3G71F

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g71F00
1VQ8F 1Q82H 2VGMA 2BO1A 3PLAC 1W40A 1YJ9F 5GIPC 1VQ7F 5DCVA 1N8RH 1NMUB 3OBYA 3V7EA 3NK7A 3G4SF 1JJ2F 3HAXD 3CC7F 4LCKA 3CC4F 1QVFF 3CG6A 3J7AR 1IPAA 5IT9M 1GO0A 2I6DA 3RA6A 3VMFB 1W3EX 3CCJF 1RA4A 4BW0B 1YJWF 1E7KA 2JNBA 1K9MH 3AGKA 2QI2A 3E20B 1PXWA 3E1YA 5GIOC 1W42A 3G71F 3CMEF 3I55F 3SIUA 1NJIH 1X52A 2LBXA 1KD1H 3LFOA 2WALA 1SDSA 3N4YA 1VQ6F 3VI6A 4NUTA 3LWOC 3LWQC 1K73H 1RLGA 3CCQF 3CCMF 3PAFA 3O85A 1XBIA 1YI2F 1S72F 2VGNA 3WXMB 2QA4F 1VQKF 3J81M 1X7PA 1YHQF 2OTLF 4BY9D 1Q86H 1K8AH 3NK6A 4X3MA 1CN7A 1KQSF 3MCAB 3CC2F 3OBWA 3CD6F 3HJWC 3I56F 1KC8H 1M90H 3CPQA 3NVIB 3NVKE 4TZZA 1DT9A 3CCLF 1W2BF 1VQOF 5A2QM 5G4VC 5GINC 3CCSF 1VQLF 1VQ4F 1YITF 3LWRC 3ON1A 3LWPC 4C4WC 2OTJF 1ZWZA 2LBWA 3CMAF 1T0KB 5EO3A 5GANK 3CXCF 2OHWA 1GO1A 2AIFA 3SIVA 2CZWA 3CCRF 1VQ5F 2OZBA 1Q81H 2FC3A 1W41A 3JCMM 3FFMA 3CPWF 2KG4A 2KTUA 2KTVA 3J80M 3N4ZA 5GAPK 3CCUF 1YJNF 3CCEF 2ALEA 4X3LA 3V7QA 1H7MA 3RA5A 3CCVF 3NMUC 5G4UC 1YIJF 5EWRA 1X7OA 3LWVC 1Q7YH 3G6EF 1VQMF 1VQ9F 5FLXM 1GZ0A 1QVGF 2QEXF 1VQPF 1VQNF 3IR9A 3GYQA 1CK2A 5FJ4C 3JAMM 1M1KH 3OW2F 2HVYD
chains in the Genus database with same CATH superfamily
1VQ8F 2ZVYA 3R0PA 5KMGA 3LYBA 4G4ZA 5EIBC 3PLAC 1U3LA 1YJ9F 2HP0B 3HKDA 3VTIC 5LP6B 5GIPC 3JARA 1N8RH 4C81A 3ZOPA 1U3PA 3OBYA 4RHAA 3WJPA 3QTYA 1W5FA 5LP6A 4X20B 4LCKA 1T0AA 4ZI7A 3JALB 5IT9M 2RHJA 2K1SA 1PF5A 2IAFA 3VMFB 2KGWA 3BYQA 4X20A 3CCJF 3WGLA 3RYHA 3RYFA 1RQ7A 5J2UB 3KE1A 3JALA 4BW0B 2H8EA 2LCAA 4TV8A 3WPXA 2QI2A 3FD5A 3E20B 5GIOC 5JVDB 3HKBA 3I55F 5CA0A 4BT4A 5J2TB 5J2UA 3LFOA 4B5CA 4X1YB 2Z1UA 3S0HA 5HY4A 3N4YA 5JVDA 4G4YA 1TUBB 2IG8A 3LWOC 1K73H 2Q1YA 4I55B 4FFBB 1S72F 2CSLA 4XCQA 3WXMB 1VQKF 1X7PA 3J81M 4X1KB 4X3MA 4ZOLB 3K0TA 3OBWA 3I56F 4BT7A 3IKFA 4FFBA 4TZZA 4ZHVA 3CCLF 4O4HA 1VQOF 1SZQA 5G4VC 5GINC 1Q8RA 1YITF 2PMPA 3ON1A 4C4WC 2R6R1 2P6YA 3K14A 3JATB 3JAKB 5GANK 2OHWA 3SIVA 2CZWA 2ZOVA 2ZVZA 3C9SA 1VQ5F 5ITZA 1JD1A 2OZBA 4IIJA 3JATA 3JAKA 4G4XA 3M4SA 4B62A 3JCMM 2F9ZC 4TUYA 1OFUA 4ZHWA 3KHNA 2KTUA 3S06A 2AIZP 3CCEF 4X3LA 5G4UC 3F0FA 4U39A 3C9TA 1X7OA 2BTUA 3HWUA 4YJ3B 4U3JB 2RHOA 5FLXM 4EI7A 3I3FA 1QVGF 3GYQA 3M84A 3C9UA 1COMA 3JAMM 3CYPB 1YGYA 3OW2F 2HVYD 3WJQA 2NMUA 2VGMA 4BT3A 4U3JA 5HXZA 3VOAA 2N48A 3LDTA 3KIZA 4HNAB 3N2GB 1ONIA 3WPWA 3FPIA 4LNUA 3V4DA 2UYJA 1NMUB 2VAWA 3NK7A 3G4SF 2UYKA 1JFFB 4O4IB 3N2GA 5IJ9B 2Z1TA 3CC7F 4EI9A 2Z01A 1QVFF 1IV1A 4I4TA 1GO0A 1ODEA 2I6DA 4I50B 4O4IA 5IJ9A 3VOBA 2UYPA 2QTPA 1W5EA 1RA4A 5IYZA 1TVKA 5JQGA 1FFXB 2Z1FA 3E1YA 4C82A 2UZHA 3S03A 3JAWB 3JASB 1KD1H 1YQNA 3F6MA 2WALA 1FFXA 5EZYB 2HP0A 2ZODA 4ERHA 2CWJA 1XHOA 2OTMA 3LWQC 4BVTA 3IEWA 4EI8A 3PAFA 1XBIA 5AVMA 2VGNA 5EZYA 5EYPB 1T0KB 1CN7A 2VXYA 3CB2A 3MCAB 4O2BB 3CC2F 4ZHYB 3HJWC 1KC8H 1UFYA 3NVIB 3NVKE 4BVSA 1DT9A 3ESJA 2G9IA 5EYPA 5A2QM 4O2BA 3ZO8A 1VQ4F 3MCQA 3LWPC 2OTJF 2LBWA 3WGNA 3JVHA 5J2TA 2UYNB 5JCOA 4DXDA 1GO1A 2AIFA 4X1YA 3D00A 4E6EA 1VK3A 3MQWA 3WJRA 3K12A 1TUBA 5LXTB 1QD9A 2VAMA 4KWEA 1W41A 1KNJA 4I55A 3WGKA 2KG4A 3F0GA 1FNKA 3J80M 3N4ZA 5GAPK 3CCUF 4X1KA 2ALEA 3NMUC 1H7MA 3I7TA 5HP8A 4ZOLA 2R751 4YJ2B 2HRUA 4C8IA 2CHTA 2HX0A 5EB1B 3S02A 3WGJA 3LWVC 4PWTA 3D01A 2QEXF 3IR9A 5B8FA 2V9YA 5CA1B 4YJ2A 1CK2A 2PHNA 3Q8HA 1UI9A 2OTLF 3N2KB 3P4EA 1Q82H 1IV2A 2BO1A 1FSZA 2L26A 2W8BC 5HWEA 5DCVA 3VO8A 4F6RB 3V7EA 3ZP7A 2CHSA 3M1XA 4G4VA 2HS3A 4O4LB 3HAXD 4TV9B 5HXUA 4F6RA 1KNKA 3J7AR 2DYYA 4O4JB 5KX5B 4O4LA 1W59A 3RA6A 1W3EX 1YJWF 1IV4A 4YJ3A 2JNBA 3VYSC 1PXWA 5LA6B 1XRGA 3CMEF 3VCZA 1X52A 1SA0B 1VHAA 5GONB 1H47A 2BTQB 2HS0A 1SDSA 5LA6A 4X1IB 3RYCB 4HNAA 3VI6A 5JH7B 2YYEA 3MDOA 3B6NA 2GVIA 2LBTA 3U0OA 3UT5B 1JFFA 1YI2F 4BY9D 1FNJA 3F0DA 4WBNB 3E22B 1KQSF 1W581 4G4WA 3FD6A 1W5AA 3UT5A 3CD6F 5MN4A 2H6LA 4I50A 1W2BF 1JN1A 4DRXB 3VYUC 3LWRC 3D54A 4C8EA 3LMEA 1ZWZA 1RQ2A 2EWCA 4DRXA 2IQQA 3JAWA 1U40A 3JASA 5EO3A 5MN6A 3HKDB 2VAPA 3JARB 3CCRF 5MN5A 2YXZA 5IJ0B 1Q81H 3RE3A 3HTNA 1W55A 1CLIA 3L7QA 3FFMA 3CPWF 4ZI7B 5IJ0A 3TD4A 2Q1XA 4NQ3A 3V7QA 3RA5A 1DBFA 1YIJF 2HP3A 3RYHB 3MBMA 3RYFB 3RYIB 5EAZA 4BT5A 4IHJB 4TV8B 3G6EF 3V3TA 1VQMF 1VQ9F 3QUWA 4B46A 1VQNF 3HKEB 1H48A 3HKBB 3ZP4A 5CA0B 5FJ4C 4G88A 3RYIA 3WGMA 1M1KH 1GX1A 2Z1EA 4IHJA 2UYNA 3C8LA 3HKEA 2HRYA 1W40A 1VQ7F 2B33A 5LOVB 5LXTA 2ZF8A 1JJ2F 1RLUA 3VYTC 1X25A 5LOVA 3F0EA 3CC4F 5EIBD 3CG6A 3IEQA 1IPAA 1VQVA 3ELCA 4BT2A 4EB6B 3CYQA 4BVRA 5C8YB 4ZHQB 1JY8A 4O2AB 4C8GA 4O4HB 4ZK7A 3DC2A 3FBAA 2H8CA 2RHLA 4EB6A 1E7KA 5HP7A 1K9MH 3AGKA 3HKCB 3EORA 5C8YA 4ZHQA 1W42A 3P10A 4O2AA 5CA1A 3G71F 2FGYA 3KJKA 5HY0A 1NJIH 3SIUA 3TD3A 2LBXA 5CB4B 3N2KA 2ZAUA 3HKCA 4NWOB 5ITZB 3GHZA 5LP6C 1J7HA 3P0ZA 1VQ6F 4IIJB 1QU9A 1U43A 4NUTA 5CB4A 3K2XA 2BTOA 1RLGA 2MQEA 3CCQF 4TUYB 3CCMF 3O85A 1QAHA 2QA4F 5EB0A 4TV9A 1YHQF 4BT6A 2CW4A 1Q86H 3NK6A 1K8AH 4R40B 4O4JA 3ERNA 5FNVB 1W57A 1XV2A 3CPQA 1M90H 5KX5A 3S0WA 3GTZA 2DT4A 3KJJA 3CCSF 3VIUA 1VQLF 3TD5A 2GZLA 3T80A 4BVQA 5FNVA 1R1MA 3QHDA 4B45A 2I6RA 2RHHA 1Z5VA 3S0YA 3CMAF 5JCOC 1OAPA 1SA0A 3C9RA 5GONA 3CXCF 4X1IA 4LNUB 3RYCA 2GLZA 5JH7A 2FC3A 5LYJB 4RQOA 5BMVB 1VH8A 2CVLA 1W5BA 2KTVA 3IKEA 1YJNF 4I4TB 5LYJA 1NQ3A 2RB9A 3E22A 4WBNA 4M8IA 5HY2A 3CCVF 5BMVA 3DDNA 2AMTA 5EWRA 5HY1A 3IMPA 5IYZB 3OONA 1TVKB 5JQGB 1Q7YH 1IV3A 1GZ0A 1VQPF 5KMGB 1Z5WA 2HQSC 2HS4A
chains in the Genus database with same CATH topology
1VQ8F 1Q82H 2VGMA 5HXZA 2BO1A 3PLAC 1W40A 5HWEA 1YJ9F 5GIPC 1VQ7F 5DCVA 1N8RH 1NMUB 3OBYA 3V7EA 3NK7A 3G4SF 1JJ2F 3HAXD 3CC7F 4EI9A 4LCKA 5HXUA 3CC4F 1QVFF 3CG6A 3J7AR 1IPAA 5IT9M 1GO0A 4BVRA 2I6DA 3RA6A 3VMFB 1W3EX 3CCJF 1RA4A 4BW0B 1YJWF 1E7KA 2JNBA 1K9MH 3AGKA 2QI2A 3E20B 1PXWA 3E1YA 5GIOC 1W42A 3G71F 3CMEF 2FGYA 3I55F 5HY0A 1NJIH 1X52A 3SIUA 2LBXA 1KD1H 3LFOA 2WALA 1SDSA 5HY4A 3N4YA 1VQ6F 3VI6A 4NUTA 3LWOC 3LWQC 4BVTA 1K73H 1RLGA 4EI8A 3CCQF 3CCMF 3PAFA 3O85A 1XBIA 1YI2F 1S72F 2VGNA 4XCQA 3WXMB 2QA4F 3J81M 1X7PA 1YHQF 1VQKF 2OTLF 1Q86H 1K8AH 3NK6A 4X3MA 4BY9D 1CN7A 1KQSF 3MCAB 3CC2F 3OBWA 3CD6F 3HJWC 3I56F 1KC8H 1M90H 3CPQA 3NVIB 3NVKE 4TZZA 4BVSA 1DT9A 3CCLF 1W2BF 1VQOF 5A2QM 5G4VC 5GINC 3CCSF 1VQLF 1VQ4F 1YITF 4BVQA 3LWRC 3ON1A 3LWPC 4C4WC 2OTJF 1ZWZA 2LBWA 3CMAF 1T0KB 5EO3A 5GANK 3CXCF 2OHWA 1GO1A 2AIFA 3SIVA 2CZWA 3D00A 3CCRF 1VQ5F 2OZBA 1Q81H 2GLZA 2FC3A 1W41A 3JCMM 2F9ZC 3FFMA 3CPWF 2KG4A 2KTUA 2KTVA 3J80M 3N4ZA 5GAPK 3CCUF 1YJNF 4NQ3A 3CCEF 2ALEA 4X3LA 3V7QA 1H7MA 3RA5A 5HY2A 3CCVF 3NMUC 1YIJF 5G4UC 5HY1A 5EWRA 1X7OA 3LWVC 1Q7YH 3G6EF 3V3TA 4EI7A 5FLXM 1GZ0A 1VQMF 2QEXF 1VQPF 1QVGF 1VQ9F 1VQNF 3IR9A 3GYQA 1CK2A 5FJ4C 3JAMM 1M1KH 3OW2F 2HVYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 F;  1Q82 H;  2VGM A;  2BO1 A;  3PLA C;  1W40 A;  1YJ9 F;  5GIP C;  1VQ7 F;  5DCV A;  1N8R H;  1NMU B;  3OBY A;  3V7E A;  3NK7 A;  3G4S F;  1JJ2 F;  3HAX D;  3CC7 F;  4LCK A;  3CC4 F;  1QVF F;  3CG6 A;  3J7A R;  1IPA A;  5IT9 M;  1GO0 A;  2I6D A;  3RA6 A;  3VMF B;  1W3E X;  3CCJ F;  1RA4 A;  4BW0 B;  1YJW F;  1E7K A;  2JNB A;  1K9M H;  3AGK A;  2QI2 A;  3E20 B;  1PXW A;  3E1Y A;  5GIO C;  1W42 A;  3G71 F;  3CME F;  3I55 F;  3SIU A;  1NJI H;  1X52 A;  2LBX A;  1KD1 H;  3LFO A;  2WAL A;  1SDS A;  3N4Y A;  1VQ6 F;  3VI6 A;  4NUT A;  3LWO C;  3LWQ C;  1K73 H;  1RLG A;  3CCQ F;  3CCM F;  3PAF A;  3O85 A;  1XBI A;  1YI2 F;  1S72 F;  2VGN A;  3WXM B;  2QA4 F;  1VQK F;  3J81 M;  1X7P A;  1YHQ F;  2OTL F;  4BY9 D;  1Q86 H;  1K8A H;  3NK6 A;  4X3M A;  1CN7 A;  1KQS F;  3MCA B;  3CC2 F;  3OBW A;  3CD6 F;  3HJW C;  3I56 F;  1KC8 H;  1M90 H;  3CPQ A;  3NVI B;  3NVK E;  4TZZ A;  1DT9 A;  3CCL F;  1W2B F;  1VQO F;  5A2Q M;  5G4V C;  5GIN C;  3CCS F;  1VQL F;  1VQ4 F;  1YIT F;  3LWR C;  3ON1 A;  3LWP C;  4C4W C;  2OTJ F;  1ZWZ A;  2LBW A;  3CMA F;  1T0K B;  5EO3 A;  5GAN K;  3CXC F;  2OHW A;  1GO1 A;  2AIF A;  3SIV A;  2CZW A;  3CCR F;  1VQ5 F;  2OZB A;  1Q81 H;  2FC3 A;  1W41 A;  3JCM M;  3FFM A;  3CPW F;  2KG4 A;  2KTU A;  2KTV A;  3J80 M;  3N4Z A;  5GAP K;  3CCU F;  1YJN F;  3CCE F;  2ALE A;  4X3L A;  3V7Q A;  1H7M A;  3RA5 A;  3CCV F;  3NMU C;  5G4U C;  1YIJ F;  5EWR A;  1X7O A;  3LWV C;  1Q7Y H;  3G6E F;  1VQM F;  1VQ9 F;  5FLX M;  1GZ0 A;  1QVG F;  2QEX F;  1VQP F;  1VQN F;  3IR9 A;  3GYQ A;  1CK2 A;  5FJ4 C;  3JAM M;  1M1K H;  3OW2 F;  2HVY D; 
#chains in the Genus database with same CATH topology
 1VQ8 F;  2ZVY A;  3R0P A;  5KMG A;  3LYB A;  4G4Z A;  5EIB C;  3PLA C;  1U3L A;  1YJ9 F;  2HP0 B;  3HKD A;  3VTI C;  5LP6 B;  5GIP C;  3JAR A;  1N8R H;  4C81 A;  3ZOP A;  1U3P A;  3OBY A;  4RHA A;  3WJP A;  3QTY A;  1W5F A;  5LP6 A;  4X20 B;  4LCK A;  1T0A A;  4ZI7 A;  3JAL B;  5IT9 M;  2RHJ A;  2K1S A;  1PF5 A;  2IAF A;  3VMF B;  2KGW A;  3BYQ A;  4X20 A;  3CCJ F;  3WGL A;  3RYH A;  3RYF A;  1RQ7 A;  5J2U B;  3KE1 A;  3JAL A;  4BW0 B;  2H8E A;  2LCA A;  4TV8 A;  3WPX A;  2QI2 A;  3FD5 A;  3E20 B;  5GIO C;  5JVD B;  3HKB A;  3I55 F;  5CA0 A;  4BT4 A;  5J2T B;  5J2U A;  3LFO A;  4B5C A;  4X1Y B;  2Z1U A;  3S0H A;  5HY4 A;  3N4Y A;  5JVD A;  4G4Y A;  1TUB B;  2IG8 A;  3LWO C;  1K73 H;  2Q1Y A;  4I55 B;  4FFB B;  1S72 F;  2CSL A;  4XCQ A;  3WXM B;  1VQK F;  1X7P A;  3J81 M;  4X1K B;  4X3M A;  4ZOL B;  3K0T A;  3OBW A;  3I56 F;  4BT7 A;  3IKF A;  4FFB A;  4TZZ A;  4ZHV A;  3CCL F;  4O4H A;  1VQO F;  1SZQ A;  5G4V C;  5GIN C;  1Q8R A;  1YIT F;  2PMP A;  3ON1 A;  4C4W C;  2R6R 1;  2P6Y A;  3K14 A;  3JAT B;  3JAK B;  5GAN K;  2OHW A;  3SIV A;  2CZW A;  2ZOV A;  2ZVZ A;  3C9S A;  1VQ5 F;  5ITZ A;  1JD1 A;  2OZB A;  4IIJ A;  3JAT A;  3JAK A;  4G4X A;  3M4S A;  4B62 A;  3JCM M;  2F9Z C;  4TUY A;  1OFU A;  4ZHW A;  3KHN A;  2KTU A;  3S06 A;  2AIZ P;  3CCE F;  4X3L A;  5G4U C;  3F0F A;  4U39 A;  3C9T A;  1X7O A;  2BTU A;  3HWU A;  4YJ3 B;  4U3J B;  2RHO A;  5FLX M;  4EI7 A;  3I3F A;  1QVG F;  3GYQ A;  3M84 A;  3C9U A;  1COM A;  3JAM M;  3CYP B;  1YGY A;  3OW2 F;  2HVY D;  3WJQ A;  2NMU A;  2VGM A;  4BT3 A;  4U3J A;  5HXZ A;  3VOA A;  2N48 A;  3LDT A;  3KIZ A;  4HNA B;  3N2G B;  1ONI A;  3WPW A;  3FPI A;  4LNU A;  3V4D A;  2UYJ A;  1NMU B;  2VAW A;  3NK7 A;  3G4S F;  2UYK A;  1JFF B;  4O4I B;  3N2G A;  5IJ9 B;  2Z1T A;  3CC7 F;  4EI9 A;  2Z01 A;  1QVF F;  1IV1 A;  4I4T A;  1GO0 A;  1ODE A;  2I6D A;  4I50 B;  4O4I A;  5IJ9 A;  3VOB A;  2UYP A;  2QTP A;  1W5E A;  1RA4 A;  5IYZ A;  1TVK A;  5JQG A;  1FFX B;  2Z1F A;  3E1Y A;  4C82 A;  2UZH A;  3S03 A;  3JAW B;  3JAS B;  1KD1 H;  1YQN A;  3F6M A;  2WAL A;  1FFX A;  5EZY B;  2HP0 A;  2ZOD A;  4ERH A;  2CWJ A;  1XHO A;  2OTM A;  3LWQ C;  4BVT A;  3IEW A;  4EI8 A;  3PAF A;  1XBI A;  5AVM A;  2VGN A;  5EZY A;  5EYP B;  1T0K B;  1CN7 A;  2VXY A;  3CB2 A;  3MCA B;  4O2B B;  3CC2 F;  4ZHY B;  3HJW C;  1KC8 H;  1UFY A;  3NVI B;  3NVK E;  4BVS A;  1DT9 A;  3ESJ A;  2G9I A;  5EYP A;  5A2Q M;  4O2B A;  3ZO8 A;  1VQ4 F;  3MCQ A;  3LWP C;  2OTJ F;  2LBW A;  3WGN A;  3JVH A;  5J2T A;  2UYN B;  5JCO A;  4DXD A;  1GO1 A;  2AIF A;  4X1Y A;  3D00 A;  4E6E A;  1VK3 A;  3MQW A;  3WJR A;  3K12 A;  1TUB A;  5LXT B;  1QD9 A;  2VAM A;  4KWE A;  1W41 A;  1KNJ A;  4I55 A;  3WGK A;  2KG4 A;  3F0G A;  1FNK A;  3J80 M;  3N4Z A;  5GAP K;  3CCU F;  4X1K A;  2ALE A;  3NMU C;  1H7M A;  3I7T A;  5HP8 A;  4ZOL A;  2R75 1;  4YJ2 B;  2HRU A;  4C8I A;  2CHT A;  2HX0 A;  5EB1 B;  3S02 A;  3WGJ A;  3LWV C;  4PWT A;  3D01 A;  2QEX F;  3IR9 A;  5B8F A;  2V9Y A;  5CA1 B;  4YJ2 A;  1CK2 A;  2PHN A;  3Q8H A;  1UI9 A;  2OTL F;  3N2K B;  3P4E A;  1Q82 H;  1IV2 A;  2BO1 A;  1FSZ A;  2L26 A;  2W8B C;  5HWE A;  5DCV A;  3VO8 A;  4F6R B;  3V7E A;  3ZP7 A;  2CHS A;  3M1X A;  4G4V A;  2HS3 A;  4O4L B;  3HAX D;  4TV9 B;  5HXU A;  4F6R A;  1KNK A;  3J7A R;  2DYY A;  4O4J B;  5KX5 B;  4O4L A;  1W59 A;  3RA6 A;  1W3E X;  1YJW F;  1IV4 A;  4YJ3 A;  2JNB A;  3VYS C;  1PXW A;  5LA6 B;  1XRG A;  3CME F;  3VCZ A;  1X52 A;  1SA0 B;  1VHA A;  5GON B;  1H47 A;  2BTQ B;  2HS0 A;  1SDS A;  5LA6 A;  4X1I B;  3RYC B;  4HNA A;  3VI6 A;  5JH7 B;  2YYE A;  3MDO A;  3B6N A;  2GVI A;  2LBT A;  3U0O A;  3UT5 B;  1JFF A;  1YI2 F;  4BY9 D;  1FNJ A;  3F0D A;  4WBN B;  3E22 B;  1KQS F;  1W58 1;  4G4W A;  3FD6 A;  1W5A A;  3UT5 A;  3CD6 F;  5MN4 A;  2H6L A;  4I50 A;  1W2B F;  1JN1 A;  4DRX B;  3VYU C;  3LWR C;  3D54 A;  4C8E A;  3LME A;  1ZWZ A;  1RQ2 A;  2EWC A;  4DRX A;  2IQQ A;  3JAW A;  1U40 A;  3JAS A;  5EO3 A;  5MN6 A;  3HKD B;  2VAP A;  3JAR B;  3CCR F;  5MN5 A;  2YXZ A;  5IJ0 B;  1Q81 H;  3RE3 A;  3HTN A;  1W55 A;  1CLI A;  3L7Q A;  3FFM A;  3CPW F;  4ZI7 B;  5IJ0 A;  3TD4 A;  2Q1X A;  4NQ3 A;  3V7Q A;  3RA5 A;  1DBF A;  1YIJ F;  2HP3 A;  3RYH B;  3MBM A;  3RYF B;  3RYI B;  5EAZ A;  4BT5 A;  4IHJ B;  4TV8 B;  3G6E F;  3V3T A;  1VQM F;  1VQ9 F;  3QUW A;  4B46 A;  1VQN F;  3HKE B;  1H48 A;  3HKB B;  3ZP4 A;  5CA0 B;  5FJ4 C;  4G88 A;  3RYI A;  3WGM A;  1M1K H;  1GX1 A;  2Z1E A;  4IHJ A;  2UYN A;  3C8L A;  3HKE A;  2HRY A;  1W40 A;  1VQ7 F;  2B33 A;  5LOV B;  5LXT A;  2ZF8 A;  1JJ2 F;  1RLU A;  3VYT C;  1X25 A;  5LOV A;  3F0E A;  3CC4 F;  5EIB D;  3CG6 A;  3IEQ A;  1IPA A;  1VQV A;  3ELC A;  4BT2 A;  4EB6 B;  3CYQ A;  4BVR A;  5C8Y B;  4ZHQ B;  1JY8 A;  4O2A B;  4C8G A;  4O4H B;  4ZK7 A;  3DC2 A;  3FBA A;  2H8C A;  2RHL A;  4EB6 A;  1E7K A;  5HP7 A;  1K9M H;  3AGK A;  3HKC B;  3EOR A;  5C8Y A;  4ZHQ A;  1W42 A;  3P10 A;  4O2A A;  5CA1 A;  3G71 F;  2FGY A;  3KJK A;  5HY0 A;  1NJI H;  3SIU A;  3TD3 A;  2LBX A;  5CB4 B;  3N2K A;  2ZAU A;  3HKC A;  4NWO B;  5ITZ B;  3GHZ A;  5LP6 C;  1J7H A;  3P0Z A;  1VQ6 F;  4IIJ B;  1QU9 A;  1U43 A;  4NUT A;  5CB4 A;  3K2X A;  2BTO A;  1RLG A;  2MQE A;  3CCQ F;  4TUY B;  3CCM F;  3O85 A;  1QAH A;  2QA4 F;  5EB0 A;  4TV9 A;  1YHQ F;  4BT6 A;  2CW4 A;  1Q86 H;  3NK6 A;  1K8A H;  4R40 B;  4O4J A;  3ERN A;  5FNV B;  1W57 A;  1XV2 A;  3CPQ A;  1M90 H;  5KX5 A;  3S0W A;  3GTZ A;  2DT4 A;  3KJJ A;  3CCS F;  3VIU A;  1VQL F;  3TD5 A;  2GZL A;  3T80 A;  4BVQ A;  5FNV A;  1R1M A;  3QHD A;  4B45 A;  2I6R A;  2RHH A;  1Z5V A;  3S0Y A;  3CMA F;  5JCO C;  1OAP A;  1SA0 A;  3C9R A;  5GON A;  3CXC F;  4X1I A;  4LNU B;  3RYC A;  2GLZ A;  5JH7 A;  2FC3 A;  5LYJ B;  4RQO A;  5BMV B;  1VH8 A;  2CVL A;  1W5B A;  2KTV A;  3IKE A;  1YJN F;  4I4T B;  5LYJ A;  1NQ3 A;  2RB9 A;  3E22 A;  4WBN A;  4M8I A;  5HY2 A;  3CCV F;  5BMV A;  3DDN A;  2AMT A;  5EWR A;  5HY1 A;  3IMP A;  5IYZ B;  3OON A;  1TVK B;  5JQG B;  1Q7Y H;  1IV3 A;  1GZ0 A;  1VQP F;  5KMG B;  1Z5W A;  2HQS C;  2HS4 A; 
#chains in the Genus database with same CATH homology
 1VQ8 F;  1Q82 H;  2VGM A;  5HXZ A;  2BO1 A;  3PLA C;  1W40 A;  5HWE A;  1YJ9 F;  5GIP C;  1VQ7 F;  5DCV A;  1N8R H;  1NMU B;  3OBY A;  3V7E A;  3NK7 A;  3G4S F;  1JJ2 F;  3HAX D;  3CC7 F;  4EI9 A;  4LCK A;  5HXU A;  3CC4 F;  1QVF F;  3CG6 A;  3J7A R;  1IPA A;  5IT9 M;  1GO0 A;  4BVR A;  2I6D A;  3RA6 A;  3VMF B;  1W3E X;  3CCJ F;  1RA4 A;  4BW0 B;  1YJW F;  1E7K A;  2JNB A;  1K9M H;  3AGK A;  2QI2 A;  3E20 B;  1PXW A;  3E1Y A;  5GIO C;  1W42 A;  3G71 F;  3CME F;  2FGY A;  3I55 F;  5HY0 A;  1NJI H;  1X52 A;  3SIU A;  2LBX A;  1KD1 H;  3LFO A;  2WAL A;  1SDS A;  5HY4 A;  3N4Y A;  1VQ6 F;  3VI6 A;  4NUT A;  3LWO C;  3LWQ C;  4BVT A;  1K73 H;  1RLG A;  4EI8 A;  3CCQ F;  3CCM F;  3PAF A;  3O85 A;  1XBI A;  1YI2 F;  1S72 F;  2VGN A;  4XCQ A;  3WXM B;  2QA4 F;  3J81 M;  1X7P A;  1YHQ F;  1VQK F;  2OTL F;  1Q86 H;  1K8A H;  3NK6 A;  4X3M A;  4BY9 D;  1CN7 A;  1KQS F;  3MCA B;  3CC2 F;  3OBW A;  3CD6 F;  3HJW C;  3I56 F;  1KC8 H;  1M90 H;  3CPQ A;  3NVI B;  3NVK E;  4TZZ A;  4BVS A;  1DT9 A;  3CCL F;  1W2B F;  1VQO F;  5A2Q M;  5G4V C;  5GIN C;  3CCS F;  1VQL F;  1VQ4 F;  1YIT F;  4BVQ A;  3LWR C;  3ON1 A;  3LWP C;  4C4W C;  2OTJ F;  1ZWZ A;  2LBW A;  3CMA F;  1T0K B;  5EO3 A;  5GAN K;  3CXC F;  2OHW A;  1GO1 A;  2AIF A;  3SIV A;  2CZW A;  3D00 A;  3CCR F;  1VQ5 F;  2OZB A;  1Q81 H;  2GLZ A;  2FC3 A;  1W41 A;  3JCM M;  2F9Z C;  3FFM A;  3CPW F;  2KG4 A;  2KTU A;  2KTV A;  3J80 M;  3N4Z A;  5GAP K;  3CCU F;  1YJN F;  4NQ3 A;  3CCE F;  2ALE A;  4X3L A;  3V7Q A;  1H7M A;  3RA5 A;  5HY2 A;  3CCV F;  3NMU C;  1YIJ F;  5G4U C;  5HY1 A;  5EWR A;  1X7O A;  3LWV C;  1Q7Y H;  3G6E F;  3V3T A;  4EI7 A;  5FLX M;  1GZ0 A;  1VQM F;  2QEX F;  1VQP F;  1QVG F;  1VQ9 F;  1VQN F;  3IR9 A;  3GYQ A;  1CK2 A;  5FJ4 C;  3JAM M;  1M1K H;  3OW2 F;  2HVY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...