3G71F

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g71F00
1VQ4F 5IT9M 1YHQF 1W41A 5GINC 1Q7YH 2CZWA 3OW2F 3J81M 3RA6A 1X7OA 3CCMF 3CG6A 1VQ5F 3VI6A 1M90H 1VQKF 3CC7F 1KC8H 2BO1A 1Q86H 4LCKA 1CK2A 3CCLF 1VQ9F 3I56F 4NUTA 3E20B 1KQSF 1XBIA 1VQOF 3SIVA 5GAPK 1JJ2F 3CCRF 2VGMA 1ZWZA 3NVKE 1T0KB 1W40A 2QA4F 3G71F 3I55F 5GIOC 3CCVF 3CCQF 3RA5A 2OZBA 3OBYA 1H7MA 2AIFA 1CN7A 5G4UC 1YJNF 1PXWA 3CMAF 4C4WC 1X7PA 5G4VC 1K8AH 1GZ0A 2WALA 2JNBA 4X3MA 3V7EA 1RLGA 3WXMB 2KTUA 2FC3A 1DT9A 3CCSF 3CPWF 1YI2F 3LWQC 3JAMM 2HVYD 1W2BF 3LWPC 3SIUA 3CMEF 1VQNF 3G4SF 3E1YA 2QEXF 3CCEF 3GYQA 2OTLF 5A2QM 1VQLF 1NMUB 3LWRC 1GO0A 3V7QA 1X52A 3HJWC 3IR9A 3CCUF 1K9MH 3J80M 1K73H 1IPAA 5GANK 3NK6A 2OHWA 3FFMA 1YJ9F 3LFOA 2VGNA 2ALEA 2OTJF 5FJ4C 3LWVC 5FLXM 4TZZA 4BY9D 3CC2F 2I6DA 3PAFA 1Q82H 3HAXD 1VQ7F 5EWRA 1VQ8F 1QVFF 3NK7A 1W3EX 3CXCF 3NVIB 2KTVA 3N4YA 5EO3A 1E7KA 3CPQA 3NMUC 2LBWA 3PLAC 1KD1H 5DCVA 3OBWA 4X3LA 1S72F 1W42A 1M1KH 2LBXA 3CCJF 1YITF 1NJIH 1GO1A 5GIPC 3CC4F 1VQ6F 3JCMM 3N4ZA 3G6EF 1N8RH 1YJWF 3J7AR 3LWOC 1Q81H 1SDSA 3MCAB 3VMFB 4BW0B 2QI2A 3O85A 1YIJF 3ON1A 1QVGF 3CD6F 1VQPF 2KG4A 1VQMF 1RA4A 3AGKA
chains in the Genus database with same CATH superfamily
4I55A 5JQGA 1W5FA 1W41A 5GINC 5LA6B 1Q7YH 3ZP4A 4ZI7B 3RA6A 3CCMF 2HX0A 4TV9B 4I55B 5JQGB 2NMUA 1IV2A 4BT6A 2Z1FA 3HWUA 2BO1A 5CA1A 1UI9A 1VQ9F 4NUTA 1VQOF 3SIVA 5LYJA 1JJ2F 5KX5A 4O4LB 1T0KB 2QA4F 2Z1TA 3VTIC 5HY1A 2L26A 3CCQF 5LYJB 3RA5A 2OZBA 5KX5B 3KHNA 3JATA 3CMAF 1X7PA 5HY0A 3QHDA 1GZ0A 2WALA 3QTYA 4X3MA 3V7EA 2IQQA 4ZHWA 5B8FA 2HRUA 3JATB 2FC3A 2HS0A 3D54A 5EZYA 2VAPA 4IHJB 1RQ2A 2AIZP 1XV2A 2R6R1 3E1YA 3ERNA 3QUWA 3CCEF 3GYQA 4I50A 3TD3A 3U0OA 2HP0A 5LP6C 3RYIB 3F0DA 3CCUF 2RHJA 4I50B 1NQ3A 5LP6A 1W59A 3IKFA 2HP0B 2W8BC 3FFMA 1QAHA 1YJ9F 2Q1XA 2IG8A 4ZK7A 1J7HA 2VGNA 3V3TA 1Z5VA 3LWVC 5BMVA 2OTMA 4BY9D 4B62A 3CC2F 4X1YA 3C9RA 2PHNA 1W5BA 2HS4A 2AMTA 3FBAA 3N4YA 5FNVA 5BMVB 4X1YB 5JH7B 4G88A 3NMUC 1KD1H 4G4XA 5FNVB 5DCVA 1S72F 2MQEA 1W42A 2LBXA 2RHLA 3DDNA 3RYHA 1YITF 1NJIH 3WJQA 1GO1A 3JCMM 3N2GA 3KJKA 4HNAA 3I7TA 1SDSA 5ITZA 2IAFA 3M1XA 2K1SA 4U3JB 4X1KB 3K2XA 4BW0B 1YIJF 3N2GB 2PMPA 4HNAB 4KWEA 3WPXA 3M84A 5ITZB 3ON1A 3IEQA 3F6MA 4DXDA 3ELCA 1RA4A 1VQ4F 4ZOLA 3C9UA 1FNKA 2I6RA 1IV1A 3OONA 4PWTA 2CZWA 3OW2F 1JY8A 1XHOA 2Z1EA 3CG6A 4G4VA 4NQ3A 4ZOLB 5IJ9B 1M90H 2VXYA 4O2AA 1OFUA 3IMPA 4O4JA 3Q8HA 1KQSF 1XBIA 4O2AB 2VGMA 1ZWZA 4O4JB 3NVKE 4EI7A 4ERHA 3FD6A 5HP8A 4C82A 3CCVF 4O2BA 4BT4A 1H7MA 4R40B 1CN7A 1W55A 5EB0A 3S0WA 4EI9A 5G4UC 1PXWA 4C4WC 4O2BB 4B45A 4C8GA 5HY4A 1K8AH 3LDTA 1DT9A 1YI2F 2GLZA 3UT5A 2HVYD 2UYPA 3T80A 1YQNA 4O4LA 1W2BF 2VAWA 5C8YA 3SIUA 1W5EA 3FD5A 4WBNB 3F0EA 2LBTA 1VQNF 3UT5B 3HTNA 5A2QM 5C8YB 2CSLA 2EWCA 1NMUB 4LNUA 4BT3A 3TD4A 3LWRC 3F0GA 3V7QA 1GO0A 2F9ZC 1SZQA 3IKEA 3MBMA 3IR9A 3JAWA 1K9MH 3P10A 1IPAA 5J2TA 4LNUB 3VYSC 4ZHQA 1W57A 4IHJA 2HP3A 3HKEB 2ALEA 3JAWB 3K14A 5FLXM 2HS3A 5J2TB 4TZZA 4ZHQB 5EWRA 1VQ7F 3NK7A 1W3EX 2CHSA 2CHTA 2KTVA 3RYIA 2ZOVA 4BVTA 3RE3A 2LBWA 3JARA 4X1IB 3BYQA 3S02A 3JAKB 3WGLA 1M1KH 2CWJA 3FPIA 3V4DA 3JARB 1FSZA 5GIPC 3CC4F 1JFFA 4O4HA 5LOVA 3LWOC 3VOBA 3F0FA 1Q81H 2BTOA 3S03A 3VMFB 1JFFB 1H48A 2QI2A 3O85A 4O4HB 5JH7A 5LOVB 5GONB 1QVGF 5IJ0A 3WPWA 1VQPF 3VOAA 1VHAA 2B33A 1KNJA 3AGKA 1RLUA 1YHQF 5IJ0B 1X25A 3J81M 1X7OA 2BTUA 2YXZA 2H8EA 4U3JA 4X1KA 5LXTA 3VCZA 1TUBA 5CA0A 2RB9A 1JN1A 3JVHA 1CK2A 3CCLF 3WGKA 5LXTB 3HKCA 3RYFA 1TUBB 5CA0B 3CYQA 3CCRF 3HKDA 3D00A 3G71F 1OAPA 5GIOC 3HKCB 3RYFB 4DRXA 4EB6A 5EIBD 1QU9A 2YYEA 3OBYA 2AIFA 1U3PA 3HKDB 4ZHYB 3VO8A 5IJ9A 1U3LA 3GHZA 4NWOB 1YJNF 4X20A 4DRXB 4EB6B 5EIBC 2JNBA 3WXMB 3VIUA 4BT7A 4X20B 3CCSF 4B5CA 3CPWF 3LWQC 1JD1A 3RYCA 3JALB 3JAMM 3D01A 4BVQA 3CMEF 4G4ZA 1UFYA 3RYCB 2OTLF 5HP7A 1VQLF 4BVRA 3EORA 1VK3A 1X52A 3HJWC 5HY2A 4ZHVA 1U43A 4YJ3A 3J80M 1K73H 5GANK 3MQWA 3VYUC 2P6YA 2KGWA 2QTPA 4YJ3B 2OTJF 5FJ4C 4WBNA 1Q82H 3P4EA 3PAFA 3HAXD 3KJJA 1VQ8F 3GTZA 4BT5A 3CXCF 3NVIB 2RHOA 3S0HA 2N48A 5EO3A 1PF5A 3HKBA 3CPQA 3ZO8A 3WGNA 2Q1YA 3WGJA 4XCQA 1SA0B 1ONIA 2UYNA 5JVDA 4YJ2A 5CB4B 3HKBB 3OBWA 4X3LA 3M4SA 5KMGA 3HKEA 3KIZA 2UYNB 5JVDB 1VQ6F 4YJ2B 1N8RH 1YJWF 3CB2A 4G4WA 5KMGB 3ESJA 5HWEA 3L7QA 4BT2A 1T0AA 3DC2A 3MCAB 1H47A 4EI8A 1XRGA 2GVIA 3C9TA 4BVSA 5CA1B 2GZLA 4X1IA 3CD6F 2ZF8A 3JAKA 1CLIA 5JCOC 1COMA 4FFBA 4U39A 4TUYA 2KG4A 5JCOA 5IT9M 1FFXA 1ODEA 3JASA 2DYYA 4FFBB 2ZAUA 4TUYB 5MN6A 2UYJA 1VQ5F 1TVKA 3R0PA 3VI6A 4C8EA 1FFXB 1IV4A 2BTQB 2ZVZA 4C8IA 1VQKF 3CC7F 3JASB 3ZP7A 1KC8H 3LYBA 1Q86H 4LCKA 5GONA 1TVKB 3I56F 2Z1UA 3E20B 3I3FA 2HRYA 5MN4A 5GAPK 4F6RA 4I4TA 1IV3A 5HXZA 5EZYB 1W40A 2ZVYA 2ZODA 3I55F 2H8CA 4F6RB 2FGYA 4I4TB 4IIJA 2Z01A 3K12A 3TD5A 2G9IA 1YGYA 4E6EA 4RQOA 5EAZA 1W581 4IIJB 5G4VC 2CW4A 2RHHA 1RLGA 5EB1B 5LP6B 2KTUA 3MCQA 2DT4A 1FNJA 3S06A 1VQVA 2UZHA 3E22A 3LWPC 3WJPA 3C8LA 3C9SA 5MN5A 5EYPA 4RHAA 3WJRA 3G4SF 2QEXF 1KNKA 2V9YA 5J2UA 4O4IA 3K0TA 3E22B 4B46A 3KE1A 4TV8A 5EYPB 1U40A 1R1MA 5J2UB 4O4IB 5HXUA 1DBFA 2R751 3VYTC 3NK6A 2OHWA 4TV8B 3LFOA 4C81A 1VH8A 3JALA 3RYHB 1W5AA 2H6LA 2I6DA 3B6NA 3LMEA 1QVFF 1E7KA 1Z5WA 3PLAC 1Q8RA 2LCAA 1QD9A 3IEWA 1GX1A 3N2KA 3S0YA 4G4YA 5AVMA 3ZOPA 1RQ7A 3CCJF 3N2KB 3N4ZA 3G6EF 3J7AR 2VAMA 5IYZA 3CYPB 2CVLA 1SA0A 5CB4A 2HQSC 3MDOA 5IYZB 5LA6A 2UYKA 4ZI7A 3P0ZA 3WGMA 4M8IA 4TV9A 1VQMF
chains in the Genus database with same CATH topology
1VQ4F 5IT9M 1YHQF 1W41A 5GINC 1Q7YH 2CZWA 3OW2F 3J81M 3RA6A 1X7OA 3CCMF 3CG6A 1VQ5F 4NQ3A 3VI6A 1M90H 1VQKF 3CC7F 1KC8H 2BO1A 1Q86H 4LCKA 1CK2A 3CCLF 1VQ9F 3I56F 4NUTA 3E20B 1KQSF 1XBIA 1VQOF 3SIVA 5GAPK 5HXZA 1JJ2F 3CCRF 2VGMA 1ZWZA 3D00A 3NVKE 4EI7A 1T0KB 1W40A 2QA4F 3G71F 5HY1A 5GIOC 3I55F 3CCVF 3CCQF 3RA5A 2FGYA 2OZBA 3OBYA 1H7MA 2AIFA 1CN7A 5G4UC 4EI9A 1YJNF 1PXWA 3CMAF 4C4WC 1X7PA 5HY0A 5HY4A 5G4VC 1K8AH 1GZ0A 2WALA 2JNBA 4X3MA 3V7EA 1RLGA 3WXMB 2KTUA 2FC3A 1DT9A 3CCSF 2GLZA 3CPWF 1YI2F 3LWQC 3JAMM 2HVYD 1W2BF 3LWPC 3SIUA 4BVQA 3CMEF 1VQNF 3G4SF 3E1YA 2QEXF 3CCEF 3GYQA 2OTLF 5A2QM 1VQLF 4BVRA 1NMUB 3LWRC 1GO0A 3V7QA 2F9ZC 1X52A 3HJWC 5HY2A 3IR9A 3CCUF 1K9MH 5HXUA 3J80M 1K73H 1IPAA 5GANK 3NK6A 2OHWA 3FFMA 1YJ9F 3LFOA 2VGNA 2ALEA 3V3TA 2OTJF 5FJ4C 3LWVC 5FLXM 4TZZA 4BY9D 3CC2F 2I6DA 3PAFA 1Q82H 3HAXD 1VQ7F 5EWRA 1VQ8F 1QVFF 3NK7A 1W3EX 3CXCF 3NVIB 2KTVA 3N4YA 5EO3A 1E7KA 3CPQA 4BVTA 3NMUC 2LBWA 4XCQA 3PLAC 1KD1H 5DCVA 3OBWA 4X3LA 1S72F 1W42A 1M1KH 2LBXA 3CCJF 1YITF 1NJIH 1GO1A 5GIPC 3CC4F 1VQ6F 3JCMM 3N4ZA 3G6EF 1N8RH 1YJWF 3J7AR 3LWOC 1Q81H 5HWEA 1SDSA 3MCAB 3VMFB 4EI8A 4BW0B 2QI2A 3O85A 1YIJF 4BVSA 3ON1A 1QVGF 3CD6F 1VQPF 2KG4A 1VQMF 1RA4A 3AGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 F;  5IT9 M;  1YHQ F;  1W41 A;  5GIN C;  1Q7Y H;  2CZW A;  3OW2 F;  3J81 M;  3RA6 A;  1X7O A;  3CCM F;  3CG6 A;  1VQ5 F;  3VI6 A;  1M90 H;  1VQK F;  3CC7 F;  1KC8 H;  2BO1 A;  1Q86 H;  4LCK A;  1CK2 A;  3CCL F;  1VQ9 F;  3I56 F;  4NUT A;  3E20 B;  1KQS F;  1XBI A;  1VQO F;  3SIV A;  5GAP K;  1JJ2 F;  3CCR F;  2VGM A;  1ZWZ A;  3NVK E;  1T0K B;  1W40 A;  2QA4 F;  3G71 F;  3I55 F;  5GIO C;  3CCV F;  3CCQ F;  3RA5 A;  2OZB A;  3OBY A;  1H7M A;  2AIF A;  1CN7 A;  5G4U C;  1YJN F;  1PXW A;  3CMA F;  4C4W C;  1X7P A;  5G4V C;  1K8A H;  1GZ0 A;  2WAL A;  2JNB A;  4X3M A;  3V7E A;  1RLG A;  3WXM B;  2KTU A;  2FC3 A;  1DT9 A;  3CCS F;  3CPW F;  1YI2 F;  3LWQ C;  3JAM M;  2HVY D;  1W2B F;  3LWP C;  3SIU A;  3CME F;  1VQN F;  3G4S F;  3E1Y A;  2QEX F;  3CCE F;  3GYQ A;  2OTL F;  5A2Q M;  1VQL F;  1NMU B;  3LWR C;  1GO0 A;  3V7Q A;  1X52 A;  3HJW C;  3IR9 A;  3CCU F;  1K9M H;  3J80 M;  1K73 H;  1IPA A;  5GAN K;  3NK6 A;  2OHW A;  3FFM A;  1YJ9 F;  3LFO A;  2VGN A;  2ALE A;  2OTJ F;  5FJ4 C;  3LWV C;  5FLX M;  4TZZ A;  4BY9 D;  3CC2 F;  2I6D A;  3PAF A;  1Q82 H;  3HAX D;  1VQ7 F;  5EWR A;  1VQ8 F;  1QVF F;  3NK7 A;  1W3E X;  3CXC F;  3NVI B;  2KTV A;  3N4Y A;  5EO3 A;  1E7K A;  3CPQ A;  3NMU C;  2LBW A;  3PLA C;  1KD1 H;  5DCV A;  3OBW A;  4X3L A;  1S72 F;  1W42 A;  1M1K H;  2LBX A;  3CCJ F;  1YIT F;  1NJI H;  1GO1 A;  5GIP C;  3CC4 F;  1VQ6 F;  3JCM M;  3N4Z A;  3G6E F;  1N8R H;  1YJW F;  3J7A R;  3LWO C;  1Q81 H;  1SDS A;  3MCA B;  3VMF B;  4BW0 B;  2QI2 A;  3O85 A;  1YIJ F;  3ON1 A;  1QVG F;  3CD6 F;  1VQP F;  2KG4 A;  1VQM F;  1RA4 A;  3AGK A; 
#chains in the Genus database with same CATH topology
 4I55 A;  5JQG A;  1W5F A;  1W41 A;  5GIN C;  5LA6 B;  1Q7Y H;  3ZP4 A;  4ZI7 B;  3RA6 A;  3CCM F;  2HX0 A;  4TV9 B;  4I55 B;  5JQG B;  2NMU A;  1IV2 A;  4BT6 A;  2Z1F A;  3HWU A;  2BO1 A;  5CA1 A;  1UI9 A;  1VQ9 F;  4NUT A;  1VQO F;  3SIV A;  5LYJ A;  1JJ2 F;  5KX5 A;  4O4L B;  1T0K B;  2QA4 F;  2Z1T A;  3VTI C;  5HY1 A;  2L26 A;  3CCQ F;  5LYJ B;  3RA5 A;  2OZB A;  5KX5 B;  3KHN A;  3JAT A;  3CMA F;  1X7P A;  5HY0 A;  3QHD A;  1GZ0 A;  2WAL A;  3QTY A;  4X3M A;  3V7E A;  2IQQ A;  4ZHW A;  5B8F A;  2HRU A;  3JAT B;  2FC3 A;  2HS0 A;  3D54 A;  5EZY A;  2VAP A;  4IHJ B;  1RQ2 A;  2AIZ P;  1XV2 A;  2R6R 1;  3E1Y A;  3ERN A;  3QUW A;  3CCE F;  3GYQ A;  4I50 A;  3TD3 A;  3U0O A;  2HP0 A;  5LP6 C;  3RYI B;  3F0D A;  3CCU F;  2RHJ A;  4I50 B;  1NQ3 A;  5LP6 A;  1W59 A;  3IKF A;  2HP0 B;  2W8B C;  3FFM A;  1QAH A;  1YJ9 F;  2Q1X A;  2IG8 A;  4ZK7 A;  1J7H A;  2VGN A;  3V3T A;  1Z5V A;  3LWV C;  5BMV A;  2OTM A;  4BY9 D;  4B62 A;  3CC2 F;  4X1Y A;  3C9R A;  2PHN A;  1W5B A;  2HS4 A;  2AMT A;  3FBA A;  3N4Y A;  5FNV A;  5BMV B;  4X1Y B;  5JH7 B;  4G88 A;  3NMU C;  1KD1 H;  4G4X A;  5FNV B;  5DCV A;  1S72 F;  2MQE A;  1W42 A;  2LBX A;  2RHL A;  3DDN A;  3RYH A;  1YIT F;  1NJI H;  3WJQ A;  1GO1 A;  3JCM M;  3N2G A;  3KJK A;  4HNA A;  3I7T A;  1SDS A;  5ITZ A;  2IAF A;  3M1X A;  2K1S A;  4U3J B;  4X1K B;  3K2X A;  4BW0 B;  1YIJ F;  3N2G B;  2PMP A;  4HNA B;  4KWE A;  3WPX A;  3M84 A;  5ITZ B;  3ON1 A;  3IEQ A;  3F6M A;  4DXD A;  3ELC A;  1RA4 A;  1VQ4 F;  4ZOL A;  3C9U A;  1FNK A;  2I6R A;  1IV1 A;  3OON A;  4PWT A;  2CZW A;  3OW2 F;  1JY8 A;  1XHO A;  2Z1E A;  3CG6 A;  4G4V A;  4NQ3 A;  4ZOL B;  5IJ9 B;  1M90 H;  2VXY A;  4O2A A;  1OFU A;  3IMP A;  4O4J A;  3Q8H A;  1KQS F;  1XBI A;  4O2A B;  2VGM A;  1ZWZ A;  4O4J B;  3NVK E;  4EI7 A;  4ERH A;  3FD6 A;  5HP8 A;  4C82 A;  3CCV F;  4O2B A;  4BT4 A;  1H7M A;  4R40 B;  1CN7 A;  1W55 A;  5EB0 A;  3S0W A;  4EI9 A;  5G4U C;  1PXW A;  4C4W C;  4O2B B;  4B45 A;  4C8G A;  5HY4 A;  1K8A H;  3LDT A;  1DT9 A;  1YI2 F;  2GLZ A;  3UT5 A;  2HVY D;  2UYP A;  3T80 A;  1YQN A;  4O4L A;  1W2B F;  2VAW A;  5C8Y A;  3SIU A;  1W5E A;  3FD5 A;  4WBN B;  3F0E A;  2LBT A;  1VQN F;  3UT5 B;  3HTN A;  5A2Q M;  5C8Y B;  2CSL A;  2EWC A;  1NMU B;  4LNU A;  4BT3 A;  3TD4 A;  3LWR C;  3F0G A;  3V7Q A;  1GO0 A;  2F9Z C;  1SZQ A;  3IKE A;  3MBM A;  3IR9 A;  3JAW A;  1K9M H;  3P10 A;  1IPA A;  5J2T A;  4LNU B;  3VYS C;  4ZHQ A;  1W57 A;  4IHJ A;  2HP3 A;  3HKE B;  2ALE A;  3JAW B;  3K14 A;  5FLX M;  2HS3 A;  5J2T B;  4TZZ A;  4ZHQ B;  5EWR A;  1VQ7 F;  3NK7 A;  1W3E X;  2CHS A;  2CHT A;  2KTV A;  3RYI A;  2ZOV A;  4BVT A;  3RE3 A;  2LBW A;  3JAR A;  4X1I B;  3BYQ A;  3S02 A;  3JAK B;  3WGL A;  1M1K H;  2CWJ A;  3FPI A;  3V4D A;  3JAR B;  1FSZ A;  5GIP C;  3CC4 F;  1JFF A;  4O4H A;  5LOV A;  3LWO C;  3VOB A;  3F0F A;  1Q81 H;  2BTO A;  3S03 A;  3VMF B;  1JFF B;  1H48 A;  2QI2 A;  3O85 A;  4O4H B;  5JH7 A;  5LOV B;  5GON B;  1QVG F;  5IJ0 A;  3WPW A;  1VQP F;  3VOA A;  1VHA A;  2B33 A;  1KNJ A;  3AGK A;  1RLU A;  1YHQ F;  5IJ0 B;  1X25 A;  3J81 M;  1X7O A;  2BTU A;  2YXZ A;  2H8E A;  4U3J A;  4X1K A;  5LXT A;  3VCZ A;  1TUB A;  5CA0 A;  2RB9 A;  1JN1 A;  3JVH A;  1CK2 A;  3CCL F;  3WGK A;  5LXT B;  3HKC A;  3RYF A;  1TUB B;  5CA0 B;  3CYQ A;  3CCR F;  3HKD A;  3D00 A;  3G71 F;  1OAP A;  5GIO C;  3HKC B;  3RYF B;  4DRX A;  4EB6 A;  5EIB D;  1QU9 A;  2YYE A;  3OBY A;  2AIF A;  1U3P A;  3HKD B;  4ZHY B;  3VO8 A;  5IJ9 A;  1U3L A;  3GHZ A;  4NWO B;  1YJN F;  4X20 A;  4DRX B;  4EB6 B;  5EIB C;  2JNB A;  3WXM B;  3VIU A;  4BT7 A;  4X20 B;  3CCS F;  4B5C A;  3CPW F;  3LWQ C;  1JD1 A;  3RYC A;  3JAL B;  3JAM M;  3D01 A;  4BVQ A;  3CME F;  4G4Z A;  1UFY A;  3RYC B;  2OTL F;  5HP7 A;  1VQL F;  4BVR A;  3EOR A;  1VK3 A;  1X52 A;  3HJW C;  5HY2 A;  4ZHV A;  1U43 A;  4YJ3 A;  3J80 M;  1K73 H;  5GAN K;  3MQW A;  3VYU C;  2P6Y A;  2KGW A;  2QTP A;  4YJ3 B;  2OTJ F;  5FJ4 C;  4WBN A;  1Q82 H;  3P4E A;  3PAF A;  3HAX D;  3KJJ A;  1VQ8 F;  3GTZ A;  4BT5 A;  3CXC F;  3NVI B;  2RHO A;  3S0H A;  2N48 A;  5EO3 A;  1PF5 A;  3HKB A;  3CPQ A;  3ZO8 A;  3WGN A;  2Q1Y A;  3WGJ A;  4XCQ A;  1SA0 B;  1ONI A;  2UYN A;  5JVD A;  4YJ2 A;  5CB4 B;  3HKB B;  3OBW A;  4X3L A;  3M4S A;  5KMG A;  3HKE A;  3KIZ A;  2UYN B;  5JVD B;  1VQ6 F;  4YJ2 B;  1N8R H;  1YJW F;  3CB2 A;  4G4W A;  5KMG B;  3ESJ A;  5HWE A;  3L7Q A;  4BT2 A;  1T0A A;  3DC2 A;  3MCA B;  1H47 A;  4EI8 A;  1XRG A;  2GVI A;  3C9T A;  4BVS A;  5CA1 B;  2GZL A;  4X1I A;  3CD6 F;  2ZF8 A;  3JAK A;  1CLI A;  5JCO C;  1COM A;  4FFB A;  4U39 A;  4TUY A;  2KG4 A;  5JCO A;  5IT9 M;  1FFX A;  1ODE A;  3JAS A;  2DYY A;  4FFB B;  2ZAU A;  4TUY B;  5MN6 A;  2UYJ A;  1VQ5 F;  1TVK A;  3R0P A;  3VI6 A;  4C8E A;  1FFX B;  1IV4 A;  2BTQ B;  2ZVZ A;  4C8I A;  1VQK F;  3CC7 F;  3JAS B;  3ZP7 A;  1KC8 H;  3LYB A;  1Q86 H;  4LCK A;  5GON A;  1TVK B;  3I56 F;  2Z1U A;  3E20 B;  3I3F A;  2HRY A;  5MN4 A;  5GAP K;  4F6R A;  4I4T A;  1IV3 A;  5HXZ A;  5EZY B;  1W40 A;  2ZVY A;  2ZOD A;  3I55 F;  2H8C A;  4F6R B;  2FGY A;  4I4T B;  4IIJ A;  2Z01 A;  3K12 A;  3TD5 A;  2G9I A;  1YGY A;  4E6E A;  4RQO A;  5EAZ A;  1W58 1;  4IIJ B;  5G4V C;  2CW4 A;  2RHH A;  1RLG A;  5EB1 B;  5LP6 B;  2KTU A;  3MCQ A;  2DT4 A;  1FNJ A;  3S06 A;  1VQV A;  2UZH A;  3E22 A;  3LWP C;  3WJP A;  3C8L A;  3C9S A;  5MN5 A;  5EYP A;  4RHA A;  3WJR A;  3G4S F;  2QEX F;  1KNK A;  2V9Y A;  5J2U A;  4O4I A;  3K0T A;  3E22 B;  4B46 A;  3KE1 A;  4TV8 A;  5EYP B;  1U40 A;  1R1M A;  5J2U B;  4O4I B;  5HXU A;  1DBF A;  2R75 1;  3VYT C;  3NK6 A;  2OHW A;  4TV8 B;  3LFO A;  4C81 A;  1VH8 A;  3JAL A;  3RYH B;  1W5A A;  2H6L A;  2I6D A;  3B6N A;  3LME A;  1QVF F;  1E7K A;  1Z5W A;  3PLA C;  1Q8R A;  2LCA A;  1QD9 A;  3IEW A;  1GX1 A;  3N2K A;  3S0Y A;  4G4Y A;  5AVM A;  3ZOP A;  1RQ7 A;  3CCJ F;  3N2K B;  3N4Z A;  3G6E F;  3J7A R;  2VAM A;  5IYZ A;  3CYP B;  2CVL A;  1SA0 A;  5CB4 A;  2HQS C;  3MDO A;  5IYZ B;  5LA6 A;  2UYK A;  4ZI7 A;  3P0Z A;  3WGM A;  4M8I A;  4TV9 A;  1VQM F; 
#chains in the Genus database with same CATH homology
 1VQ4 F;  5IT9 M;  1YHQ F;  1W41 A;  5GIN C;  1Q7Y H;  2CZW A;  3OW2 F;  3J81 M;  3RA6 A;  1X7O A;  3CCM F;  3CG6 A;  1VQ5 F;  4NQ3 A;  3VI6 A;  1M90 H;  1VQK F;  3CC7 F;  1KC8 H;  2BO1 A;  1Q86 H;  4LCK A;  1CK2 A;  3CCL F;  1VQ9 F;  3I56 F;  4NUT A;  3E20 B;  1KQS F;  1XBI A;  1VQO F;  3SIV A;  5GAP K;  5HXZ A;  1JJ2 F;  3CCR F;  2VGM A;  1ZWZ A;  3D00 A;  3NVK E;  4EI7 A;  1T0K B;  1W40 A;  2QA4 F;  3G71 F;  5HY1 A;  5GIO C;  3I55 F;  3CCV F;  3CCQ F;  3RA5 A;  2FGY A;  2OZB A;  3OBY A;  1H7M A;  2AIF A;  1CN7 A;  5G4U C;  4EI9 A;  1YJN F;  1PXW A;  3CMA F;  4C4W C;  1X7P A;  5HY0 A;  5HY4 A;  5G4V C;  1K8A H;  1GZ0 A;  2WAL A;  2JNB A;  4X3M A;  3V7E A;  1RLG A;  3WXM B;  2KTU A;  2FC3 A;  1DT9 A;  3CCS F;  2GLZ A;  3CPW F;  1YI2 F;  3LWQ C;  3JAM M;  2HVY D;  1W2B F;  3LWP C;  3SIU A;  4BVQ A;  3CME F;  1VQN F;  3G4S F;  3E1Y A;  2QEX F;  3CCE F;  3GYQ A;  2OTL F;  5A2Q M;  1VQL F;  4BVR A;  1NMU B;  3LWR C;  1GO0 A;  3V7Q A;  2F9Z C;  1X52 A;  3HJW C;  5HY2 A;  3IR9 A;  3CCU F;  1K9M H;  5HXU A;  3J80 M;  1K73 H;  1IPA A;  5GAN K;  3NK6 A;  2OHW A;  3FFM A;  1YJ9 F;  3LFO A;  2VGN A;  2ALE A;  3V3T A;  2OTJ F;  5FJ4 C;  3LWV C;  5FLX M;  4TZZ A;  4BY9 D;  3CC2 F;  2I6D A;  3PAF A;  1Q82 H;  3HAX D;  1VQ7 F;  5EWR A;  1VQ8 F;  1QVF F;  3NK7 A;  1W3E X;  3CXC F;  3NVI B;  2KTV A;  3N4Y A;  5EO3 A;  1E7K A;  3CPQ A;  4BVT A;  3NMU C;  2LBW A;  4XCQ A;  3PLA C;  1KD1 H;  5DCV A;  3OBW A;  4X3L A;  1S72 F;  1W42 A;  1M1K H;  2LBX A;  3CCJ F;  1YIT F;  1NJI H;  1GO1 A;  5GIP C;  3CC4 F;  1VQ6 F;  3JCM M;  3N4Z A;  3G6E F;  1N8R H;  1YJW F;  3J7A R;  3LWO C;  1Q81 H;  5HWE A;  1SDS A;  3MCA B;  3VMF B;  4EI8 A;  4BW0 B;  2QI2 A;  3O85 A;  1YIJ F;  4BVS A;  3ON1 A;  1QVG F;  3CD6 F;  1VQP F;  2KG4 A;  1VQM F;  1RA4 A;  3AGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...