3G71H

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
160
Chain Sequence
b'KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 3g71H00
3CC7H 1VQ6H 1VQNH 1KQSH 3CC4H 2ZJQJ 1YHQH 1YIJH 1KC8J 4U67J 3CCEH 4IOAJ 3CCSH 4WFAJ 1W2BH 1VQKH 3CD6H 3CMEH 1KD1J 1Q7YJ 2ZJRJ 3I56H 1K8AJ 3CCUH 3CCQH 1JJ2H 1VQMH 2PA2A 3G6EH 1QVFH 5DM6J 3G4SH 1YITH 4WCEJ 2QA4H 1YJ9H 3DLLJ 1VQPH 3CF5J 5DM7J 5GAGN 3OW2H 1N8RJ 3I55H 1YJWH 3CC2H 3CXCH 3PIPJ 4WFNJ 1VQ9H 1VQOH 4WF9J 2OTJH 3CCLH 2ZJPJ 2OTLH 4UY8M 3CPWH 1QVGH 1VQ8H 4IOCJ 1Q81J 1VQ7H 3CCJH 3CCMH 1Y69K 3G71H 1VQ4H 3J7ZM 5GAEN 4IO9J 5JVHJ 3PIOJ 5MLCO 1K9MJ 3CCRH 1WKIA 5H1SO 1YI2H 5GAHN 1NJIJ 5GADN 1YJNH 4WFBJ 5HL7J 5AN9F 1VQ5H 1K73J 1S72H 1M90J 5JVGJ 1M1KJ 2QEXH 1Q82J 3CMAH 3CCVH 1Q86J 1VQLH
chains in the Genus database with same CATH superfamily
4ZOHA 3CC7H 1VQ6H 1QPOA 1VQNH 1ZXIB 1FM0E 1YTEA 1YTKA 1JRPB 1KQSH 3CC4H 3TQVA 2ZJQJ 1FFUB 1YHQH 1YIJH 1KC8J 5AYYA 4U67J 2W3RB 4AP8A 3PAJA 3CCEH 4KWVA 4IOAJ 3CCSH 1FFVB 1VLBA 2B7QA 3GNNA 4WFAJ 1W2BH 1VQKH 3CD6H 3CMEH 1WYGA 1KD1J 1Q7YJ 1RM6A 4X46A 1QPRA 3EUB4 2ZJRJ 1N5XA 3I56H 1K8AJ 4C80A 3CCUH 3BIIE 1N5WB 3CCQH 1FMAE 3WNZA 1SB3A 3H5QA 4C7ZA 1JJ2H 1VQMH 4YEKA 2PA2A 2I14A 3G6EH 3C2RA 1QVFH 2JBMA 5DM6J 3G4SH 1YITH 1NVIE 4WCEJ 5EP8A 2QA4H 1YJ9H 3DLLJ 4US8A 2WK6A 4C7YA 2TPTA 1VQPH 2E3TA 5EY3A 2WK5A 3CF5J 5DM7J 3WO0A 2OMDA 4LHMA 5HUPA 5GAGN 3OW2H 1N8RJ 3I55H 3C2EA 1YJWH 2J0FA 3CC2H 2I1OA 3L0GA 3NVWC 3WO1A 1AZYA 3L4PA 3FC4A 3NS1C 4KWWA 4WFNJ 3PIPJ 4GA6A 5HULA 3CXCH 1VQ9H 1VQOH 1O4UA 1FIQC 4GA4A 4WF9J 2W55B 3C2VA 4EAFA 2OTJH 3VMMA 2DSJA 3CCLH 2ZJPJ 2OTLH 1QAPA 1FO4A 3CPWH 4UY8M 1N60B 1QVGH 1SIJA 4I9AA 5AYXA 5AYZA 1N62B 3SR6C 1VQ8H 3RPFA 2B7NA 4YYYA 4IOCJ 1Q81J 1VQ7H 3CCJH 5HUOA 3CCMH 1UOUA 1Y69K 3G71H 1QPNA 1VQ4H 1V97A 3B9JC 3NVVC 3J7ZM 4USAA 5GAEN 2W54B 5JVHJ 2WP4A 3PIOJ 4IO9J 5MLCO 1K9MJ 3NVZC 4US9A 3CCRH 1WKIA 3AM9A 2QIEA 3AMZA 3C2FA 5H1SO 5GAHN 1YI2H 3AN1A 4EADA 3ETRC 4GA5A 3C2OA 1NJIJ 3NVYC 1NVJA 2B7PA 5GADN 1N63B 1QPQA 2Q5WE 1YJNH 4WFBJ 5HL7J 5AN9F 1JROB 1OTPA 1VDVA 1VQ5H 1YTDA 1K73J 3FAHA 1S72H 5JVGJ 1M90J 1M1KJ 2QEXH 4XR5A 1BRWA 1Q82J 1DGJA 1N61B 3NRZC 3CMAH 2W3SB 3CCVH 1Q86J 1VQLH 1X1OA 5MPOC
chains in the Genus database with same CATH topology
3CC7H 1VQ6H 1VQNH 1KQSH 3CC4H 2ZJQJ 1YHQH 1YIJH 1KC8J 4U67J 3CCEH 4IOAJ 3CCSH 4WFAJ 1W2BH 1VQKH 3CD6H 3CMEH 1KD1J 1Q7YJ 2ZJRJ 3I56H 1K8AJ 3CCUH 3CCQH 1JJ2H 1VQMH 2PA2A 3G6EH 1QVFH 5DM6J 3G4SH 1YITH 4WCEJ 2QA4H 1YJ9H 3DLLJ 1VQPH 3CF5J 5DM7J 5GAGN 3OW2H 1N8RJ 3I55H 1YJWH 3CC2H 3CXCH 3PIPJ 4WFNJ 1VQ9H 1VQOH 4WF9J 2OTJH 3CCLH 2ZJPJ 2OTLH 4UY8M 3CPWH 1QVGH 1VQ8H 4IOCJ 1Q81J 1VQ7H 3CCJH 3CCMH 1Y69K 3G71H 1VQ4H 3J7ZM 5GAEN 4IO9J 5JVHJ 3PIOJ 5MLCO 1K9MJ 3CCRH 1WKIA 5H1SO 1YI2H 5GAHN 1NJIJ 5GADN 1YJNH 4WFBJ 5HL7J 5AN9F 1VQ5H 1K73J 1S72H 1M90J 5JVGJ 1M1KJ 2QEXH 1Q82J 3CMAH 3CCVH 1Q86J 1VQLH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 H;  1VQ6 H;  1VQN H;  1KQS H;  3CC4 H;  2ZJQ J;  1YHQ H;  1YIJ H;  1KC8 J;  4U67 J;  3CCE H;  4IOA J;  3CCS H;  4WFA J;  1W2B H;  1VQK H;  3CD6 H;  3CME H;  1KD1 J;  1Q7Y J;  2ZJR J;  3I56 H;  1K8A J;  3CCU H;  3CCQ H;  1JJ2 H;  1VQM H;  2PA2 A;  3G6E H;  1QVF H;  5DM6 J;  3G4S H;  1YIT H;  4WCE J;  2QA4 H;  1YJ9 H;  3DLL J;  1VQP H;  3CF5 J;  5DM7 J;  5GAG N;  3OW2 H;  1N8R J;  3I55 H;  1YJW H;  3CC2 H;  3CXC H;  3PIP J;  4WFN J;  1VQ9 H;  1VQO H;  4WF9 J;  2OTJ H;  3CCL H;  2ZJP J;  2OTL H;  4UY8 M;  3CPW H;  1QVG H;  1VQ8 H;  4IOC J;  1Q81 J;  1VQ7 H;  3CCJ H;  3CCM H;  1Y69 K;  3G71 H;  1VQ4 H;  3J7Z M;  5GAE N;  4IO9 J;  5JVH J;  3PIO J;  5MLC O;  1K9M J;  3CCR H;  1WKI A;  5H1S O;  1YI2 H;  5GAH N;  1NJI J;  5GAD N;  1YJN H;  4WFB J;  5HL7 J;  5AN9 F;  1VQ5 H;  1K73 J;  1S72 H;  1M90 J;  5JVG J;  1M1K J;  2QEX H;  1Q82 J;  3CMA H;  3CCV H;  1Q86 J;  1VQL H; 
#chains in the Genus database with same CATH topology
 4ZOH A;  3CC7 H;  1VQ6 H;  1QPO A;  1VQN H;  1ZXI B;  1FM0 E;  1YTE A;  1YTK A;  1JRP B;  1KQS H;  3CC4 H;  3TQV A;  2ZJQ J;  1FFU B;  1YHQ H;  1YIJ H;  1KC8 J;  5AYY A;  4U67 J;  2W3R B;  4AP8 A;  3PAJ A;  3CCE H;  4KWV A;  4IOA J;  3CCS H;  1FFV B;  1VLB A;  2B7Q A;  3GNN A;  4WFA J;  1W2B H;  1VQK H;  3CD6 H;  3CME H;  1WYG A;  1KD1 J;  1Q7Y J;  1RM6 A;  4X46 A;  1QPR A;  3EUB 4;  2ZJR J;  1N5X A;  3I56 H;  1K8A J;  4C80 A;  3CCU H;  3BII E;  1N5W B;  3CCQ H;  1FMA E;  3WNZ A;  1SB3 A;  3H5Q A;  4C7Z A;  1JJ2 H;  1VQM H;  4YEK A;  2PA2 A;  2I14 A;  3G6E H;  3C2R A;  1QVF H;  2JBM A;  5DM6 J;  3G4S H;  1YIT H;  1NVI E;  4WCE J;  5EP8 A;  2QA4 H;  1YJ9 H;  3DLL J;  4US8 A;  2WK6 A;  4C7Y A;  2TPT A;  1VQP H;  2E3T A;  5EY3 A;  2WK5 A;  3CF5 J;  5DM7 J;  3WO0 A;  2OMD A;  4LHM A;  5HUP A;  5GAG N;  3OW2 H;  1N8R J;  3I55 H;  3C2E A;  1YJW H;  2J0F A;  3CC2 H;  2I1O A;  3L0G A;  3NVW C;  3WO1 A;  1AZY A;  3L4P A;  3FC4 A;  3NS1 C;  4KWW A;  4WFN J;  3PIP J;  4GA6 A;  5HUL A;  3CXC H;  1VQ9 H;  1VQO H;  1O4U A;  1FIQ C;  4GA4 A;  4WF9 J;  2W55 B;  3C2V A;  4EAF A;  2OTJ H;  3VMM A;  2DSJ A;  3CCL H;  2ZJP J;  2OTL H;  1QAP A;  1FO4 A;  3CPW H;  4UY8 M;  1N60 B;  1QVG H;  1SIJ A;  4I9A A;  5AYX A;  5AYZ A;  1N62 B;  3SR6 C;  1VQ8 H;  3RPF A;  2B7N A;  4YYY A;  4IOC J;  1Q81 J;  1VQ7 H;  3CCJ H;  5HUO A;  3CCM H;  1UOU A;  1Y69 K;  3G71 H;  1QPN A;  1VQ4 H;  1V97 A;  3B9J C;  3NVV C;  3J7Z M;  4USA A;  5GAE N;  2W54 B;  5JVH J;  2WP4 A;  3PIO J;  4IO9 J;  5MLC O;  1K9M J;  3NVZ C;  4US9 A;  3CCR H;  1WKI A;  3AM9 A;  2QIE A;  3AMZ A;  3C2F A;  5H1S O;  5GAH N;  1YI2 H;  3AN1 A;  4EAD A;  3ETR C;  4GA5 A;  3C2O A;  1NJI J;  3NVY C;  1NVJ A;  2B7P A;  5GAD N;  1N63 B;  1QPQ A;  2Q5W E;  1YJN H;  4WFB J;  5HL7 J;  5AN9 F;  1JRO B;  1OTP A;  1VDV A;  1VQ5 H;  1YTD A;  1K73 J;  3FAH A;  1S72 H;  5JVG J;  1M90 J;  1M1K J;  2QEX H;  4XR5 A;  1BRW A;  1Q82 J;  1DGJ A;  1N61 B;  3NRZ C;  3CMA H;  2W3S B;  3CCV H;  1Q86 J;  1VQL H;  1X1O A;  5MPO C; 
#chains in the Genus database with same CATH homology
 3CC7 H;  1VQ6 H;  1VQN H;  1KQS H;  3CC4 H;  2ZJQ J;  1YHQ H;  1YIJ H;  1KC8 J;  4U67 J;  3CCE H;  4IOA J;  3CCS H;  4WFA J;  1W2B H;  1VQK H;  3CD6 H;  3CME H;  1KD1 J;  1Q7Y J;  2ZJR J;  3I56 H;  1K8A J;  3CCU H;  3CCQ H;  1JJ2 H;  1VQM H;  2PA2 A;  3G6E H;  1QVF H;  5DM6 J;  3G4S H;  1YIT H;  4WCE J;  2QA4 H;  1YJ9 H;  3DLL J;  1VQP H;  3CF5 J;  5DM7 J;  5GAG N;  3OW2 H;  1N8R J;  3I55 H;  1YJW H;  3CC2 H;  3CXC H;  3PIP J;  4WFN J;  1VQ9 H;  1VQO H;  4WF9 J;  2OTJ H;  3CCL H;  2ZJP J;  2OTL H;  4UY8 M;  3CPW H;  1QVG H;  1VQ8 H;  4IOC J;  1Q81 J;  1VQ7 H;  3CCJ H;  3CCM H;  1Y69 K;  3G71 H;  1VQ4 H;  3J7Z M;  5GAE N;  4IO9 J;  5JVH J;  3PIO J;  5MLC O;  1K9M J;  3CCR H;  1WKI A;  5H1S O;  1YI2 H;  5GAH N;  1NJI J;  5GAD N;  1YJN H;  4WFB J;  5HL7 J;  5AN9 F;  1VQ5 H;  1K73 J;  1S72 H;  1M90 J;  5JVG J;  1M1K J;  2QEX H;  1Q82 J;  3CMA H;  3CCV H;  1Q86 J;  1VQL H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...