MA 4NQ3A 2KTUA 5GIPC 1KQSF 3NVKE 1VQ9F 3CG6A 2LBXA 2WALA 5GAPK 3RA6A 3NVIB 2QEXF 3CC2F 5EO3A 1N8RH 2ALEA 1GO1A 3J81M 1W41A 1VQ6F 1Q82H 1Q86H 3SIUA 2CZWA 3NK7A 3CC7F 1VQNF 1GO0A 3E20B 3OBYA 5A2QM 4NUTA 3LWRC 1DT9A 4BVQA 2GLZA 1VQ8F 2OTLF 3HAXD 4X3LA 4BVSA 3I56F 1M1KH 3CD6F 1YI2F 1S72F 1VQ4F 1QVGF 1VQ5F 4BY9D 4C4WC 1VQKF 1K9MH 1YITF 5GANK 3CXCF 1GZ0A 1M90H 1SDSA 3I55F 3VI6A 2AIFA 3V7EA 3SIVA 5HY2A 1VQ7F 1RA4A 1CK2A 1VQLF 2QI2A 3OBWA 3G71F 3WXMB 2LBWA 5G4UC 4BVRA 3O85A 3PAFA 3NK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6D A;  4TZZ A;  3JAM M;  2QA4 F;  1YJW F;  1QVF F;  1Q7Y H;  1K8A H;  3NMU C;  5DCV A;  1PXW A;  2JNB A;  1W3E X;  3GYQ A;  1VQM F;  2VGM A;  1KD1 H;  5FLX M;  1T0K B;  3CPW F;  1K73 H;  1YJN F;  5EWR A;  1Q81 H;  3LWP C;  3CC4 F;  5FJ4 C;  2KTV A;  3LWO C;  3AGK A;  3ON1 A;  2OHW A;  3CCR F;  3V7Q A;  3CCV F;  3CCM F;  2KG4 A;  3FFM A;  3G6E F;  2VGN A;  2OTJ F;  3VMF B;  3MCA B;  3CCL F;  2HVY D;  3CME F;  3CCS F;  1VQP F;  3J80 M;  4LCK A;  5G4V C;  3CCU F;  1W40 A;  1NMU B;  3CMA F;  1W2B F;  1IPA A;  1W42 A;  3N4Y A;  4X3M A;  4BW0 B;  3CCE F;  1YJ9 F;  2OZB A;  1ZWZ A;  3LWQ C;  3G4S F;  2FC3 A;  3IR9 A;  1E7K A;  3E1Y A;  1X52 A;  1NJI H;  5GIN C;  1KC8 H;  3LWV C;  1X7O A;  1XBI A;  3N4Z A;  3RA5 A;  5GIO C;  1VQO F;  3CCJ F;  3CCQ F;  2BO1 A;  1JJ2 F;  1YIJ F;  3J7A R;  3OW2 F;  3PLA C;  1X7P A;  1YHQ F;  1CN7 A;  3HJW C;  1RLG A;  3JCM M;  3LFO A;  5IT9 M;  3CPQ A;  1H7M A;  2KTU A;  5GIP C;  1KQS F;  3NVK E;  1VQ9 F;  3CG6 A;  2LBX A;  2WAL A;  5GAP K;  3RA6 A;  3NVI B;  2QEX F;  3CC2 F;  5EO3 A;  1N8R H;  2ALE A;  1GO1 A;  3J81 M;  1W41 A;  1VQ6 F;  1Q82 H;  1Q86 H;  3SIU A;  2CZW A;  3NK7 A;  3CC7 F;  1VQN F;  1GO0 A;  3E20 B;  3OBY A;  5A2Q M;  4NUT A;  3LWR C;  1DT9 A;  2OTL F;  1VQ8 F;  3HAX D;  4X3L A;  3I56 F;  1M1K H;  3CD6 F;  1YI2 F;  1S72 F;  1VQ4 F;  1QVG F;  1VQ5 F;  4BY9 D;  4C4W C;  1VQK F;  1K9M H;  1YIT F;  5GAN K;  3CXC F;  1GZ0 A;  1M90 H;  1SDS A;  3I55 F;  3VI6 A;  2AIF A;  3V7E A;  3SIV A;  1VQ7 F;  1RA4 A;  1CK2 A;  1VQL F;  2QI2 A;  3OBW A;  3G71 F;  3WXM B;  2LBW A;  5G4U C;  3O85 A;  3PAF A;  3NK6 A; 
#chains in the Genus database with same CATH topology
 1Q7Y H;  1K8A H;  3NMU C;  5JCO A;  4WBN B;  4G4V A;  1KD1 H;  2AIZ P;  1IV1 A;  3T80 A;  5ITZ A;  2IQQ A;  3JAT B;  4BT5 A;  4TV8 A;  1K73 H;  2GVI A;  5AVM A;  1YJN F;  5EWR A;  4ZOL A;  3S06 A;  1JD1 A;  3JAL B;  4NWO B;  4M8I A;  5JVD B;  3CCR F;  1JFF B;  4G4X A;  2KG4 A;  4WBN A;  3FFM A;  3G6E F;  2LCA A;  2P6Y A;  3P10 A;  3VMF B;  4O4L A;  3JAT A;  1PF5 A;  4LCK A;  3ERN A;  5HY4 A;  4EI9 A;  1NMU B;  3KJK A;  3FBA A;  1JFF A;  1XRG A;  2I6R A;  1IPA A;  3N4Y A;  4X3M A;  3CCE F;  4X1I B;  3WGL A;  3F0D A;  3LWQ C;  3G4S F;  1E7K A;  3E1Y A;  3LME A;  3ZP7 A;  4B62 A;  5LYJ A;  3IEW A;  1KC8 H;  1RQ2 A;  1X7O A;  4I4T B;  3N4Z A;  3RA5 A;  3JAR B;  5LXT A;  2UYP A;  5EYP B;  3I7T A;  4B5C A;  3VYU C;  1TUB B;  5IYZ A;  2BO1 A;  2H6L A;  3J7A R;  1CN7 A;  5FNV B;  5CA0 B;  3HJW C;  1FSZ A;  5CA1 A;  5HWE A;  2HRU A;  3IEQ A;  2K1S A;  3RYH A;  1H7M A;  3S0Y A;  5CB4 A;  3OON A;  4IIJ B;  1VQ9 F;  1T0A A;  3NVI B;  2VAM A;  2BTU A;  1X25 A;  5FNV A;  5CA0 A;  3E22 B;  3HKC A;  3JAW B;  3CC2 F;  4DRX A;  1OFU A;  2QTP A;  1W5B A;  4X1K B;  3S03 A;  1XHO A;  3RYC B;  1Q86 H;  3SIU A;  2ZAU A;  3S02 A;  1VQN F;  2YYE A;  1GO0 A;  3LWR C;  4BVQ A;  4O4H A;  5LOV A;  3CD6 F;  1IV3 A;  3ESJ A;  1QVG F;  3M1X A;  4C4W C;  3JAW A;  1M90 H;  3ZO8 A;  2H8E A;  1KNK A;  3KHN A;  3V7E A;  3SIV A;  3RYF B;  3MQW A;  1RA4 A;  1VHA A;  2QI2 A;  4O2A B;  2UYN B;  3C9S A;  3OBW A;  3Q8H A;  4O2B B;  5LP6 C;  4G4Y A;  4I55 B;  4HNA B;  1JN1 A;  1XV2 A;  3PAF A;  2I6D A;  4TV9 A;  1FFX B;  3MDO A;  4EB6 B;  3K12 A;  2QA4 F;  4C8G A;  2OTM A;  2JNB A;  1W3E X;  2VAW A;  3IMP A;  3RYF A;  3TD4 A;  5KMG B;  5FLX M;  3CPW F;  4ZHW A;  4TUY B;  4HNA A;  5B8F A;  3CC4 F;  5FJ4 C;  3LWO C;  1FFX A;  3HKB A;  3F0E A;  4ZK7 A;  4ZI7 A;  4C8E A;  3FD6 A;  3V7Q A;  1U3P A;  2KGW A;  1U43 A;  3GHZ A;  2VGN A;  4C8I A;  2OTJ F;  3D01 A;  4EI7 A;  1W5E A;  2CHT A;  3TD5 A;  3VTI C;  3VYS C;  3CME F;  3J80 M;  5IJ9 B;  3CCU F;  5HP7 A;  2HS4 A;  4YJ3 B;  5C8Y B;  4BT6 A;  1YJ9 F;  2OZB A;  3WGJ A;  3HKD B;  5LP6 A;  2F9Z C;  4IHJ B;  3UT5 B;  3S0H A;  2G9I A;  5KX5 B;  1XBI A;  1CLI A;  5GIO C;  4PWT A;  1VQO F;  3RE3 A;  1IV4 A;  4EI8 A;  4YJ3 A;  2CVL A;  4C82 A;  3MCQ A;  5IJ0 B;  3CCQ F;  2RB9 A;  1YIJ F;  3OW2 F;  1X7P A;  3D00 A;  2N48 A;  1J7H A;  2DT4 A;  5EB0 A;  3JAL A;  3JCM M;  3LFO A;  4DXD A;  5IT9 M;  3CPQ A;  4NQ3 A;  2KTU A;  5JVD A;  5GIP C;  3R0P A;  3FD5 A;  1VQV A;  2NMU A;  3V4D A;  5EZY B;  1H47 A;  3CG6 A;  2RHL A;  2ZVY A;  2LBT A;  5EIB D;  2RHH A;  2Z1U A;  3B6N A;  4O4J B;  1YQN A;  3JAS B;  3J81 M;  3KJJ A;  2CZW A;  1COM A;  3E20 B;  5HP8 A;  4X1I A;  1SA0 B;  3N2G B;  4NUT A;  1DT9 A;  2OTL F;  2GLZ A;  1VQ8 F;  2CSL A;  3C9T A;  3LYB A;  5LA6 B;  1W55 A;  3JVH A;  1TVK B;  2R75 1;  3MBM A;  4C81 A;  1YI2 F;  1VQ5 F;  4I4T A;  4O4J A;  2HS0 A;  3VYT C;  1R1M A;  2GZL A;  3FPI A;  1GZ0 A;  3JAR A;  3CXC F;  1YIT F;  5EYP A;  4G88 A;  1TUB A;  5HY2 A;  3WPX A;  1CK2 A;  3K14 A;  1SA0 A;  2V9Y A;  5JH7 B;  3G71 F;  3WXM B;  2HX0 A;  3O85 A;  2HP0 B;  3VOB A;  1GX1 A;  1W5F A;  2Z1F A;  2WAL A;  3TD3 A;  5GON B;  3JAM M;  2H8C A;  4IIJ A;  2CHS A;  1QU9 A;  3GYQ A;  1VQM F;  5BMV B;  1ONI A;  5HXU A;  1QAH A;  3E22 A;  5J2T B;  4BT3 A;  3N2K B;  4X1K A;  3P4E A;  5HXZ A;  2R6R 1;  3RYC A;  5GON A;  2DYY A;  4ZHQ B;  3HKE B;  5JQG B;  4BT7 A;  3QUW A;  4BT4 A;  2IG8 A;  3VIU A;  3MCA B;  2HVY D;  3CCS F;  3WGK A;  3CB2 A;  3P0Z A;  3RYI B;  1VQP F;  5G4V C;  3D54 A;  4KWE A;  3K2X A;  1W40 A;  3CMA F;  3DDN A;  3C9U A;  4XCQ A;  1W2B F;  4O2A A;  1W42 A;  3WGN A;  2UYN A;  5JQG A;  4I50 B;  4X20 B;  1RQ7 A;  4O2B A;  1ZWZ A;  2FC3 A;  3IR9 A;  1UFY A;  1X52 A;  4I55 A;  2ZVZ A;  3BYQ A;  4ZHY B;  4EB6 A;  3CCJ F;  2Q1Y A;  3VOA A;  5HY0 A;  5KMG A;  2MQE A;  5EAZ A;  1JJ2 F;  4X20 A;  1RLG A;  4TUY A;  2UZH A;  1H48 A;  4BT2 A;  1U40 A;  4YJ2 B;  3CYP B;  1KQS F;  3NVK E;  1NQ3 A;  2BTQ B;  3ZP4 A;  2LBX A;  1YGY A;  4B45 A;  5GAP K;  3RA6 A;  3QHD A;  2QEX F;  4LNU B;  5IJ9 A;  1N8R H;  2CW4 A;  5C8Y A;  1U3L A;  1W41 A;  4YJ2 A;  1VQ6 F;  1Q82 H;  1W59 A;  3NK7 A;  3CC7 F;  5MN5 A;  3OBY A;  3HKD A;  2VAP A;  3JAK B;  4X1Y B;  4BVS A;  3I56 F;  3F0G A;  4IHJ A;  3UT5 A;  1M1K H;  4O4L B;  5KX5 A;  4LNU A;  1K9M H;  5GAN K;  1VK3 A;  3KE1 A;  2HP3 A;  3I55 F;  3VI6 A;  5IJ0 A;  1VQ7 F;  4R40 B;  3JAK A;  2LBW A;  4X1Y A;  5G4U C;  3LDT A;  4RQO A;  2VXY A;  3C8L A;  5LYJ B;  3NK6 A;  3I3F A;  1Q8R A;  4TZZ A;  1YJW F;  3WPW A;  5LXT B;  1QVF F;  5EZY A;  3KIZ A;  3WJQ A;  5DCV A;  5J2U B;  2RHO A;  3V3T A;  1PXW A;  5IYZ B;  2Q1X A;  2VGM A;  4BVT A;  3CYQ A;  2HQS C;  1T0K B;  3IKE A;  5EIB C;  5CA1 B;  1Q81 H;  3JAS A;  2IAF A;  3LWP C;  4O4I B;  2KTV A;  3AGK A;  3ON1 A;  3RYH B;  2OHW A;  4U3J B;  2L26 A;  2YXZ A;  5EB1 B;  5CB4 B;  2W8B C;  3CCV F;  3N2G A;  5J2U A;  5MN6 A;  3CCM F;  1UI9 A;  1FNJ A;  5LA6 A;  3F6M A;  2Z01 A;  1TVK A;  3IKF A;  3CCL F;  3WJP A;  1ODE A;  3HKC B;  4O4I A;  4DRX B;  4U39 A;  3WGM A;  3M84 A;  5HY1 A;  2UYK A;  4U3J A;  1OAP A;  1DBF A;  2Z1E A;  5JH7 A;  4BW0 B;  1Z5V A;  2HP0 A;  1NJI H;  4O4H B;  5GIN C;  3DC2 A;  3QTY A;  5LOV B;  3LWV C;  4G4Z A;  1KNJ A;  3VCZ A;  3HWU A;  3S0W A;  5BMV A;  3PLA C;  1RLU A;  1YHQ F;  3GTZ A;  5J2T A;  2EWC A;  3L7Q A;  3N2K A;  2FGY A;  3F0F A;  2ZOD A;  4TV9 B;  4ZHQ A;  3HKE A;  2PMP A;  2AMT A;  2UYJ A;  5JCO C;  3VO8 A;  4ERH A;  3M4S A;  2PHN A;  3ZOP A;  3RYI A;  1W57 A;  1QD9 A;  4FFB B;  5EO3 A;  3HTN A;  4F6R B;  2ALE A;  2B33 A;  1GO1 A;  4RHA A;  2HRY A;  3HKB B;  4E6E A;  4ZI7 B;  5A2Q M;  4I50 A;  3ELC A;  1W58 1;  3HAX D;  4X3L A;  4B46 A;  3WJR A;  1VH8 A;  1S72 F;  1IV2 A;  1VQ4 F;  3EOR A;  4BY9 D;  4FFB A;  2Z1T A;  2ZOV A;  1VQK F;  1FNK A;  1SDS A;  3K0T A;  4F6R A;  5MN4 A;  2ZF8 A;  2BTO A;  3C9R A;  2HS3 A;  1SZQ A;  1W5A A;  2AIF A;  2CWJ A;  4G4W A;  3U0O A;  4ZHV A;  1VQL F;  5ITZ B;  5LP6 B;  4BVR A;  4TV8 B;  1Z5W A;  4ZOL B;  2RHJ A;  1JY8 A; 
#chains in the Genus database with same CATH homology
 2I6D A;  4TZZ A;  3JAM M;  2QA4 F;  1YJW F;  1QVF F;  1Q7Y H;  1K8A H;  3NMU C;  5DCV A;  3V3T A;  1PXW A;  2JNB A;  1W3E X;  3GYQ A;  1VQM F;  2VGM A;  4BVT A;  5HXU A;  1KD1 H;  5FLX M;  1T0K B;  3CPW F;  1K73 H;  1YJN F;  5EWR A;  1Q81 H;  3LWP C;  3CC4 F;  5FJ4 C;  2KTV A;  3LWO C;  3AGK A;  3ON1 A;  5HXZ A;  2OHW A;  3CCR F;  3V7Q A;  3CCV F;  3CCM F;  2KG4 A;  3FFM A;  3G6E F;  2VGN A;  2OTJ F;  4EI7 A;  3VMF B;  3MCA B;  3CCL F;  2HVY D;  3CME F;  3CCS F;  1VQP F;  3J80 M;  4LCK A;  5G4V C;  5HY4 A;  3CCU F;  1W40 A;  4EI9 A;  1NMU B;  3CMA F;  5HY1 A;  4XCQ A;  1W2B F;  1IPA A;  1W42 A;  3N4Y A;  4X3M A;  4BW0 B;  3CCE F;  1YJ9 F;  2OZB A;  1ZWZ A;  3LWQ C;  3G4S F;  2FC3 A;  3IR9 A;  1E7K A;  3E1Y A;  1X52 A;  1NJI H;  2F9Z C;  5GIN C;  1KC8 H;  3LWV C;  1X7O A;  1XBI A;  3N4Z A;  3RA5 A;  5GIO C;  1VQO F;  3CCJ F;  4EI8 A;  5HY0 A;  3CCQ F;  2BO1 A;  1JJ2 F;  1YIJ F;  3J7A R;  3OW2 F;  3PLA C;  1X7P A;  1YHQ F;  3D00 A;  1CN7 A;  3HJW C;  1RLG A;  5HWE A;  2FGY A;  3JCM M;  3LFO A;  5IT9 M;  3CPQ A;  1H7M A;  4NQ3 A;  2KTU A;  5GIP C;  1KQS F;  3NVK E;  1VQ9 F;  3CG6 A;  2LBX A;  2WAL A;  5GAP K;  3RA6 A;  3NVI B;  2QEX F;  3CC2 F;  5EO3 A;  1N8R H;  2ALE A;  1GO1 A;  3J81 M;  1W41 A;  1VQ6 F;  1Q82 H;  1Q86 H;  3SIU A;  2CZW A;  3NK7 A;  3CC7 F;  1VQN F;  1GO0 A;  3E20 B;  3OBY A;  5A2Q M;  4NUT A;  3LWR C;  1DT9 A;  4BVQ A;  2GLZ A;  1VQ8 F;  2OTL F;  3HAX D;  4X3L A;  4BVS A;  3I56 F;  1M1K H;  3CD6 F;  1YI2 F;  1S72 F;  1VQ4 F;  1QVG F;  1VQ5 F;  4BY9 D;  4C4W C;  1VQK F;  1K9M H;  1YIT F;  5GAN K;  3CXC F;  1GZ0 A;  1M90 H;  1SDS A;  3I55 F;  3VI6 A;  2AIF A;  3V7E A;  3SIV A;  5HY2 A;  1VQ7 F;  1RA4 A;  1CK2 A;  1VQL F;  2QI2 A;  3OBW A;  3G71 F;  3WXM B;  2LBW A;  5G4U C;  4BVR A;  3O85 A;  3PAF A;  3NK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...