3G71F

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g71F00
2LBXA 4NUTA 2QA4F 3VI6A 1H7MA 3CPQA 1YJNF 1K73H 3CCUF 1XBIA 3OW2F 1X52A 5G4UC 2KG4A 3JCMM 1Q7YH 1VQ7F 1YJ9F 3CC7F 3J80M 1YHQF 3J81M 5FJ4C 1VQPF 2VGNA 1NJIH 3I55F 3N4ZA 2HVYD 3MCAB 3V7QA 1M90H 2WALA 3V7EA 3G71F 4X3MA 3NVIB 5G4VC 2OHWA 1N8RH 1T0KB 3RA6A 1W41A 4TZZA 5GINC 1Q81H 5EWRA 1VQKF 3OBYA 5IT9M 1Q82H 1VQOF 1YJWF 3CCVF 5EO3A 2FC3A 3CXCF 1KD1H 5GIOC 3CC2F 3OBWA 3VMFB 3CPWF 1S72F 3HAXD 3RA5A 3IR9A 1W40A 1M1KH 1JJ2F 1VQMF 1YIJF 3SIVA 2CZWA 3CCLF 1Q86H 3GYQA 1YI2F 1VQ9F 2LBWA 1SDSA 3PAFA 3O85A 4C4WC 4BW0B 3PLAC 1X7OA 1W42A 1X7PA 3CMAF 5GANK 1VQ5F 5DCVA 3WXMB 3G4SF 2VGMA 2OTJF 3LWQC 3CCQF 3I56F 2QI2A 3CCMF 1NMUB 5FLXM 2ALEA 3G6EF 1RA4A 3LFOA 1K9MH 3N4YA 3JAMM 1KQSF 4LCKA 2OZBA 1PXWA 2QEXF 1KC8H 1VQLF 1K8AH 1E7KA 1GO1A 5GIPC 1VQ6F 2AIFA 3AGKA 3NK6A 4BY9D 3NMUC 1CK2A 1W2BF 3NVKE 3LWVC 3FFMA 3CD6F 1QVGF 3CCSF 1GZ0A 1W3EX 3CCJF 3CMEF 1CN7A 3LWPC 3CCEF 5GAPK 1DT9A 3CCRF 3ON1A 3SIUA 3CC4F 1QVFF 1GO0A 1YITF 1IPAA 2BO1A 1RLGA 1VQ8F 3J7AR 3CG6A 3NK7A 5A2QM 1VQ4F 2KTUA 3LWRC 2JNBA 3HJWC 1VQNF 2KTVA 2OTLF 2I6DA 3E1YA 3LWOC 1ZWZA 3E20B 4X3LA
chains in the Genus database with same CATH superfamily
3D00A 2QA4F 1KNJA 4X20A 1XHOA 4B62A 3KJKA 3CPQA 5CA0A 1COMA 4X1YB 1X52A 1Q7YH 3S0YA 5CB4A 5KX5B 3RYIB 4ERHA 1YHQF 1VQPF 3WJRA 3P0ZA 1TUBB 2ZVYA 3N4ZA 4O2AB 2HVYD 3JVHA 3V7QA 1QD9A 3VYSC 5JCOC 3V7EA 4X3MA 2YXZA 3TD4A 3VO8A 1W41A 3MBMA 5HXZA 4WBNA 3F0FA 5J2TA 3KIZA 1FNJA 3RYHA 3DDNA 1VQKF 2IAFA 5IT9M 3HKBA 5EO3A 2OTMA 4E6EA 3WGMA 5MN6A 3CC2F 2RHHA 3VMFB 2L26A 1J7HA 1GX1A 4O4HA 3ZP7A 3IR9A 1JJ2F 5C8YA 2N48A 3CB2A 3SIVA 2RHJA 3CCLF 3UT5B 4O4LA 3RYCB 2EWCA 2LBWA 1X25A 2ZVZA 5EZYB 2ZODA 4BW0B 1X7OA 3D01A 3I7TA 5GANK 3M84A 1VQ5F 3WXMB 2HS3A 2VAPA 4O2BB 3WPWA 2VGMA 2Z01A 4I4TA 2YYEA 3JAKB 2ZAUA 1PF5A 1VH8A 3WJQA 3JASB 5LXTA 4X20B 3G6EF 4TV9A 3E22A 4EB6B 1OFUA 3N4YA 4EI9A 2K1SA 1GO1A 5BMVA 5GIPC 2AIFA 1U43A 1VQ6F 4ZI7A 1JY8A 5B8FA 3K12A 3CYPB 3WGKA 3LMEA 3WPXA 1TVKB 1VK3A 4ZHVA 1TVKA 4FFBA 1RQ2A 3CCJF 5JH7A 2DYYA 4ZHQA 3LWPC 1CN7A 4BT6A 4WBNB 5J2TB 3QUWA 2ZOVA 4X1KB 3IKEA 3CC4F 4YJ3B 1GO0A 2RB9A 3T80A 5IJ0A 2BO1A 3C9TA 1VQ8F 5A2QM 2CVLA 2Q1YA 4G4WA 3MQWA 2UYNB 4IHJA 2JNBA 3HJWC 2KTVA 5EYPB 5CA0B 5HY4A 3LWOC 3L7QA 2IG8A 1FSZA 4X3LA 4NUTA 3MCQA 1XV2A 3VI6A 1SZQA 4I55B 3IEQA 1JN1A 3ZOPA 3K14A 4ZOLB 1FFXA 1K73H 3KE1A 1XBIA 5G4UC 5LYJA 2AMTA 2ZF8A 1YJ9F 5FJ4C 3I55F 3JALA 5EB1B 2CHTA 2HP3A 4BT4A 1M90H 5CA1B 3HTNA 5G4VC 2OHWA 1T0KB 1SA0A 3RA6A 2G9IA 3FD6A 3KHNA 5LOVB 3N2KB 4G4ZA 1Q82H 1KNKA 4DXDA 1VQVA 3C8LA 3CPWF 4DRXB 3HAXD 2MQEA 3RA5A 3F0EA 5IJ0B 1T0AA 1VQMF 3N2GB 3VIUA 2AIZP 5GONB 1VQ9F 3PAFA 5CA1A 1UFYA 1YGYA 4C4WC 2HP0B 3M1XA 1W42A 3BYQA 1X7PA 2VAWA 3HKDA 5HY0A 3HKDB 1IV3A 2OTJF 2VXYA 4EI8A 4ZI7B 2V9YA 4ZOLA 5LP6B 5FLXM 2ALEA 2VAMA 3LFOA 4F6RB 1K9MH 3S02A 3JAMM 1KQSF 1VHAA 4BVTA 3HWUA 2QEXF 1VQLF 1W57A 1K8AH 3ELCA 5KMGB 3R0PA 3NK6A 1XRGA 4O4IA 4B45A 3ZO8A 4DRXA 1W5EA 4X1IB 3CD6F 3JAKA 2HS0A 3GTZA 1W3EX 4PWTA 3RYFA 2UYNA 3CCEF 3HKCB 5LA6B 2Z1EA 2BTUA 5EB0A 3VOAA 1IPAA 1RLGA 3J7AR 1IV1A 1VQ4F 2KTUA 3U0OA 3E1YA 3LDTA 1JFFA 3M4SA 3ZP4A 1ZWZA 4IIJA 2GZLA 3JARB 3ERNA 1Z5WA 1H7MA 3RYHB 1W5FA 3V4DA 3D54A 3S06A 1YJNF 1H47A 4RHAA 3C9UA 4BVQA 1U40A 3HKEA 1W5BA 3CC7F 3J80M 3J81M 1RQ7A 5JVDB 1FNKA 5EYPA 3MCAB 1JD1A 3S0HA 4IHJB 3JATB 2WALA 3LYBA 3G71F 3JATA 5FNVA 1ONIA 1Q81H 5EWRA 3V3TA 3OBYA 4G4YA 4X1YA 3Q8HA 4FFBB 3CCVF 1YJWF 3GHZA 1KD1H 5JH7B 5ITZB 5C8YB 5GIOC 5EIBC 3P10A 2HRUA 3OBWA 2H8EA 3JALB 3FD5A 5ITZA 4G4XA 5J2UB 3FBAA 3ESJA 1W40A 5MN5A 1M1KH 2GLZA 3K0TA 3JASA 5LXTB 3MDOA 2CZWA 4TUYB 2DT4A 5LA6A 4I4TB 1SDSA 4I50A 1U3LA 1YI2F 2PHNA 3O85A 5IYZB 2R6R1 3PLAC 5JVDA 3CMAF 3JAWB 3G4SF 3LWQC 3CCQF 3I56F 2QI2A 3CCMF 1NMUB 2Z1UA 1RA4A 3JARA 4X1KA 4LNUA 4U39A 3RYCA 4ZK7A 4LCKA 4KWEA 4ZHWA 1W59A 4BY9D 2HRYA 2KGWA 4U3JA 2R751 1CK2A 4G4VA 1W2BF 3NVKE 3FFMA 3CCSF 1GZ0A 2HP0A 2HQSC 5BMVB 3CMEF 5FNVB 1Z5VA 2W8BC 2NMUA 4G88A 5GAPK 5HY2A 3CCRF 1IV4A 4BVRA 1YQNA 3SIUA 1QVFF 1IV2A 2RHLA 3IEWA 2LBTA 5EAZA 5LP6C 4O4JA 1YITF 2BTQB 3WGNA 4M8IA 3RYIA 5HY1A 5JCOA 1VQNF 2OTLF 2CWJA 2HS4A 2F9ZC 5JQGA 3RE3A 2UYKA 2LBXA 3HKEB 5KMGA 4TUYA 5HXUA 1H48A 2CSLA 3WGJA 4YJ2A 1SA0B 3CCUF 3OW2F 2KG4A 4O4HB 3JCMM 3VTIC 1VQ7F 5LP6A 1W5AA 2VGNA 1NJIH 4C8GA 3WJPA 5AVMA 3FPIA 3NVIB 2Z1TA 3IMPA 3S0WA 5LYJB 1N8RH 4TZZA 3E20B 2H8CA 1QAHA 2UYPA 3IKFA 4I55A 5GINC 4LNUB 4BT3A 3CYQA 5GONA 1VQOF 4EI7A 2BTOA 1FFXB 1Q8RA 2FC3A 4O4IB 4BT2A 3CXCF 2IQQA 5HP7A 2UYJA 4C8IA 4O2BA 4X1IA 1S72F 3F0GA 5JQGB 3K2XA 4BT5A 3N2KA 2I6RA 4C81A 4NWOB 5HWEA 2PMPA 1YIJF 4B46A 3I3FA 1R1MA 3TD3A 2RHOA 4I50B 3QTYA 1Q86H 1UI9A 5LOVA 3GYQA 4TV8B 5EIBD 2Q1XA 4RQOA 1U3PA 1JFFB 1OAPA 5DCVA 2CW4A 4TV8A 2CHSA 4BT7A 2P6YA 2QTPA 1W581 4U3JB 3TD5A 3VYTC 2HX0A 2B33A 2UZHA 3HKCA 4EB6A 3S03A 4TV9B 3VYUC 3QHDA 4YJ2B 3N2GA 1W55A 2OZBA 1PXWA 1E7KA 3RYFB 1KC8H 3P4EA 2H6LA 3AGKA 4R40B 4C82A 3NMUC 3E22B 4HNAB 5MN4A 4HNAA 2FGYA 2GVIA 3F6MA 3LWVC 1TUBA 4NQ3A 4O2AA 1QVGF 4O4JB 3VCZA 1RLUA 5IYZA 1NQ3A 5CB4B 5KX5A 3EORA 3DC2A 1DBFA 3JAWA 4O4LB 1DT9A 3ON1A 4F6RA 1ODEA 1QU9A 3C9RA 4YJ3A 5EZYA 3WGLA 4IIJB 4B5CA 3CG6A 3NK7A 5J2UA 3UT5A 3F0DA 3LWRC 4ZHQB 5HP8A 2Z1FA 3C9SA 5IJ9A 4C8EA 4BVSA 4ZHYB 5IJ9B 2I6DA 3OONA 4XCQA 3VOBA 1CLIA 2LCAA 3HKBB 3B6NA 3KJJA
chains in the Genus database with same CATH topology
2LBXA 3D00A 4NUTA 2QA4F 3VI6A 1H7MA 5HXUA 3CPQA 1YJNF 1K73H 3CCUF 1XBIA 3OW2F 1X52A 4BVQA 2KG4A 5G4UC 3JCMM 1Q7YH 1VQ7F 1YJ9F 3CC7F 3J80M 1YHQF 3J81M 5FJ4C 1VQPF 2VGNA 1NJIH 3I55F 3N4ZA 2HVYD 3MCAB 3V7QA 1M90H 2WALA 3V7EA 3G71F 4X3MA 3NVIB 5G4VC 2OHWA 1N8RH 1T0KB 3RA6A 1W41A 5HXZA 4TZZA 5GINC 1Q81H 5EWRA 1VQKF 3V3TA 3OBYA 5IT9M 1Q82H 1VQOF 4EI7A 1YJWF 3CCVF 5EO3A 2FC3A 3CXCF 1KD1H 5GIOC 3CC2F 3OBWA 3VMFB 3CPWF 1S72F 3HAXD 5HWEA 3RA5A 3IR9A 1W40A 1M1KH 2GLZA 1JJ2F 1VQMF 1YIJF 3SIVA 2CZWA 3CCLF 1Q86H 3GYQA 1YI2F 1VQ9F 2LBWA 1SDSA 3PAFA 3O85A 4C4WC 4BW0B 3PLAC 1X7OA 1W42A 1X7PA 3CMAF 5GANK 1VQ5F 5DCVA 3WXMB 5HY0A 3G4SF 2VGMA 2OTJF 4EI8A 3LWQC 3CCQF 3I56F 2QI2A 3CCMF 1NMUB 5FLXM 2ALEA 3G6EF 1RA4A 3LFOA 1K9MH 3N4YA 3JAMM 1KQSF 4LCKA 4EI9A 2OZBA 4BVTA 1PXWA 2QEXF 1KC8H 1VQLF 1K8AH 1E7KA 1GO1A 5GIPC 1VQ6F 2AIFA 3AGKA 3NK6A 4BY9D 3NMUC 1CK2A 2FGYA 1W2BF 3NVKE 3LWVC 3FFMA 4NQ3A 3CD6F 1QVGF 3CCSF 1GZ0A 1W3EX 3CCJF 3CMEF 1CN7A 3LWPC 3CCEF 5GAPK 1DT9A 5HY2A 3CCRF 4BVRA 3ON1A 3SIUA 3CC4F 1QVFF 1GO0A 1YITF 1IPAA 2BO1A 1RLGA 1VQ8F 3J7AR 3CG6A 3NK7A 5A2QM 1VQ4F 2KTUA 3LWRC 2JNBA 3HJWC 4BVSA 5HY1A 1VQNF 2KTVA 2OTLF 2I6DA 3E1YA 5HY4A 3LWOC 4XCQA 2F9ZC 1ZWZA 3E20B 4X3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBX A;  4NUT A;  2QA4 F;  3VI6 A;  1H7M A;  3CPQ A;  1YJN F;  1K73 H;  3CCU F;  1XBI A;  3OW2 F;  1X52 A;  5G4U C;  2KG4 A;  3JCM M;  1Q7Y H;  1VQ7 F;  1YJ9 F;  3CC7 F;  3J80 M;  1YHQ F;  3J81 M;  5FJ4 C;  1VQP F;  2VGN A;  1NJI H;  3I55 F;  3N4Z A;  2HVY D;  3MCA B;  3V7Q A;  1M90 H;  2WAL A;  3V7E A;  3G71 F;  4X3M A;  3NVI B;  5G4V C;  2OHW A;  1N8R H;  1T0K B;  3RA6 A;  1W41 A;  4TZZ A;  5GIN C;  1Q81 H;  5EWR A;  1VQK F;  3OBY A;  5IT9 M;  1Q82 H;  1VQO F;  1YJW F;  3CCV F;  5EO3 A;  2FC3 A;  3CXC F;  1KD1 H;  5GIO C;  3CC2 F;  3OBW A;  3VMF B;  3CPW F;  1S72 F;  3HAX D;  3RA5 A;  3IR9 A;  1W40 A;  1M1K H;  1JJ2 F;  1VQM F;  1YIJ F;  3SIV A;  2CZW A;  3CCL F;  1Q86 H;  3GYQ A;  1YI2 F;  1VQ9 F;  2LBW A;  1SDS A;  3PAF A;  3O85 A;  4C4W C;  4BW0 B;  3PLA C;  1X7O A;  1W42 A;  1X7P A;  3CMA F;  5GAN K;  1VQ5 F;  5DCV A;  3WXM B;  3G4S F;  2VGM A;  2OTJ F;  3LWQ C;  3CCQ F;  3I56 F;  2QI2 A;  3CCM F;  1NMU B;  5FLX M;  2ALE A;  3G6E F;  1RA4 A;  3LFO A;  1K9M H;  3N4Y A;  3JAM M;  1KQS F;  4LCK A;  2OZB A;  1PXW A;  2QEX F;  1KC8 H;  1VQL F;  1K8A H;  1E7K A;  1GO1 A;  5GIP C;  1VQ6 F;  2AIF A;  3AGK A;  3NK6 A;  4BY9 D;  3NMU C;  1CK2 A;  1W2B F;  3NVK E;  3LWV C;  3FFM A;  3CD6 F;  1QVG F;  3CCS F;  1GZ0 A;  1W3E X;  3CCJ F;  3CME F;  1CN7 A;  3LWP C;  3CCE F;  5GAP K;  1DT9 A;  3CCR F;  3ON1 A;  3SIU A;  3CC4 F;  1QVF F;  1GO0 A;  1YIT F;  1IPA A;  2BO1 A;  1RLG A;  1VQ8 F;  3J7A R;  3CG6 A;  3NK7 A;  5A2Q M;  1VQ4 F;  2KTU A;  3LWR C;  2JNB A;  3HJW C;  1VQN F;  2KTV A;  2OTL F;  2I6D A;  3E1Y A;  3LWO C;  1ZWZ A;  3E20 B;  4X3L A; 
#chains in the Genus database with same CATH topology
 3D00 A;  2QA4 F;  1KNJ A;  4X20 A;  1XHO A;  4B62 A;  3KJK A;  3CPQ A;  5CA0 A;  1COM A;  4X1Y B;  1X52 A;  1Q7Y H;  3S0Y A;  5CB4 A;  5KX5 B;  3RYI B;  4ERH A;  1YHQ F;  1VQP F;  3WJR A;  3P0Z A;  1TUB B;  2ZVY A;  3N4Z A;  4O2A B;  2HVY D;  3JVH A;  3V7Q A;  1QD9 A;  3VYS C;  5JCO C;  3V7E A;  4X3M A;  2YXZ A;  3TD4 A;  3VO8 A;  1W41 A;  3MBM A;  5HXZ A;  4WBN A;  3F0F A;  5J2T A;  3KIZ A;  1FNJ A;  3RYH A;  3DDN A;  1VQK F;  2IAF A;  5IT9 M;  3HKB A;  5EO3 A;  2OTM A;  4E6E A;  3WGM A;  5MN6 A;  3CC2 F;  2RHH A;  3VMF B;  2L26 A;  1J7H A;  1GX1 A;  4O4H A;  3ZP7 A;  3IR9 A;  1JJ2 F;  5C8Y A;  2N48 A;  3CB2 A;  3SIV A;  2RHJ A;  3CCL F;  3UT5 B;  4O4L A;  3RYC B;  2EWC A;  2LBW A;  1X25 A;  2ZVZ A;  5EZY B;  2ZOD A;  4BW0 B;  1X7O A;  3D01 A;  3I7T A;  5GAN K;  3M84 A;  1VQ5 F;  3WXM B;  2HS3 A;  2VAP A;  4O2B B;  3WPW A;  2VGM A;  2Z01 A;  4I4T A;  2YYE A;  3JAK B;  2ZAU A;  1PF5 A;  1VH8 A;  3WJQ A;  3JAS B;  5LXT A;  4X20 B;  3G6E F;  4TV9 A;  3E22 A;  4EB6 B;  1OFU A;  3N4Y A;  4EI9 A;  2K1S A;  1GO1 A;  5BMV A;  5GIP C;  2AIF A;  1U43 A;  1VQ6 F;  4ZI7 A;  1JY8 A;  5B8F A;  3K12 A;  3CYP B;  3WGK A;  3LME A;  3WPX A;  1TVK B;  1VK3 A;  4ZHV A;  1TVK A;  4FFB A;  1RQ2 A;  3CCJ F;  5JH7 A;  2DYY A;  4ZHQ A;  3LWP C;  1CN7 A;  4BT6 A;  4WBN B;  5J2T B;  3QUW A;  2ZOV A;  4X1K B;  3IKE A;  3CC4 F;  4YJ3 B;  1GO0 A;  2RB9 A;  3T80 A;  5IJ0 A;  2BO1 A;  3C9T A;  1VQ8 F;  5A2Q M;  2CVL A;  2Q1Y A;  4G4W A;  3MQW A;  2UYN B;  4IHJ A;  2JNB A;  3HJW C;  2KTV A;  5EYP B;  5CA0 B;  5HY4 A;  3LWO C;  3L7Q A;  2IG8 A;  1FSZ A;  4X3L A;  4NUT A;  3MCQ A;  1XV2 A;  3VI6 A;  1SZQ A;  4I55 B;  3IEQ A;  1JN1 A;  3ZOP A;  3K14 A;  4ZOL B;  1FFX A;  1K73 H;  3KE1 A;  1XBI A;  5G4U C;  5LYJ A;  2AMT A;  2ZF8 A;  1YJ9 F;  5FJ4 C;  3I55 F;  3JAL A;  5EB1 B;  2CHT A;  2HP3 A;  4BT4 A;  1M90 H;  5CA1 B;  3HTN A;  5G4V C;  2OHW A;  1T0K B;  1SA0 A;  3RA6 A;  2G9I A;  3FD6 A;  3KHN A;  5LOV B;  3N2K B;  4G4Z A;  1Q82 H;  1KNK A;  4DXD A;  1VQV A;  3C8L A;  3CPW F;  4DRX B;  3HAX D;  2MQE A;  3RA5 A;  3F0E A;  5IJ0 B;  1T0A A;  1VQM F;  3N2G B;  3VIU A;  2AIZ P;  5GON B;  1VQ9 F;  3PAF A;  5CA1 A;  1UFY A;  1YGY A;  4C4W C;  2HP0 B;  3M1X A;  1W42 A;  3BYQ A;  1X7P A;  2VAW A;  3HKD A;  5HY0 A;  3HKD B;  1IV3 A;  2OTJ F;  2VXY A;  4EI8 A;  4ZI7 B;  2V9Y A;  4ZOL A;  5LP6 B;  5FLX M;  2ALE A;  2VAM A;  3LFO A;  4F6R B;  1K9M H;  3S02 A;  3JAM M;  1KQS F;  1VHA A;  4BVT A;  3HWU A;  2QEX F;  1VQL F;  1W57 A;  1K8A H;  3ELC A;  5KMG B;  3R0P A;  3NK6 A;  1XRG A;  4O4I A;  4B45 A;  3ZO8 A;  4DRX A;  1W5E A;  4X1I B;  3CD6 F;  3JAK A;  2HS0 A;  3GTZ A;  1W3E X;  4PWT A;  3RYF A;  2UYN A;  3CCE F;  3HKC B;  5LA6 B;  2Z1E A;  2BTU A;  5EB0 A;  3VOA A;  1IPA A;  1RLG A;  3J7A R;  1IV1 A;  1VQ4 F;  2KTU A;  3U0O A;  3E1Y A;  3LDT A;  1JFF A;  3M4S A;  3ZP4 A;  1ZWZ A;  4IIJ A;  2GZL A;  3JAR B;  3ERN A;  1Z5W A;  1H7M A;  3RYH B;  1W5F A;  3V4D A;  3D54 A;  3S06 A;  1YJN F;  1H47 A;  4RHA A;  3C9U A;  4BVQ A;  1U40 A;  3HKE A;  1W5B A;  3CC7 F;  3J80 M;  3J81 M;  1RQ7 A;  5JVD B;  1FNK A;  5EYP A;  3MCA B;  1JD1 A;  3S0H A;  4IHJ B;  3JAT B;  2WAL A;  3LYB A;  3G71 F;  3JAT A;  5FNV A;  1ONI A;  1Q81 H;  5EWR A;  3V3T A;  3OBY A;  4G4Y A;  4X1Y A;  3Q8H A;  4FFB B;  3CCV F;  1YJW F;  3GHZ A;  1KD1 H;  5JH7 B;  5ITZ B;  5C8Y B;  5GIO C;  5EIB C;  3P10 A;  2HRU A;  3OBW A;  2H8E A;  3JAL B;  3FD5 A;  5ITZ A;  4G4X A;  5J2U B;  3FBA A;  3ESJ A;  1W40 A;  5MN5 A;  1M1K H;  2GLZ A;  3K0T A;  3JAS A;  5LXT B;  3MDO A;  2CZW A;  4TUY B;  2DT4 A;  5LA6 A;  4I4T B;  1SDS A;  4I50 A;  1U3L A;  1YI2 F;  2PHN A;  3O85 A;  5IYZ B;  2R6R 1;  3PLA C;  5JVD A;  3CMA F;  3JAW B;  3G4S F;  3LWQ C;  3CCQ F;  3I56 F;  2QI2 A;  3CCM F;  1NMU B;  2Z1U A;  1RA4 A;  3JAR A;  4X1K A;  4LNU A;  4U39 A;  3RYC A;  4ZK7 A;  4LCK A;  4KWE A;  4ZHW A;  1W59 A;  4BY9 D;  2HRY A;  2KGW A;  4U3J A;  2R75 1;  1CK2 A;  4G4V A;  1W2B F;  3NVK E;  3FFM A;  3CCS F;  1GZ0 A;  2HP0 A;  2HQS C;  5BMV B;  3CME F;  5FNV B;  1Z5V A;  2W8B C;  2NMU A;  4G88 A;  5GAP K;  5HY2 A;  3CCR F;  1IV4 A;  4BVR A;  1YQN A;  3SIU A;  1QVF F;  1IV2 A;  2RHL A;  3IEW A;  2LBT A;  5EAZ A;  5LP6 C;  4O4J A;  1YIT F;  2BTQ B;  3WGN A;  4M8I A;  3RYI A;  5HY1 A;  5JCO A;  1VQN F;  2OTL F;  2CWJ A;  2HS4 A;  2F9Z C;  5JQG A;  3RE3 A;  2UYK A;  2LBX A;  3HKE B;  5KMG A;  4TUY A;  5HXU A;  1H48 A;  2CSL A;  3WGJ A;  4YJ2 A;  1SA0 B;  3CCU F;  3OW2 F;  2KG4 A;  4O4H B;  3JCM M;  3VTI C;  1VQ7 F;  5LP6 A;  1W5A A;  2VGN A;  1NJI H;  4C8G A;  3WJP A;  5AVM A;  3FPI A;  3NVI B;  2Z1T A;  3IMP A;  3S0W A;  5LYJ B;  1N8R H;  4TZZ A;  3E20 B;  2H8C A;  1QAH A;  2UYP A;  3IKF A;  4I55 A;  5GIN C;  4LNU B;  4BT3 A;  3CYQ A;  5GON A;  1VQO F;  4EI7 A;  2BTO A;  1FFX B;  1Q8R A;  2FC3 A;  4O4I B;  4BT2 A;  3CXC F;  2IQQ A;  5HP7 A;  2UYJ A;  4C8I A;  4O2B A;  4X1I A;  1S72 F;  3F0G A;  5JQG B;  3K2X A;  4BT5 A;  3N2K A;  2I6R A;  4C81 A;  4NWO B;  5HWE A;  2PMP A;  1YIJ F;  4B46 A;  3I3F A;  1R1M A;  3TD3 A;  2RHO A;  4I50 B;  3QTY A;  1Q86 H;  1UI9 A;  5LOV A;  3GYQ A;  4TV8 B;  5EIB D;  2Q1X A;  4RQO A;  1U3P A;  1JFF B;  1OAP A;  5DCV A;  2CW4 A;  4TV8 A;  2CHS A;  4BT7 A;  2P6Y A;  2QTP A;  1W58 1;  4U3J B;  3TD5 A;  3VYT C;  2HX0 A;  2B33 A;  2UZH A;  3HKC A;  4EB6 A;  3S03 A;  4TV9 B;  3VYU C;  3QHD A;  4YJ2 B;  3N2G A;  1W55 A;  2OZB A;  1PXW A;  1E7K A;  3RYF B;  1KC8 H;  3P4E A;  2H6L A;  3AGK A;  4R40 B;  4C82 A;  3NMU C;  3E22 B;  4HNA B;  5MN4 A;  4HNA A;  2FGY A;  2GVI A;  3F6M A;  3LWV C;  1TUB A;  4NQ3 A;  4O2A A;  1QVG F;  4O4J B;  3VCZ A;  1RLU A;  5IYZ A;  1NQ3 A;  5CB4 B;  5KX5 A;  3EOR A;  3DC2 A;  1DBF A;  3JAW A;  4O4L B;  1DT9 A;  3ON1 A;  4F6R A;  1ODE A;  1QU9 A;  3C9R A;  4YJ3 A;  5EZY A;  3WGL A;  4IIJ B;  4B5C A;  3CG6 A;  3NK7 A;  5J2U A;  3UT5 A;  3F0D A;  3LWR C;  4ZHQ B;  5HP8 A;  2Z1F A;  3C9S A;  5IJ9 A;  4C8E A;  4BVS A;  4ZHY B;  5IJ9 B;  2I6D A;  3OON A;  4XCQ A;  3VOB A;  1CLI A;  2LCA A;  3HKB B;  3B6N A;  3KJJ A; 
#chains in the Genus database with same CATH homology
 2LBX A;  3D00 A;  4NUT A;  2QA4 F;  3VI6 A;  1H7M A;  5HXU A;  3CPQ A;  1YJN F;  1K73 H;  3CCU F;  1XBI A;  3OW2 F;  1X52 A;  4BVQ A;  2KG4 A;  5G4U C;  3JCM M;  1Q7Y H;  1VQ7 F;  1YJ9 F;  3CC7 F;  3J80 M;  1YHQ F;  3J81 M;  5FJ4 C;  1VQP F;  2VGN A;  1NJI H;  3I55 F;  3N4Z A;  2HVY D;  3MCA B;  3V7Q A;  1M90 H;  2WAL A;  3V7E A;  3G71 F;  4X3M A;  3NVI B;  5G4V C;  2OHW A;  1N8R H;  1T0K B;  3RA6 A;  1W41 A;  5HXZ A;  4TZZ A;  5GIN C;  1Q81 H;  5EWR A;  1VQK F;  3V3T A;  3OBY A;  5IT9 M;  1Q82 H;  1VQO F;  4EI7 A;  1YJW F;  3CCV F;  5EO3 A;  2FC3 A;  3CXC F;  1KD1 H;  5GIO C;  3CC2 F;  3OBW A;  3VMF B;  3CPW F;  1S72 F;  3HAX D;  5HWE A;  3RA5 A;  3IR9 A;  1W40 A;  1M1K H;  2GLZ A;  1JJ2 F;  1VQM F;  1YIJ F;  3SIV A;  2CZW A;  3CCL F;  1Q86 H;  3GYQ A;  1YI2 F;  1VQ9 F;  2LBW A;  1SDS A;  3PAF A;  3O85 A;  4C4W C;  4BW0 B;  3PLA C;  1X7O A;  1W42 A;  1X7P A;  3CMA F;  5GAN K;  1VQ5 F;  5DCV A;  3WXM B;  5HY0 A;  3G4S F;  2VGM A;  2OTJ F;  4EI8 A;  3LWQ C;  3CCQ F;  3I56 F;  2QI2 A;  3CCM F;  1NMU B;  5FLX M;  2ALE A;  3G6E F;  1RA4 A;  3LFO A;  1K9M H;  3N4Y A;  3JAM M;  1KQS F;  4LCK A;  4EI9 A;  2OZB A;  4BVT A;  1PXW A;  2QEX F;  1KC8 H;  1VQL F;  1K8A H;  1E7K A;  1GO1 A;  5GIP C;  1VQ6 F;  2AIF A;  3AGK A;  3NK6 A;  4BY9 D;  3NMU C;  1CK2 A;  2FGY A;  1W2B F;  3NVK E;  3LWV C;  3FFM A;  4NQ3 A;  3CD6 F;  1QVG F;  3CCS F;  1GZ0 A;  1W3E X;  3CCJ F;  3CME F;  1CN7 A;  3LWP C;  3CCE F;  5GAP K;  1DT9 A;  5HY2 A;  3CCR F;  4BVR A;  3ON1 A;  3SIU A;  3CC4 F;  1QVF F;  1GO0 A;  1YIT F;  1IPA A;  2BO1 A;  1RLG A;  1VQ8 F;  3J7A R;  3CG6 A;  3NK7 A;  5A2Q M;  1VQ4 F;  2KTU A;  3LWR C;  2JNB A;  3HJW C;  4BVS A;  5HY1 A;  1VQN F;  2KTV A;  2OTL F;  2I6D A;  3E1Y A;  5HY4 A;  3LWO C;  4XCQ A;  2F9Z C;  1ZWZ A;  3E20 B;  4X3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...