3G71F

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g71F00
1KQSF 1YIJF 5GIPC 1YJNF 3CCVF 2KTVA 4X3MA 3LWQC 1K8AH 1JJ2F 1W42A 2QEXF 1RLGA 3CC4F 1VQMF 5GANK 5A2QM 1N8RH 1VQ9F 1K9MH 3GYQA 3CC7F 2JNBA 1W40A 3LWPC 1S72F 1Q7YH 1CN7A 3I55F 3CXCF 4TZZA 1E7KA 3OBWA 5G4UC 3N4YA 2OHWA 3JAMM 1M90H 3JCMM 2KTUA 2CZWA 2OTLF 1NJIH 3E1YA 3HAXD 3PLAC 1QVGF 1Q86H 3MCAB 1YITF 2KG4A 5G4VC 3CMAF 2WALA 4X3LA 1YI2F 5IT9M 2QA4F 3NMUC 1W2BF 3NVIB 5DCVA 4LCKA 1PXWA 3CCLF 1K73H 3WXMB 3J7AR 3CMEF 3O85A 1KC8H 3G4SF 3ON1A 1YJWF 2VGMA 1VQ7F 1X7OA 3E20B 4BW0B 1VQNF 2AIFA 2I6DA 1DT9A 1H7MA 3I56F 5GAPK 2OZBA 3HJWC 3CPQA 3OBYA 1VQLF 2LBWA 5FJ4C 3CCEF 2ALEA 3CCUF 3CCMF 1KD1H 3G6EF 4NUTA 1VQ8F 3LWVC 3PAFA 1VQOF 1GO1A 3CPWF 1VQ4F 4C4WC 3CD6F 1W3EX 3OW2F 3J81M 3VMFB 1T0KB 3CC2F 1SDSA 2OTJF 1XBIA 3CG6A 2HVYD 1YHQF 1M1KH 4BY9D 1YJ9F 3G71F 3AGKA 2BO1A 3IR9A 1GO0A 1VQKF 3LWRC 1IPAA 1NMUB 3CCRF 1VQPF 1Q82H 2LBXA 1CK2A 1QVFF 3FFMA 3V7EA 1GZ0A 3SIVA 3NK6A 5FLXM 3N4ZA 3CCJF 5GIOC 1W41A 3NVKE 2VGNA 3CCSF 3VI6A 5EO3A 3V7QA 1Q81H 5GINC 1VQ5F 5EWRA 2QI2A 3SIUA 1X52A 3RA5A 1X7PA 3J80M 3NK7A 3LWOC 1RA4A 2FC3A 1ZWZA 3CCQF 1VQ6F 3RA6A 3LFOA
chains in the Genus database with same CATH superfamily
1FNJA 5EIBD 3WGKA 5EYPB 3MQWA 3CCVF 4U3JA 4HNAB 3T80A 2W8BC 3GHZA 4G4XA 3LMEA 1X25A 4HNAA 4NQ3A 5AVMA 3QHDA 3QTYA 3HKDB 3S0WA 5MN6A 2LCAA 2CSLA 5J2TB 1W40A 5J2UA 3I55F 3LDTA 3S02A 3DC2A 3OBWA 1H47A 3C9RA 3UT5B 2Q1YA 5JQGA 2KTUA 1W5EA 1NJIH 2CW4A 3E1YA 4DRXA 5G4VC 2H8CA 1UI9A 1W2BF 4XCQA 4O2BB 4LCKA 4G4WA 5CA1B 5HY0A 5MN5A 4F6RA 1YJWF 3D54A 5CA1A 5EZYA 5LP6B 1X7OA 1VH8A 2CHSA 4YJ3B 4ZI7A 1DBFA 2AIZP 3K14A 1Z5VA 5LOVA 2LBWA 4TV8B 4ERHA 2YXZA 3UT5A 5B8FA 5JQGB 2VAMA 2GVIA 4NUTA 5HY4A 3S06A 5J2UB 4ZK7A 1GO1A 1VQVA 2BTQB 2BTUA 2RHHA 4R40B 3CD6F 5CA0B 1W3EX 3V4DA 5KX5A 4B5CA 5HP8A 3CC2F 1SDSA 2OTJF 5LXTB 2HVYD 3HKCA 3TD5A 2CHTA 1T0AA 4X1IB 3KE1A 3G71F 3AGKA 3LYBA 2BTOA 4ZI7B 3IMPA 4PWTA 2V9YA 2VXYA 3MDOA 5EZYB 4BT4A 3FFMA 3V7EA 1GZ0A 5CB4B 4O4JB 5FLXM 3SIVA 1FSZA 2IG8A 1ONIA 3JALA 5BMVA 3CCJF 5GIOC 1W41A 2ZAUA 2GZLA 5EO3A 1FFXA 4C81A 1Q81H 3L7QA 4I55A 2RHOA 3P10A 4FFBB 3N2GA 3CCQF 1VQ6F 1SA0B 4C8IA 3RA6A 2UYJA 3V3TA 2OTMA 5IJ9B 1YIJF 5GIPC 1KNKA 1YJNF 3IEWA 3JASA 1W581 3WJRA 4O4LA 5JVDB 2CWJA 1QD9A 2QEXF 1KNJA 5LP6C 1K9MH 3CC7F 3IEQA 3JAWA 3MCQA 5IJ9A 3CYPB 1PF5A 4U3JB 2IAFA 1CN7A 4X20B 3S0YA 1U3LA 4X1KB 4TZZA 1E7KA 1TVKA 2ZOVA 5IYZA 4WBNB 3JAMM 3F0FA 3JAKA 1M90H 2P6YA 4TUYA 3PLAC 4BT7A 1Q86H 4EI9A 2KG4A 3CMAF 2WALA 3VO8A 2AMTA 3VIUA 1FNKA 3WJQA 3VCZA 4O2AA 3J7AR 3O85A 4ZHQB 3G4SF 4X20A 1VQ7F 4G4ZA 5JCOA 1VQNF 3RYCA 1DT9A 1H7MA 2Z1TA 2RHJA 3HKEA 5GAPK 2OZBA 4BT5A 3HJWC 3JARA 4TV9A 2IQQA 2VAWA 2EWCA 3HKBB 3RYIA 3CYQA 4ZOLB 3CCMF 5CA0A 1KD1H 1SZQA 1TVKB 1VQ8F 1JFFB 3LWVC 5FNVB 4EI8A 5KMGA 3DDNA 1JY8A 2I6RA 3D00A 3RYHA 2B33A 4E6EA 1U40A 3KIZA 3OW2F 4B45A 3KJJA 1XRGA 1XBIA 3F0DA 3CG6A 1YHQF 4KWEA 3HKBA 2R751 2BO1A 2Z1UA 3IR9A 3WJPA 2UYNA 3HKEB 1VQKF 4LNUB 3LWRC 5CB4A 4I4TB 3GTZA 2LBXA 3N2GB 5EB1B 3D01A 1QAHA 2VGNA 3VI6A 3V7QA 3ERNA 4ZHYB 3C8LA 3VYTC 2QI2A 3HKCB 3VYUC 3J80M 3ZO8A 4O4JA 2GLZA 1OAPA 1U3PA 2UZHA 1VHAA 5HXUA 3CCRF 4B46A 2Z1FA 3S03A 3MBMA 3HKDA 2HP3A 1W5BA 2PMPA 1GX1A 3VOBA 4BT2A 3JVHA 4X3MA 2NMUA 1H48A 3F0EA 1K8AH 3WPWA 1JJ2F 2ZF8A 3FD5A 1RLGA 2N48A 3CC4F 2UYKA 2KGWA 5LOVB 4ZHVA 5KX5B 1N8RH 1VQ9F 5JVDA 3GYQA 2R6R1 4EB6B 2DT4A 3TD4A 3JASB 5LA6B 2RB9A 3I7TA 2L26A 3N4YA 3QUWA 1SA0A 2Z01A 3I3FA 3FPIA 3HAXD 3F0GA 1QVGF 4DRXB 3WGLA 1YI2F 5IT9M 2QA4F 5C8YA 5LP6A 1PXWA 2LBTA 2HQSC 1K73H 3WXMB 1XV2A 2UYNB 5EIBC 1KC8H 3ON1A 1W55A 2VGMA 4C8EA 4O2BA 3E20B 3WGJA 1IV2A 4EI7A 3FBAA 5C8YB 1U43A 4G88A 3I56F 4RQOA 1QU9A 4EB6A 3CPQA 1NQ3A 1OFUA 2H6LA 3WPXA 1VQLF 1RQ7A 1VK3A 2G9IA 3ESJA 3G6EF 3U0OA 5ITZA 5LXTA 3PAFA 3RYHB 4YJ2A 2VAPA 1VQOF 3WGNA 1W57A 1JFFA 3CPWF 1VQ4F 2HP0A 3M1XA 2Z1EA 4ZOLA 3VTIC 5JCOC 1T0KB 4YJ2B 1Z5WA 4G4VA 3C9TA 5HY1A 3JARB 1M1KH 5GONB 4RHAA 4O4HA 3RE3A 1R1MA 1J7HA 4TV8A 3K0TA 5EYPA 1IV4A 4G4YA 1VQPF 1QVFF 3JATA 4F6RB 3HWUA 1RQ2A 3ELCA 3NK6A 3N4ZA 3P4EA 1XHOA 3FD6A 4LNUA 4O4IA 3CCSF 1YGYA 3K2XA 5GINC 1IV3A 1VQ5F 2RHLA 3E22A 3M4SA 3SIUA 1X52A 3RA5A 4BVTA 3NK7A 3LWOC 2HRUA 2FC3A 3EORA 2HRYA 4I4TA 2ZVYA 5EB0A 3LFOA 4C8GA 1KQSF 2UYPA 4B62A 2F9ZC 5LA6A 5FNVA 2HX0A 2KTVA 3LWQC 3P0ZA 3Q8HA 4IIJB 4O4LB 1W42A 3RYIB 3VYSC 1Q8RA 1VQMF 4IHJA 5GANK 5A2QM 2HS4A 3HTNA 3IKEA 3ZP4A 2JNBA 3LWPC 1S72F 1Q7YH 2CVLA 5EAZA 3TD3A 1UFYA 4ZHQA 3ZP7A 3CXCF 2DYYA 2HS0A 4FFBA 1CLIA 3RYFB 5G4UC 3N2KB 4O2AB 2OHWA 4I55B 1JD1A 3R0PA 3JCMM 2CZWA 1TUBB 4DXDA 2OTLF 1FFXB 2PHNA 5JH7A 4TV9B 5IJ0B 3MCAB 1YITF 2MQEA 4TUYB 4X3LA 3RYCB 4BVSA 3NMUC 3NVIB 3CB2A 5DCVA 1W59A 3JAKB 5HXZA 4WBNA 3CCLF 3RYFA 3CMEF 4BT3A 4BW0B 2AIFA 2I6DA 4O4HB 5GONA 5IJ0A 3OBYA 4I50B 1W5AA 4IHJB 3WGMA 5FJ4C 3CCEF 2ALEA 3CCUF 1JN1A 4IIJA 3C9UA 5IYZB 1ODEA 3ZOPA 4U39A 1IV1A 4X1KA 4X1YB 4C82A 4BVRA 3C9SA 5ITZB 5LYJB 5LYJA 3JAWB 3VOAA 3M84A 1YQNA 4C4WC 2YYEA 3BYQA 4X1YA 3J81M 5MN4A 3VMFB 5KMGB 3S0HA 4NWOB 4ZHWA 4BY9D 2FGYA 1YJ9F 4YJ3A 4BVQA 1COMA 2Q1XA 3KHNA 3KJKA 3OONA 4I50A 3F6MA 1GO0A 2ZODA 5HP7A 1IPAA 1NMUB 1Q82H 2HS3A 1CK2A 1RLUA 4BT6A 4M8IA 3B6NA 2QTPA 3NVKE 3E22B 5HY2A 4X1IA 1W5FA 5EWRA 4O4IB 1X7PA 5BMVB 3JALB 3K12A 2H8EA 5JH7B 1RA4A 1TUBA 5HWEA 2K1SA 1ZWZA 3JATB 3N2KA 3IKFA 2HP0B 5J2TA 2ZVZA
chains in the Genus database with same CATH topology
1KQSF 1YIJF 5GIPC 2F9ZC 1YJNF 3CCVF 2KTVA 4X3MA 3LWQC 1K8AH 1JJ2F 1W42A 2QEXF 1RLGA 3CC4F 4NQ3A 1VQMF 5GANK 5A2QM 1N8RH 1VQ9F 1K9MH 3GYQA 3CC7F 2JNBA 1W40A 3LWPC 1S72F 1Q7YH 1CN7A 3I55F 3CXCF 4TZZA 1E7KA 3OBWA 5G4UC 3N4YA 2OHWA 3JAMM 1M90H 3JCMM 2KTUA 2CZWA 2OTLF 1NJIH 3E1YA 3HAXD 3PLAC 1QVGF 1Q86H 3MCAB 4EI9A 2KG4A 5G4VC 3CMAF 2WALA 4X3LA 1YITF 1YI2F 5IT9M 4BVSA 2QA4F 1W2BF 4XCQA 3NVIB 3NMUC 4LCKA 5DCVA 1PXWA 5HXZA 3CCLF 5HY0A 1K73H 3WXMB 3J7AR 3CMEF 3O85A 1KC8H 3G4SF 3ON1A 1YJWF 2VGMA 1VQ7F 4EI7A 1X7OA 3E20B 4BW0B 1VQNF 2AIFA 2I6DA 1DT9A 1H7MA 3I56F 5GAPK 2OZBA 3HJWC 3CPQA 3OBYA 1VQLF 2LBWA 5FJ4C 3CCEF 2ALEA 3CCUF 3CCMF 1KD1H 3G6EF 4NUTA 5HY4A 1VQ8F 3LWVC 3PAFA 4EI8A 1VQOF 1GO1A 3D00A 4BVRA 3CPWF 1VQ4F 4C4WC 3CD6F 1W3EX 3OW2F 3J81M 3VMFB 1T0KB 3CC2F 1SDSA 2OTJF 1XBIA 3CG6A 5HY1A 2HVYD 1YHQF 2FGYA 1M1KH 4BY9D 1YJ9F 4BVQA 3G71F 3AGKA 2BO1A 3IR9A 1GO0A 1VQKF 3LWRC 1IPAA 1NMUB 3CCRF 1VQPF 1Q82H 2LBXA 1CK2A 1QVFF 3FFMA 3V7EA 1GZ0A 3SIVA 3NK6A 5FLXM 3N4ZA 3CCJF 5GIOC 1W41A 3NVKE 2VGNA 3CCSF 3VI6A 5EO3A 3V7QA 5HY2A 1Q81H 5GINC 1VQ5F 5EWRA 2QI2A 3SIUA 1X52A 3RA5A 1X7PA 4BVTA 3J80M 3NK7A 3LWOC 1RA4A 2FC3A 2GLZA 5HWEA 1ZWZA 3CCQF 1VQ6F 3RA6A 3V3TA 5HXUA 3LFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS F;  1YIJ F;  5GIP C;  1YJN F;  3CCV F;  2KTV A;  4X3M A;  3LWQ C;  1K8A H;  1JJ2 F;  1W42 A;  2QEX F;  1RLG A;  3CC4 F;  1VQM F;  5GAN K;  5A2Q M;  1N8R H;  1VQ9 F;  1K9M H;  3GYQ A;  3CC7 F;  2JNB A;  1W40 A;  3LWP C;  1S72 F;  1Q7Y H;  1CN7 A;  3I55 F;  3CXC F;  4TZZ A;  1E7K A;  3OBW A;  5G4U C;  3N4Y A;  2OHW A;  3JAM M;  1M90 H;  3JCM M;  2KTU A;  2CZW A;  2OTL F;  1NJI H;  3E1Y A;  3HAX D;  3PLA C;  1QVG F;  1Q86 H;  3MCA B;  1YIT F;  2KG4 A;  5G4V C;  3CMA F;  2WAL A;  4X3L A;  1YI2 F;  5IT9 M;  2QA4 F;  3NMU C;  1W2B F;  3NVI B;  5DCV A;  4LCK A;  1PXW A;  3CCL F;  1K73 H;  3WXM B;  3J7A R;  3CME F;  3O85 A;  1KC8 H;  3G4S F;  3ON1 A;  1YJW F;  2VGM A;  1VQ7 F;  1X7O A;  3E20 B;  4BW0 B;  1VQN F;  2AIF A;  2I6D A;  1DT9 A;  1H7M A;  3I56 F;  5GAP K;  2OZB A;  3HJW C;  3CPQ A;  3OBY A;  1VQL F;  2LBW A;  5FJ4 C;  3CCE F;  2ALE A;  3CCU F;  3CCM F;  1KD1 H;  3G6E F;  4NUT A;  1VQ8 F;  3LWV C;  3PAF A;  1VQO F;  1GO1 A;  3CPW F;  1VQ4 F;  4C4W C;  3CD6 F;  1W3E X;  3OW2 F;  3J81 M;  3VMF B;  1T0K B;  3CC2 F;  1SDS A;  2OTJ F;  1XBI A;  3CG6 A;  2HVY D;  1YHQ F;  1M1K H;  4BY9 D;  1YJ9 F;  3G71 F;  3AGK A;  2BO1 A;  3IR9 A;  1GO0 A;  1VQK F;  3LWR C;  1IPA A;  1NMU B;  3CCR F;  1VQP F;  1Q82 H;  2LBX A;  1CK2 A;  1QVF F;  3FFM A;  3V7E A;  1GZ0 A;  3SIV A;  3NK6 A;  5FLX M;  3N4Z A;  3CCJ F;  5GIO C;  1W41 A;  3NVK E;  2VGN A;  3CCS F;  3VI6 A;  5EO3 A;  3V7Q A;  1Q81 H;  5GIN C;  1VQ5 F;  5EWR A;  2QI2 A;  3SIU A;  1X52 A;  3RA5 A;  1X7P A;  3J80 M;  3NK7 A;  3LWO C;  1RA4 A;  2FC3 A;  1ZWZ A;  3CCQ F;  1VQ6 F;  3RA6 A;  3LFO A; 
#chains in the Genus database with same CATH topology
 1FNJ A;  5EIB D;  3WGK A;  5EYP B;  3MQW A;  3CCV F;  4U3J A;  4HNA B;  3T80 A;  2W8B C;  3GHZ A;  4G4X A;  3LME A;  1X25 A;  4HNA A;  4NQ3 A;  5AVM A;  3QHD A;  3QTY A;  3HKD B;  3S0W A;  5MN6 A;  2LCA A;  2CSL A;  5J2T B;  1W40 A;  5J2U A;  3I55 F;  3LDT A;  3S02 A;  3DC2 A;  3OBW A;  1H47 A;  3C9R A;  3UT5 B;  2Q1Y A;  5JQG A;  2KTU A;  1W5E A;  1NJI H;  2CW4 A;  3E1Y A;  4DRX A;  5G4V C;  2H8C A;  1UI9 A;  1W2B F;  4XCQ A;  4O2B B;  4LCK A;  4G4W A;  5CA1 B;  5HY0 A;  5MN5 A;  4F6R A;  1YJW F;  3D54 A;  5CA1 A;  5EZY A;  5LP6 B;  1X7O A;  1VH8 A;  2CHS A;  4YJ3 B;  4ZI7 A;  1DBF A;  2AIZ P;  3K14 A;  1Z5V A;  5LOV A;  2LBW A;  4TV8 B;  4ERH A;  2YXZ A;  3UT5 A;  5B8F A;  5JQG B;  2VAM A;  2GVI A;  4NUT A;  5HY4 A;  3S06 A;  5J2U B;  4ZK7 A;  1GO1 A;  1VQV A;  2BTQ B;  2BTU A;  2RHH A;  4R40 B;  3CD6 F;  5CA0 B;  1W3E X;  3V4D A;  5KX5 A;  4B5C A;  5HP8 A;  3CC2 F;  1SDS A;  2OTJ F;  5LXT B;  2HVY D;  3HKC A;  3TD5 A;  2CHT A;  1T0A A;  4X1I B;  3KE1 A;  3G71 F;  3AGK A;  3LYB A;  2BTO A;  4ZI7 B;  3IMP A;  4PWT A;  2V9Y A;  2VXY A;  3MDO A;  5EZY B;  4BT4 A;  3FFM A;  3V7E A;  1GZ0 A;  5CB4 B;  4O4J B;  5FLX M;  3SIV A;  1FSZ A;  2IG8 A;  1ONI A;  3JAL A;  5BMV A;  3CCJ F;  5GIO C;  1W41 A;  2ZAU A;  2GZL A;  5EO3 A;  1FFX A;  4C81 A;  1Q81 H;  3L7Q A;  4I55 A;  2RHO A;  3P10 A;  4FFB B;  3N2G A;  3CCQ F;  1VQ6 F;  1SA0 B;  4C8I A;  3RA6 A;  2UYJ A;  3V3T A;  2OTM A;  5IJ9 B;  1YIJ F;  5GIP C;  1KNK A;  1YJN F;  3IEW A;  3JAS A;  1W58 1;  3WJR A;  4O4L A;  5JVD B;  2CWJ A;  1QD9 A;  2QEX F;  1KNJ A;  5LP6 C;  1K9M H;  3CC7 F;  3IEQ A;  3JAW A;  3MCQ A;  5IJ9 A;  3CYP B;  1PF5 A;  4U3J B;  2IAF A;  1CN7 A;  4X20 B;  3S0Y A;  1U3L A;  4X1K B;  4TZZ A;  1E7K A;  1TVK A;  2ZOV A;  5IYZ A;  4WBN B;  3JAM M;  3F0F A;  3JAK A;  1M90 H;  2P6Y A;  4TUY A;  3PLA C;  4BT7 A;  1Q86 H;  4EI9 A;  2KG4 A;  3CMA F;  2WAL A;  3VO8 A;  2AMT A;  3VIU A;  1FNK A;  3WJQ A;  3VCZ A;  4O2A A;  3J7A R;  3O85 A;  4ZHQ B;  3G4S F;  4X20 A;  1VQ7 F;  4G4Z A;  5JCO A;  1VQN F;  3RYC A;  1DT9 A;  1H7M A;  2Z1T A;  2RHJ A;  3HKE A;  5GAP K;  2OZB A;  4BT5 A;  3HJW C;  3JAR A;  4TV9 A;  2IQQ A;  2VAW A;  2EWC A;  3HKB B;  3RYI A;  3CYQ A;  4ZOL B;  3CCM F;  5CA0 A;  1KD1 H;  1SZQ A;  1TVK B;  1VQ8 F;  1JFF B;  3LWV C;  5FNV B;  4EI8 A;  5KMG A;  3DDN A;  1JY8 A;  2I6R A;  3D00 A;  3RYH A;  2B33 A;  4E6E A;  1U40 A;  3KIZ A;  3OW2 F;  4B45 A;  3KJJ A;  1XRG A;  1XBI A;  3F0D A;  3CG6 A;  1YHQ F;  4KWE A;  3HKB A;  2R75 1;  2BO1 A;  2Z1U A;  3IR9 A;  3WJP A;  2UYN A;  3HKE B;  1VQK F;  4LNU B;  3LWR C;  5CB4 A;  4I4T B;  3GTZ A;  2LBX A;  3N2G B;  5EB1 B;  3D01 A;  1QAH A;  2VGN A;  3VI6 A;  3V7Q A;  3ERN A;  4ZHY B;  3C8L A;  3VYT C;  2QI2 A;  3HKC B;  3VYU C;  3J80 M;  3ZO8 A;  4O4J A;  2GLZ A;  1OAP A;  1U3P A;  2UZH A;  1VHA A;  5HXU A;  3CCR F;  4B46 A;  2Z1F A;  3S03 A;  3MBM A;  3HKD A;  2HP3 A;  1W5B A;  2PMP A;  1GX1 A;  3VOB A;  4BT2 A;  3JVH A;  4X3M A;  2NMU A;  1H48 A;  3F0E A;  1K8A H;  3WPW A;  1JJ2 F;  2ZF8 A;  3FD5 A;  1RLG A;  2N48 A;  3CC4 F;  2UYK A;  2KGW A;  5LOV B;  4ZHV A;  5KX5 B;  1N8R H;  1VQ9 F;  5JVD A;  3GYQ A;  2R6R 1;  4EB6 B;  2DT4 A;  3TD4 A;  3JAS B;  5LA6 B;  2RB9 A;  3I7T A;  2L26 A;  3N4Y A;  3QUW A;  1SA0 A;  2Z01 A;  3I3F A;  3FPI A;  3HAX D;  3F0G A;  1QVG F;  4DRX B;  3WGL A;  1YI2 F;  5IT9 M;  2QA4 F;  5C8Y A;  5LP6 A;  1PXW A;  2LBT A;  2HQS C;  1K73 H;  3WXM B;  1XV2 A;  2UYN B;  5EIB C;  1KC8 H;  3ON1 A;  1W55 A;  2VGM A;  4C8E A;  4O2B A;  3E20 B;  3WGJ A;  1IV2 A;  4EI7 A;  3FBA A;  5C8Y B;  1U43 A;  4G88 A;  3I56 F;  4RQO A;  1QU9 A;  4EB6 A;  3CPQ A;  1NQ3 A;  1OFU A;  2H6L A;  3WPX A;  1VQL F;  1RQ7 A;  1VK3 A;  2G9I A;  3ESJ A;  3G6E F;  3U0O A;  5ITZ A;  5LXT A;  3PAF A;  3RYH B;  4YJ2 A;  2VAP A;  1VQO F;  3WGN A;  1W57 A;  1JFF A;  3CPW F;  1VQ4 F;  2HP0 A;  3M1X A;  2Z1E A;  4ZOL A;  3VTI C;  5JCO C;  1T0K B;  4YJ2 B;  1Z5W A;  4G4V A;  3C9T A;  5HY1 A;  3JAR B;  1M1K H;  5GON B;  4RHA A;  4O4H A;  3RE3 A;  1R1M A;  1J7H A;  4TV8 A;  3K0T A;  5EYP A;  1IV4 A;  4G4Y A;  1VQP F;  1QVF F;  3JAT A;  4F6R B;  3HWU A;  1RQ2 A;  3ELC A;  3NK6 A;  3N4Z A;  3P4E A;  1XHO A;  3FD6 A;  4LNU A;  4O4I A;  3CCS F;  1YGY A;  3K2X A;  5GIN C;  1IV3 A;  1VQ5 F;  2RHL A;  3E22 A;  3M4S A;  3SIU A;  1X52 A;  3RA5 A;  4BVT A;  3NK7 A;  3LWO C;  2HRU A;  2FC3 A;  3EOR A;  2HRY A;  4I4T A;  2ZVY A;  5EB0 A;  3LFO A;  4C8G A;  1KQS F;  2UYP A;  4B62 A;  2F9Z C;  5LA6 A;  5FNV A;  2HX0 A;  2KTV A;  3LWQ C;  3P0Z A;  3Q8H A;  4IIJ B;  4O4L B;  1W42 A;  3RYI B;  3VYS C;  1Q8R A;  1VQM F;  4IHJ A;  5GAN K;  5A2Q M;  2HS4 A;  3HTN A;  3IKE A;  3ZP4 A;  2JNB A;  3LWP C;  1S72 F;  1Q7Y H;  2CVL A;  5EAZ A;  3TD3 A;  1UFY A;  4ZHQ A;  3ZP7 A;  3CXC F;  2DYY A;  2HS0 A;  4FFB A;  1CLI A;  3RYF B;  5G4U C;  3N2K B;  4O2A B;  2OHW A;  4I55 B;  1JD1 A;  3R0P A;  3JCM M;  2CZW A;  1TUB B;  4DXD A;  2OTL F;  1FFX B;  2PHN A;  5JH7 A;  4TV9 B;  5IJ0 B;  3MCA B;  1YIT F;  2MQE A;  4TUY B;  4X3L A;  3RYC B;  4BVS A;  3NMU C;  3NVI B;  3CB2 A;  5DCV A;  1W59 A;  3JAK B;  5HXZ A;  4WBN A;  3CCL F;  3RYF A;  3CME F;  4BT3 A;  4BW0 B;  2AIF A;  2I6D A;  4O4H B;  5GON A;  5IJ0 A;  3OBY A;  4I50 B;  1W5A A;  4IHJ B;  3WGM A;  5FJ4 C;  3CCE F;  2ALE A;  3CCU F;  1JN1 A;  4IIJ A;  3C9U A;  5IYZ B;  1ODE A;  3ZOP A;  4U39 A;  1IV1 A;  4X1K A;  4X1Y B;  4C82 A;  4BVR A;  3C9S A;  5ITZ B;  5LYJ B;  5LYJ A;  3JAW B;  3VOA A;  3M84 A;  1YQN A;  4C4W C;  2YYE A;  3BYQ A;  4X1Y A;  3J81 M;  5MN4 A;  3VMF B;  5KMG B;  3S0H A;  4NWO B;  4ZHW A;  4BY9 D;  2FGY A;  1YJ9 F;  4YJ3 A;  4BVQ A;  1COM A;  2Q1X A;  3KHN A;  3KJK A;  3OON A;  4I50 A;  3F6M A;  1GO0 A;  2ZOD A;  5HP7 A;  1IPA A;  1NMU B;  1Q82 H;  2HS3 A;  1CK2 A;  1RLU A;  4BT6 A;  4M8I A;  3B6N A;  2QTP A;  3NVK E;  3E22 B;  5HY2 A;  4X1I A;  1W5F A;  5EWR A;  4O4I B;  1X7P A;  5BMV B;  3JAL B;  3K12 A;  2H8E A;  5JH7 B;  1RA4 A;  1TUB A;  5HWE A;  2K1S A;  1ZWZ A;  3JAT B;  3N2K A;  3IKF A;  2HP0 B;  5J2T A;  2ZVZ A; 
#chains in the Genus database with same CATH homology
 1KQS F;  1YIJ F;  5GIP C;  2F9Z C;  1YJN F;  3CCV F;  2KTV A;  4X3M A;  3LWQ C;  1K8A H;  1JJ2 F;  1W42 A;  2QEX F;  1RLG A;  3CC4 F;  4NQ3 A;  1VQM F;  5GAN K;  5A2Q M;  1N8R H;  1VQ9 F;  1K9M H;  3GYQ A;  3CC7 F;  2JNB A;  1W40 A;  3LWP C;  1S72 F;  1Q7Y H;  1CN7 A;  3I55 F;  3CXC F;  4TZZ A;  1E7K A;  3OBW A;  5G4U C;  3N4Y A;  2OHW A;  3JAM M;  1M90 H;  3JCM M;  2KTU A;  2CZW A;  2OTL F;  1NJI H;  3E1Y A;  3HAX D;  3PLA C;  1QVG F;  1Q86 H;  3MCA B;  4EI9 A;  2KG4 A;  5G4V C;  3CMA F;  2WAL A;  4X3L A;  1YIT F;  1YI2 F;  5IT9 M;  4BVS A;  2QA4 F;  1W2B F;  4XCQ A;  3NVI B;  3NMU C;  4LCK A;  5DCV A;  1PXW A;  5HXZ A;  3CCL F;  5HY0 A;  1K73 H;  3WXM B;  3J7A R;  3CME F;  3O85 A;  1KC8 H;  3G4S F;  3ON1 A;  1YJW F;  2VGM A;  1VQ7 F;  4EI7 A;  1X7O A;  3E20 B;  4BW0 B;  1VQN F;  2AIF A;  2I6D A;  1DT9 A;  1H7M A;  3I56 F;  5GAP K;  2OZB A;  3HJW C;  3CPQ A;  3OBY A;  1VQL F;  2LBW A;  5FJ4 C;  3CCE F;  2ALE A;  3CCU F;  3CCM F;  1KD1 H;  3G6E F;  4NUT A;  5HY4 A;  1VQ8 F;  3LWV C;  3PAF A;  4EI8 A;  1VQO F;  1GO1 A;  3D00 A;  4BVR A;  3CPW F;  1VQ4 F;  4C4W C;  3CD6 F;  1W3E X;  3OW2 F;  3J81 M;  3VMF B;  1T0K B;  3CC2 F;  1SDS A;  2OTJ F;  1XBI A;  3CG6 A;  5HY1 A;  2HVY D;  1YHQ F;  2FGY A;  1M1K H;  4BY9 D;  1YJ9 F;  4BVQ A;  3G71 F;  3AGK A;  2BO1 A;  3IR9 A;  1GO0 A;  1VQK F;  3LWR C;  1IPA A;  1NMU B;  3CCR F;  1VQP F;  1Q82 H;  2LBX A;  1CK2 A;  1QVF F;  3FFM A;  3V7E A;  1GZ0 A;  3SIV A;  3NK6 A;  5FLX M;  3N4Z A;  3CCJ F;  5GIO C;  1W41 A;  3NVK E;  2VGN A;  3CCS F;  3VI6 A;  5EO3 A;  3V7Q A;  5HY2 A;  1Q81 H;  5GIN C;  1VQ5 F;  5EWR A;  2QI2 A;  3SIU A;  1X52 A;  3RA5 A;  1X7P A;  4BVT A;  3J80 M;  3NK7 A;  3LWO C;  1RA4 A;  2FC3 A;  2GLZ A;  5HWE A;  1ZWZ A;  3CCQ F;  1VQ6 F;  3RA6 A;  3V3T A;  5HXU A;  3LFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...